CLUSTAL format seed alignment for MF_00258

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MURI_ECOLI       MATKLQDGNTPCLAATPSE----PRPTVLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNV
MURI_ECO57       MATKLQDGNTPCLAATPSE----PRPTVLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNV
MURI_SALTY       MATKLQDENTPCLAATPSE----PRPTVLVFDSGVGGLSVYDEIRRLLPDLHYIYAFDNV
MURI_YERPE       MATKPQDANTTSREAITSKADSPPRPTALIFDSGVGGLSVYQEIRQLLPDLHYIYAFDNV
MURI_HAEIN       MDKKEK------------------RPTVLFFDSGVGGFSVYREAKKLLPNWHYLYCFDNA
MURI_PASMU       -MNSPY------------------QPTILFFDSGMGGFSVYKETKQLLPDCHYLYCFDNA
MURI_VIBCH       -MSSPS------------------FPRVLIFDSGVGGLSVYREIEARLPQLNYIYLFDNA
MURI_BUCAI       ---------------------------MLIFDSGVGGLSILKNIKKILPNIHYIYMLDNE
MURI_NOSS1       ----MYSSSSIEGNLYGFSAQEPQRAPIGVFDSGVGGLTVLRQIYRQLPNESVIYFGDTA
MURI_SYNY3       -------------------MREPQRSRIGVFDSGVGGLTVLRELYRQLPKESILYFGDTA
MURI_NEIMA       ------------------MENIGRQRPIGVFDSGIGGLTNVRALMERLPMENIIYFGDTA
MURI_NEIMC       ------------------MENIGRQRPIGVFDSGIGGLTNVRALMERLPMENIIYFGDTA
MURI1_BACSU      ----------------------MLEQPIGVIDSGVGGLTVAKEIMRQLPKENIIYVGDTK
MURI_BACC1       ---------------------MKLNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTA
MURI_LISIN       -----------------------MKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTA
MURI_LISMO       -----------------------MKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTA
MURI_CARST       ----------------------MKKQAIGFIDSGVGGLTVVKEAMRQLPNESIYYVGDTA
MURI_LYSSH       -----------------------MNAPIGVIDSGVGGLTVAKEIIKRLPNETIYYIGDTA
MURI_STAAM       -----------------------MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIG
MURI_STAHA       -----------------------MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIA
MURI_STRPN       ----------------------MDNRPIGFLDSGVGGLTVVRELMRQLPHEEIVYIGDSA
MURI_STRP1       ----------------------MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSA
MURI_LACLA       ----------------------MDNRPIGLLDSGVGGLTVARELLRQLPNEEIVYIGDTR
MURI_LACBR       ----------------------MQNDPIGLMDSGVGGLTVLKEVQRLLPTENTVFLGDQA
MURI_PEDPE       ----------------------MDNRPIGFMDSGVGGLTVVKTAQKLLPNEEIIFIGDEA
MURI_LACFE       ----------------------MDNRPIGVMDSGLGGLSVVRVIQQKLPNEEVIFVGDQG
MURI_MYCLE       --------------------MSSPLLPVGVFDSGVGGLTVARAIIDQLPDEDIVYVGDTG
MURI_MYCTU       --------------------MNSPLAPVGVFDSGVGGLTVARAIIDQLPDEDIVYVGDTG
MURI_CORGL       ---------------MIERPVPGADAPIGIFDSGVGGLTVARTIIDQLPHESVIYIGDTA
MURI_AQUAE       -------------------------MKIGIFDSGAGGMTVLKAIREAYPNVDVVYLGDTA
MURI_AQUPY       -------------------------MKIGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTA
MURI_HELPY       -------------------------MKIGVFDSGVGGFSVLKSLLKAQLFDEIIYYGDSA
MURI_HELPJ       -------------------------MKIGVFDSGVGGFSVLKSLLKARLFDEIIYYGDSA
MURI_CAMJE       -------------------------MKIGVFDSGVGGLSVLKSLYEARLFDEIIYYGDTA
MURI_CLOAB       --------------------MSVKNNPIGVIDSGVGGISVLKEAVKQLPYENFIYYGDSK
MURI_CLOPE       ------------------MQDDLKNAPIGFFDSGLGGLSVLRKALEMMPNENYIYYGDSK
MURI2_BACSU      -------------------------MKIGFFDSGIGGMTVLYEAIKVLPYEDYIFYADTL
MURI_PSEAE       --------------------MAVESAAVGVFDSGVGGLSVLREIRARLPSESLLYVADNA
MURI_RALSO       -------------------MTTRAQAPVGVFDSGLGGLSVLRAIRAELPAESLLYLADSR
MURI_DEIRA       --------MPPVSFAAASDPAPRSALPIGVFDSGAGGLSVLAELQRALPQEDVLYLADTA
MURI_BRUME       -------MKKAPAGSFPAKPTIAPERPILVFDSGIGGLTVLREARVVMPDRRFVYIADDA
MURI_RHIME       -------------------MTKTELKPILVFDSGIGGLTVLREARVLMPERHFIYVADDA
MURI_RHILO       ----------------------MTDQPILMFDSGVGGLTVLREARVLMPDRRFVYVADDA
MURI_TREPA       ------------------MSDRREQFQYAFLDSGIGGLPYAHALRVRVPEASLVYVADRV
MURI_BORBU       --------------------MKNFKEVIIIFDSGIGGLSYFKYIKSRIGGCQYVYVADNK
                                              .:*** **:.               :  *  

MURI_ECOLI       AFPYGEKSEAFIVERVVAIVTAVQERYPLALAVVACNTASTVSLPALREKF-DFPVVGVV
MURI_ECO57       AFPYGEKSEAFIVERVVAIVTAVQERYPLALAVVACNTASTVSLPALREKF-DFPVVGVV
MURI_SALTY       AFPYGEKSETFIVERVVEIVTAVQQRYPLSLAVIACNTASTVSLPALREKF-AFPVVGVV
MURI_YERPE       AFPYGEKSGEFIVERVLEIVTAVQQRHPLAIVVIACNTASTVSLPALRERF-AFPVVGVV
MURI_HAEIN       GFPYSERKEESIIHRTLAACQLINQRYPLDAMVIACNTASTVVLPPLRAAF-DIPIIGTV
MURI_PASMU       FFPYSEKSEEEIIQRTLKICQKIDRTFPLDLIVIACNTASTVVLPALRAHF-AIPVVGTV
MURI_VIBCH       AYPYGELTQETLIARVDTLVTRMVEQERIDLVVIACNTASTIVLPVLRAKL-TIPVVGVV
MURI_BUCAI       SFPYGNKTEFFIIQRSIKIIHTIKKIYPINVVVIACNTISTVALSILRKKF-DIPIFGIF
MURI_NOSS1       RLPYGIRSQAEILTFVRDILDWMQQ-QHVKMVVMACNTSSALALDIVREEY-DFPILGVI
MURI_SYNY3       RLPYGKRSPQVILQYVREILTWMAA-EEVKMVIMACNTSSALALETVQQEF-NMPILGVI
MURI_NEIMA       RVPYGTKSKATIENFSMQIVDFLLE-HDVKAMVIACNTIAAVAGQKIRQKTGNMPVLDVI
MURI_NEIMC       RVPYGTKSKATIENFSMQIVDFLLE-HDVKAMVIACNTIAAVAGQKIRQKTGNMPVLDVI
MURI1_BACSU      RCPYGPRPEEEVLQYTWELTNYLLENHHIKMLVIACNTATAIALDDIQRSV-GIPVVGVI
MURI_BACC1       RCPYGPRSREEVRQFTWEMTEHLLD-LNIKMLVIACNTATAVVLEEMQKQL-PIPVVGVI
MURI_LISIN       RCPYGPRDKEEVAQFTWEMTNFLVD-RGIKMLVIACNTATAAALYDIREKL-DIPVIGVI
MURI_LISMO       RCPYGPRDKEEVAKFTWEMTNFLVD-RGIKMLVIACNTATAAALYDIREKL-DIPVIGVI
MURI_CARST       RCPYGPRPEDQVRKFTWEMTHFLLD-KNIKMLVIACNTATAAALKDIKKKL-AIPVIGVI
MURI_LYSSH       RCPYGPRTRQEVRNFTWQMAKALEK-MNIKMLVIACNTATAVALESLQRNM-PFPVLGVI
MURI_STAAM       RCPYGPRPGEQVKQYTVEIARKLME-FDIKMLVIACNTATAVALEYLQKTL-SIPVIGVI
MURI_STAHA       RCPYGPRPGDEVKQFTTQLANKLMQ-FDIKMLVIACNTATAVALEHLQQML-PIPVIGVI
MURI_STRPN       RAPYGPRPAEQIREYTWQLVNFLLT-KDVKMIVIACNTATAVVWEEIKAQL-DIPVLGVI
MURI_STRP1       RAPYGPRPKKQIKEYTWELVNFLLT-QNVKMIVFACNTATAVAWEEVKAAL-DIPVLGVV
MURI_LACLA       RAPYGPRSREQIIAFTWDMVNFLLS-KDVKMIVMACNTATAMALEIVKEKL-DIPVIGVI
MURI_LACBR       RLPYGPRSVAEVTMFTKQIAQFLRQQARIKALVIACNTATAAALTTMQQTL-PIPVIGVI
MURI_PEDPE       RMPYGPRPTAEVVEFSRQMASFLMTK-NIKALVIACNTATNAALAVLQAEL-PIPVIGVI
MURI_LACFE       HFPYGTKDQAEVRQLALSIGAFLLKH-DVKMMVVACNTATAAALPALQAAL-PIPVIGVI
MURI_MYCLE       NGPYGPLSIPEIRAHALAICDDLVG-RGVKILVIACNTASAACLRDARERY-DVPVVEVI
MURI_MYCTU       NGPYGPLTIPEIRAHALAIGDDLVG-RGVKALVIACNSASSACLRDARERY-QVPVVEVI
MURI_CORGL       NGPYGPLPIAKVREHAIRIADELVE-RGCKMIVIACNTASAAFLRDARERY-SVPVVEVI
MURI_AQUAE       RVPYGIRSKETIVRYSKECANFLKD-KGVDLLVVACNTASAYALEELKREF-PFPVFGVI
MURI_AQUPY       RVPYGIRSKDTIIRYSLECAGFLKD-KGVDIIVVACNTASAYALERLKKEI-NVPVFGVI
MURI_HELPY       RVPYGTKDPTTIKQFGLEALDFFKP-HQIKLLIVACNTASALALEEMQKHS-KIPVVGVI
MURI_HELPJ       RVPYGTKDPTTIKQFGLEALDFFKP-HEIELLIVACNTASALALEEMQKYS-KIPIVGVI
MURI_CAMJE       RVPYGVKDKDTIIKFCLEALDFFEQ-FQIDMLIIACNTASAYALDALRAKA-HFPVYGVI
MURI_CLOAB       NAPYGIKSVDEVRNLTFNVVEKLLK-LNIKALVVACNTATSAAIDELREKYKNIPVIGIE
MURI_CLOPE       HAPYGEKTPQEIRSLSFNAIEFLIK-KGAKAIVIACNTATSAAAHDLREYYKDIPIIGIE
MURI2_BACSU      NVPYGEKSKGKVKEYIFNAAEFLAS-QNIKALVIACNTATSIAIEDLRRNF-DFPIIGIE
MURI_PSEAE       HVPYGEKSAEYIRERCERIGDFLLE-QGAKALVLACNTATAAAAAELRERYPQVPLVAME
MURI_RALSO       HAPYGEKPPEFIAGRTLRVCEWLVG-QGCKALVIACNTATAQAVHLLREQLA-VPVIGVE
MURI_DEIRA       HVPYGARSDEDIRDLTARAVAELVR-RGVKAVVVACNTASAFSLTHLRERFE-LPIIGLV
MURI_BRUME       GFPYGNWEEEALKRRIIELFGEFIANYDPEIAVIACNTASTLVLEDLRRAYPSVPFVGTV
MURI_RHIME       GFPYGGWEEGALKERVIALFGRLLAELDPEICIIACNTAFTLVGADLRAAYPQMTFVGTV
MURI_RHILO       AFPFGAWEEPALRTHILDLFVKLLDRFAPAISVIACNTASTLVIDALRERFPGHPFVGTV
MURI_TREPA       YFPYGNKSSAQIIARASAVLQKVQTNFSPHIVVLACNSMSVNALEFLRAQV-SVPVVGVV
MURI_BORBU       NFPYGEKSPEYLLEAVLFLIEKLKKIYNIGALVLACNTISVSVYNKLNFVF---PVVYTL
                   *:.      :          .         :.***:         .      ..    

MURI_ECOLI       ---PAIKPAARLTANGIVGLLATRGTVKRSYTHELIARFAN--ECQIEMLGSAEMVELAE
MURI_ECO57       ---PAIKPAARLTANGIVGLLATRGTVKRSYTHELIARFAN--ECQIEMLGSAEMVELAE
MURI_SALTY       ---PAIKPAARLTANGVVGLLATRATVKRPYTHELIARFAN--ECQIAMLGSAELVELAE
MURI_YERPE       ---PAIKPAVRLTRNGVVGLLATRATVHASYTLDLIARFAT--DCKIELLGSSELVEVAE
MURI_HAEIN       ---PAIKPASEITKTKHIGLLATKGTVKRHYIDELIDKFAQ--DCIVERLGTTKLVEIAE
MURI_PASMU       ---PAIKPAAECSETKHIGLLATKGTVKRAYVADLIAQYAR--DCTVEKLGSTKLVEIAE
MURI_VIBCH       ---PAIKPAS-LIASKAIGLIATPATVKRQYTQELIRDFSA--NKNVELLGSTRLVNMAE
MURI_BUCAI       ---PHIKAAEKITKNKIIGLIATKATINSSYTQKIIYEYSC--SNTIKIIGTNKLAVIAE
MURI_NOSS1       LPGAKAAVQQG--K--RIGVISTPATAKSNAYRQAIWEIDP--NVEVWQVGCPEFVPLIE
MURI_SYNY3       LPGARAAVRQG--R--RIGVISTPATAASNAYRHAIHEITP--DALVWQMACPEFVPLIE
MURI_NEIMA       SAGAKAALATT--RNNKIGIIATNTTVNSNAYARAIHRNNP--DTLVRTQAAPLLVPLVE
MURI_NEIMC       SAGAKAALATT--RNNKIGIIATNTTVNSNAYARAIHRNNP--DTLVRTQAAPLLVPLVE
MURI1_BACSU      QPGARAAIKVT--DNQHIGVIGTENTIKSNAYEEALLALNP--DLKVENLACPLLVPFVE
MURI_BACC1       HPGSRTALKMT--NTYHVGIIGTIGTVKSGAYEEALKSINN--RVMVESLACPPFVELVE
MURI_LISIN       QPGSRAALKAT--RNNKIGVLGTLGTVESMAYPTALKGLNR--RVEVDSLACPKFVSVVE
MURI_LISMO       QPGSRAALKAT--RNNKIGVLGTLGTVESMAYPTALKGLNR--RVEVDSLACPKFVSVVE
MURI_CARST       LPGSRAAIKAT--HTNRIGVIGTEGTVKSNQYKKMIHSKDT--KALVTSLACPKFVPLVE
MURI_LYSSH       NRGARAAVKKT--KRHEVVVLATEGTIKSGAYEEALLSLNT--STHIIPLACPTFVPLVE
MURI_STAAM       EPGARTAIMTT--RNQNVLVLGTEGTIKSEAYRTHIKRINP--HVEVHGVACPGFVPLVE
MURI_STAHA       EPGSRTAIMTT--KNQNVLILGTEGTIKSEAYRHHIKHINP--NVHVLWCGLPGFVPLVE
MURI_STRPN       LPGASAAIKSS--QGGKIGVIGTPMTVQSDIYRQKIHDLDP--DLQVESLACPKFAPLVE
MURI_STRP1       LPGASAAIKST--TKGQVGVIGTPMTVASDIYRKKIQLLAP--SIQVRSLACPKFVPIVE
MURI_LACLA       LPGASSAIQKT--KTNKIGVIATQASIRSDEYHKTIARKSS--AVEVYSLACPKFVSIVE
MURI_LACBR       APGAQAAVQTT--RNHRIGVIATAGTVKSDQYRRDILAAAP--NSQIFSVACPEMVTLAE
MURI_PEDPE       LPGAIAANRQT--KNQKIGVIATLGTIKSEAYPKALAEINT--KLRAYPVACQEFVEIAE
MURI_LACFE       EPGARAALAQD--KKGPIGVIATTATTTAGAYPATIERLAP--GTPVIAKATQPMVEIVE
MURI_MYCLE       LPAVRRAVAAT--RNGRIGVIGTRATIASHAYQDAFAA-AR--DTEITAVACPRFVDFVE
MURI_MYCTU       LPAVRRAVAAT--RNGRIGVIGTRATITSHAYQDAFAA-AR--DTEITAVACPRFVDFVE
MURI_CORGL       LPAVRRAVAST--RNGKVGVIGTVGTINSGAYQDLFSA-SP--SIVVNAVACPRFVDFVE
MURI_AQUAE       EPGVKEALRKS--KTKRIGVIGTQATIKSGAYQEALK--RA--GAEVYSKACPLFVPLVE
MURI_AQUPY       EPGVKEALKKS--RNKKIGVIGTPATVKSGAYQRKLE--EG--GADVFAKACPLFVPLAE
MURI_HELPY       EPSILAIKRQVKDKNAPILVLGTKATIQSNAYDNALKQ-QG--YLNVSHLATSLFVPLIE
MURI_HELPJ       EPSILAIKRQVEDKNAPILVLGTKATIQSNAYDNALKQ-QG--YLNISHLATSLFVPLIE
MURI_CAMJE       DAGVEATIKALHDKNKEILVIATKATIKSEEYQKRLLS-QG--YTNINALATGLFVPMVE
MURI_CLOAB       -PALKPAVELKR--RGKIIIMATPMTLSEVKFKNLMEKYE--KDSEIVKLPCPGLVELIE
MURI_CLOPE       -PALKPAIKLHE--TGSVIVMATKATLTQEKFKNLMDKYG--EHREVIPLPCPGLVEFIE
MURI2_BACSU      -PAVKPAINKCTEERKRVLVVATNLTLKEEKFHNLVKEID--HHDLVDCLALPGLVEFAE
MURI_PSEAE       -PAVKPAAAATR--NGRVGVLATTGTLKSARFAALLDRFA--SDVQVFTQPCPGLVERIE
MURI_RALSO       -PGLKPAVATSR--SRVVGVLATESTLRSDKFARLLGNVS--GDCRVLCQPGYGLVPLIE
MURI_DEIRA       -PAVKPAVAATK--SGVVGVLATPGTLRGTLLADVIRQWAEPAGVRVMQAVSTELVPLVE
MURI_BRUME       -PAIKPAAERT--SSGLVSVLATPGTVKRAYTRDLIQSFAS--RCHVRLVGADGLAAIAE
MURI_RHIME       -PAIKPAAERT--RSGLVSVLATPGTVKRAYTRDLIQSFAS--QCHVRLVGSENLARMAE
MURI_RHILO       -PAVKPAAERT--RSGLVSVLATPGTVKRQYTRDLISKWAQ--KCHVRLVGSDRLAGLAE
MURI_TREPA       -PAIKQAVACS--HKKHIGVLATQCTITHPYTACLRAQFGA--GCVFQMRADARLIECLE
MURI_BORBU       PDVSSVSDLVL----KRVLLIATNTTLESKFVKDQVNIHND-----LIVKAAGELVNFVE
                                  : ::.*  :                            :    *

MURI_ECOLI       AKLHGEDVSLDALKRILRPWLR--MKEPPDTVVLGCTHFPLLQEELLQVL--PEGTRLVD
MURI_ECO57       AKLHGEDVSLDALKRILRPWLR--MKEPPDTVVLGCTHFPLLQEELLQVL--PEGTRLVD
MURI_SALTY       AKLHGDSVSLEELRRILRPWLR--MPEPPDTVVLGCTHFPLLRDELLQVL--PEGTRLVD
MURI_YERPE       TKLHGGVVPLEVLKKILHPWLS--MREPPDTIVLGCTHFPLLTEELAQVL--PEGTRMVD
MURI_HAEIN       QKIRGHSVDLISLKDELSSWAG--MADL-DTLVLGCTHFPLIKDEIQLCL--PQVKYFME
MURI_PASMU       QKLHGKAVDLHALKQELAPWQS--IQNL-DTVVLGCTHFPLIKEEIKWCL--PQVRFFVD
MURI_VIBCH       EKLRGKPLDLEELASILQP-----LKNTIDVAVLGCTHFPLIKEEIQQVL--GEQVQLID
MURI_BUCAI       KKIRGVAVSQKKLKNIFRPWIN--LPTCPDTIILGCTHFSLLEKEIKNILYKTRSVYFID
MURI_NOSS1       ---QNRIQD-PYTTEVARAYLEPLIQQDIDTLVYGCTHYPLLAPVLRSLL--PPQVKIID
MURI_SYNY3       ---QNRLHD-PYTLEVAKGYLQPLLDADIDTLVFGCTHYRHLTPVFQQIL--PSHIRLVD
MURI_NEIMA       ---EGWLEH-EVTRLTVCEYLKPLLADGIDTLVLGCTHFPLLKPLIGRE---AGNVALVD
MURI_NEIMC       ---EGWLEH-EVTRLTVCEYLKPLLADGIDTLVLGCTHFPLLKPLIGRE---AHNVALVD
MURI1_BACSU      ---SGKFLD-KTADEIVKTSLYPLKDTSIDSLILGCTHYPILKEAIQRYM--GEHVNIIS
MURI_BACC1       ---SGNFES-EMAYEVVRETLQPLKNTDIDTLILGCTHYPILGPVIKQVM--GDKVQLIS
MURI_LISIN       ---SGEYKS-AIAKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENFM--GDGVAVIN
MURI_LISMO       ---SGEYKS-AIAKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENFM--GDGVAVIN
MURI_CARST       ---SNEYSS-AIAKKVVAETLRPLKNEGLDTLILGCTHYPLLRPIIQNTL--GDSVTLID
MURI_LYSSH       ---SGEYKG-QFANNLIAEGLKPLKNEQFDTVILGCTHYPILQKQIEAVV--GEDVFVLS
MURI_STAAM       ---QMRYSDPTITSIVIHQTLKRWRNSESDTVILGCTHYPLLYKPIYDYF--GGKKTVIS
MURI_STAHA       ---QMRYDDPTITSIVIHQTLKQWRNTDADTIILGCTHYPLLYKPINDYF--GGEKKVIS
MURI_STRPN       ---SGALST-SVTKKVVYETLRPLVG-KVDSLILGCTHYPLLRPIIQNVM--GPKVQLID
MURI_STRP1       ---SNEMCS-SIAKKIVYDSLAPLVG-KIDTLVLGCTHYPLLRPIIQNVM--GPSVKLID
MURI_LACLA       ---SNEMES-EIARKVVSESLVPLIG-KVDTLILGCTHYPLLRSLIQETM--GKEVRLID
MURI_LACBR       ---QNDLTT-THAQSVVAANLASLMDKKIDTLVMGCTHFPLLRSAIQHAV--GSQVTLVD
MURI_PEDPE       ---KNELHT-TAAQKVMNEKLAEFRQDQIDTLILGCTHFPLLEEGIQAAV--GPDVTLVD
MURI_LACFE       ---HGQTGT-AKAQEVVSEQLMTFKEHPVKTLIMGCTHFPFLAPEISKAV--GPTVALVD
MURI_MYCLE       ---CGVTSG-RQVLGLAEGYLEPLQRSGVDTLVLGCTHYPLLAGLIQLAM--GENVTLVS
MURI_MYCTU       ---RGVTSG-RQVLGLAQGYLEPLQRAEVDTLVLGCTHYPLLSGLIQLAM--GENVTLVS
MURI_CORGL       ---RGITSG-RQILNIAQDYLEPLQAEGVDTLVLGCTHYPLLSGVIQLAM--GDHVSLVS
MURI_AQUAE       ---EGMIEG--EIPKKVVEHYLKDFKGKVDTLILGCTHYPLLKREIQNFL--EGVNVIDS
MURI_AQUPY       ---EGLLEG--EITRKVVEHYLKEFKGKIDTLILGCTHYPLLKKEIKKFL--GDVEVVDS
MURI_HELPY       ---ESILEG--ELLETCMRYYFTPLEILPEVVILGCTHFPLIAQKIEGYF--MEHFALST
MURI_HELPJ       ---ESILEG--ELLETCMHYYFTPLEILPEVIILGCTHFPLIAQKIEGYF--MGHFALPT
MURI_CAMJE       ---EGIFEG--DFLQSAMEYYFKNITT-PDALILACTHFPLLGRSLSKYF--GDK-----
MURI_CLOAB       ---DGIVEG-EKMQEYLRNKFKDYEKDDIAAFVLGCTHYPFVKKEIASIA--RD-VPIID
MURI_CLOPE       ---AGDLEG-EDVKNFLREKLNPYMDREISSIVLGCTHYPFVKDVIQDLV--GEKVDIID
MURI2_BACSU      ---NFDFSE-DKIIKYLKNELSSFDLKQYGTIVLGCTHFPFFKNSFEKLF--GIKVDMIS
MURI_PSEAE       ---AGDLYG-PQTRALLERLLAPILEQGCDTLILGCTHYPFVKPLLAELI--PAEMAVID
MURI_RALSO       ---RGDTHS-PAVLELLRAYLLPMLEAGADTLVLGCTHYPFLQDAIREIA--GDRLTLID
MURI_DEIRA       ---AGKADS-PEARVVLRDVLEPLAEAGADQLVLGCTHYPFLAGSIRAEF--GDTFALVD
MURI_BRUME       AHIRGESFDEALVMAQIAPCFIEKDGKRTDIVVLACTHYPFLVNVLRRLA--PWPVDWLD
MURI_RHIME       AYIRGDALADEAVLAEIEPCFVEAEGKRTDIVVLACTHYPFMSNVFRRLA--PWPVDWLD
MURI_RHILO       VYMREGFVDEEAVRAEIAPCFMEHEGLRTDIVVLACTHYPFLVNRMRKTA--PWPVDWID
MURI_TREPA       R--GLIFEVEDMQREAVARSVMPFQEAGVDVLVLACTHFVHVRHLFQDCV--GTSCTVVD
MURI_BORBU       ----YGENYKKYALRCLEALKFEVVNTGREIVFLGCTHYLHLKVMIEDFL----KIPVYE
                                                 . .***:  .   :              

MURI_ECOLI       SGAAIARRTAWLLEHEAPDAKSAD-----ANIAFCMAMTPGAEQLLPVLQRYGFETLEKL
MURI_ECO57       SGAAIARRTAWLLEHEAPDAKSAD-----ANIAFCMAMTPEAEQLLPVLQRYGFETLEKL
MURI_SALTY       SGAAIARRTAWLLEHEAPDAKSTD-----ANIAYCMAMTPGAEQLLPVLQRYGFETLEKL
MURI_YERPE       SGAAIARRTAWLISSQENVISSQD-----ENIAYCMALDEDTDALLPVLQSYGFPKLQKL
MURI_HAEIN       PSAAIAKRIKYLLDDKNLQAQNEK-----YNQMFCTAHFPEESQFKKALHLWGFESLEVI
MURI_PASMU       SGKAIALRVKTLLSKIDIQSKTNE-----KNLIFCTQFFEDETQFQKVIHFWGFEQLINL
MURI_VIBCH       SGLAIARRVQELLG-IEQAVGAKQ-----KHRIYASAPPWEESALNIKLEQLGFNPVQPF
MURI_BUCAI       SIKKVIFQIESYLKTSNVNQKIKK-----NIFLYSKNNN-NLKKLLSFLKQYKFTVIKHI
MURI_NOSS1       PAVHVVTACTQELD-LLGLSNTH---PPLPTRFAVSGCPQQFSQSGVHWLGYTPLVEAVD
MURI_SYNY3       PASHVVKAARQELE-VMGLRNSE---MSIATRFTVSGCPQQFAELSHQWLGFTPMVEKIS
MURI_NEIMA       SAITTAEETARVLA-QEGLLNTDN--NNPDYRFYVSDIPLKFRTIGERFLGRT--MEQIE
MURI_NEIMC       SAITTAEETARVLA-QEGLLNTDN--NNPDYRFYVSDIPLKFRTIGERFLGRT--MEQIE
MURI1_BACSU      SGDETAREVSTILS-YKGLLNQSP--IAPDHQFLTTGARDQFAKIADDWFGHEVGHVECI
MURI_BACC1       SGDETAREVSTILY-HSKMLNEGE--EQSDHLFLTTGKIGLFKEIASKWFGQPIENVKHI
MURI_LISIN       SGEETASEVSALLD-YHNLLDATD--DEIEHRFFTTGSTQIFKDIAKDWLNMPDMTVEHI
MURI_LISMO       SGEETASEVSALLD-YHNLLDATD--EEIEHRFFTTGSTQIFKDIAKDWLNMPDMTVEHI
MURI_CARST       SGAETVSEVSTILD-YFNLAVDSQNKEKAERNFYTTGSSQMFHAIASEWLQLDDLAVEHI
MURI_LYSSH       SAEETAKDVEEMLA-YNGTLADTN--AKPAHKFYATGSVPIFRSIAENWLEQGTLDIHRI
MURI_STAAM       SGLETAREVSALLT-FSNEHASYT--EHPDHRFFATGDPTHITNIIKEWLNLSV-NVERI
MURI_STAHA       SGLETAREVSALLT-FSNEHASYT--QHPEHRFFATGDTVHIKNIILQWLKLDV-EVERI
MURI_STRPN       SGAECVRDISVLLN-YFEINRGRDA-GPLHHRFYTTASSQSFAQIGEEWLE-KEIHVEHV
MURI_STRP1       SGAECVRDISVLLN-YFDINGNYHQ-KAVEHRFFTTANPEIFQEIASIWLK-QKINVEHV
MURI_LACLA       SGAEAVRDISVLLN-YFSIN-GQER-QPLEHRFYTTAGVNSFREIAEKWLNIGQLQIEHT
MURI_LACBR       PGLATAEQTVAILK-TRGLLNSATT--RGTAQFFTTGETDQFDTLASQWLDQQPTPAKHV
MURI_PEDPE       PGVETVHQLIEILT-KQALQHAEGP--KAQDQYYSTGNIKNFEEIARTFLNQD-LRVEEV
MURI_LACFE       PAKETVATAKSWLE-QHQAMGNHA---HPNYHLYSTGNLPDLRAGVNKWLLSGHFDLGTA
MURI_MYCLE       SAEETAKEVLRVLT-ERDLLRRHDAPPV-NRVFEATGDPEAFIQLAARFLGPAVSGVQPA
MURI_MYCTU       SAEETAKEVVRVLT-EIDLLRPHDAPPA-TRIFEATGDPEAFTKLAARFLGPVLGGVQPV
MURI_CORGL       SAEETAKDVLRILS-QQDLLADPDMHPEPSYSFESTGDPEIFAQLSRRFLGPIVSQVRQN
MURI_AQUAE       SRATAKSLKDFVKNEGSG-SLELYFTDRSQNLERLIKLILGEEVEPKITSEVFVL-----
MURI_AQUPY       SEALSLSLHNFIKDDGSS-SLELFFTDLSPNLQFLIKLILGRDYPVKLAEGVFTH-----
MURI_HELPY       PPLLIHSGDAIVEYLQQNYALKKNACAFPKVEFHASGDVVWLEKQAKEWLKL--------
MURI_HELPJ       PPLLIHSGDAIVEYLQQKYALKNNACTFPKVEFHASGDVIWLERQAKEWLKL--------
MURI_CAMJE       -TKLIHSGDAIVEFLKERENIDLKNHK-AKLHFYASSDVESLKNTAKIWLNLLRK-----
MURI_CLOAB       GSQGTVMQLKRKLD---KYDILNIGSEKGKIKIMNS---LKDDKILDLSHRLLDL-----
MURI_CLOPE       GSSGTIRELKRRLE---ENNMESESKKKGNLDIFNS---LEDKKILELSKKLIEIK----
MURI2_BACSU      GSVGTAKQLKKVLA---DRNQLGKGS--GSITFFNSGHKIVDQEVISKYKRLFEILDETQ
MURI_PSEAE       TGAAVARQLERVLS---ARALLASG-QAATPRFWTSALPEEMERILPILWGSPESVGKLV
MURI_RALSO       TGHAVARHLGRTLA---AAHLQATG-AAASPRFLSTADVLPLQAMVAALLGEAPMAQRID
MURI_DEIRA       SGAAVARHTRNVLS---RGGLLRGGDRTGEVSYLTTSDPAHLRALLMTLRPGGADGASLP
MURI_BRUME       PAEAIARRMKSLLPARSDDDEFHSQ---DDLAFFTSRKPDYAIRRLMQGFGLRF------
MURI_RHIME       PAEAIARRARSLVPLPNGFEPLNG----EDPAIFTSGRPDFATRRLMQGFGLRVMADAVS
MURI_RHILO       PAEAIARRALSLLPPVDGALPQGE----PDIAVFTSGKTDFAIGRLMQGFGLSVR-----
MURI_TREPA       SLEGVVRRTLRLCPPQSQLRGNAACYVTGARDAVCAARYARYAQHFGLRWAGFLDV----
MURI_BORBU       NRELVVKNLIRSMNFSEHKGNYYKNDFDFVDDEFYLTENKNLTFYQNFCKKYNLRFKGMI
                                                                             

MURI_ECOLI       AVLG-------------
MURI_ECO57       AVLG-------------
MURI_SALTY       PV---------------
MURI_YERPE       PI---------------
MURI_HAEIN       KID--------------
MURI_PASMU       NMKA-------------
MURI_VIBCH       LHPI-------------
MURI_BUCAI       NLN--------------
MURI_NOSS1       FAGVPVSQLQQDLA---
MURI_SYNY3       LPCLS-SICPQPLEIRE
MURI_NEIMA       MVSLG------------
MURI_NEIMC       MVSLG------------
MURI1_BACSU      SLQEPIKR---------
MURI_BACC1       YLEKE------------
MURI_LISIN       KLGK-------------
MURI_LISMO       KLGK-------------
MURI_CARST       TLG--------------
MURI_LYSSH       TLK--------------
MURI_STAAM       SVND-------------
MURI_STAHA       SVDE-------------
MURI_STRPN       EL---------------
MURI_STRP1       TL---------------
MURI_LACLA       EIENFNKEK--------
MURI_LACBR       AIAQLTTPMEVN-----
MURI_PEDPE       KID--------------
MURI_LACFE       QIEEGD-----------
MURI_MYCLE       RLHSRVR----------
MURI_MYCTU       H-PSRIH----------
MURI_CORGL       EG---------------
MURI_AQUAE       -----------------
MURI_AQUPY       -----------------
MURI_HELPY       -----------------
MURI_HELPJ       -----------------
MURI_CAMJE       -----------------
MURI_CLOAB       -----------------
MURI_CLOPE       -----------------
MURI2_BACSU      RSHVGH-----------
MURI_PSEAE       V----------------
MURI_RALSO       IGDTAVPPLASHQ----
MURI_DEIRA       DPPSPRIELTTT-----
MURI_BRUME       -----------------
MURI_RHIME       ADRRERI----------
MURI_RHILO       -----------------
MURI_TREPA       -----------------
MURI_BORBU       V----------------