CLUSTAL format seed alignment for MF_00259

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GCST_MYCLE      ----MTDAPELLKGPLEDRHRELGANFAEFGGWLMPVSYAGTVSEHSATRNAVGLFDVSH
GCST_MYCTU      ----MSDVPELIHGPLEDRHRELGASFAEFGGWLMPVSYAGTVSEHNATRTAVGLFDVSH
GCST_CHLTE      ----------MKKTALSAWHEAAGAKMIDFGGFLMPVQYTGIIAEHKAVREAAGLFDVSH
GCST_HALSA      --------MGLRTSPLHGRHEDRGASFTEFGGWNMPVDFDGIQAEHAAVREAAGIFDVSH
GCST_NOSS1      MANQKDTAETLARTPLYQLGVELKARLTSFGGWEMPVQFSGITREHEAVRNAAGMFDISH
GCST_SYNY3      MANLF----PALRTPLYNLITEQTTKLTTFGGWEMPVQFAGLKQEHQAVREKVGMFDISH
GCST_THEEB      MISMA---EALQRTPLYPL--HQGARFTPFGDWEMPLQYSSILQEHQAVRQQVGMFDISH
GCST_ECOLI      ---------MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSH
GCST_ECO57      ---------MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHEVRTDAGMFDVSH
GCST_ECOL6      ---------MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSH
GCST_SALTY      ---------MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQLDEHHAVRTDAGMFDVSH
GCST_YERPE      ---------MAKQTPLYDQHVACGARMVDFHGWMMPLHYGSQIDEHHFVRQDAGMFDVSH
GCST_SHEON      ---------MANKTVLFNKHLESNAKMVDFHGWDMPLNYGSQIEEHHAVRQDAGMFDVSH
GCST_PSEPK      ---------MGQRTLLYDLHLALGAKTVDFGGWDMPLHYGSQVEEHHQVRSDCGVFDVSH
GCST_PSESM      ---------MGQRTPLFDLHLALGAKMVDFGGWDMPLHYGSQVEEHHQVRRDCGVFDVSH
GCST_PSEAE      ---------MGLRTPLYELHVALGAKMVDFGGWDMPLHYGSQVEEHHQVRRDCGVFDVSH
GCST_XANAC      ---------MTQKTILNDTHRALGAKMVDFGGWDMPIHYGSQLDEHHQVRRDAGMFDVSH
GCST_XANCP      ---------MTQKTILNDTHRALGAKMVDFGGWDMPIHYGSQIDEHHQVRRDAGMFDVSH
GCST_XYLFA      ---------MIKKTILNDTHRALGAKMVDFSGWEMPIHYGSQIDEHHHVRRNAGIFDVSH
GCST_XYLFT      ---------MIKKTILNDTHQALGAKMVDFSGWEMPIHYGSQIDEHHHVRRNAGIFDVSH
GCST_RALSO      --------MTLQHTPLNAIHRSLGARMVDFGGWDMPVNYGSQIEEHHAVRRDAGIFDVSH
GCST_NEIMA      -------MITLKTTPFHQAHQDAGAKLVDFAGWELPIHYGSQIAEHEAVRTDAGMFDVSH
GCST_NEIMB      -------MTALKTTPFHQAHQDAGAKLVDFAGWELPIHYGSQIAEHEAVRTDAGMFDVSH
GCST_PYRAB      ---------MAKRVHLFDWHKEHAKKIEEFAGWEMPIWYSSIKEEHLAVRNAVGLFDVSH
GCST_PYRHO      ---------MVKRVHIFDWHKEHARKIEEFAGWEMPIWYSSIKEEHLAVRNAVGIFDVSH
GCST_PYRFU      ---------MAKRVHLFDWHKEHAKKIEEFAGWEMPIWYSSIKEEHLAVRNAVGVFDVSH
GCST_BACTN      ----------MKTTPFTEKHIALGAKMHEFAGYNMPIEYSGIIDEHLTVCNAVGVFDVSH
GCST_BACHD      -------MTELKKTPLFDLYEQYGGKVIDFGGWALPVQFSSIKEEHEAVRTKAGLFDVSH
GCST_BACSU      ---------MLKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSH
GCST_OCEIH      -------MSEQKRTPIFTEYASHGAKTIDFGGWDLPVQFSSIKHEHEVTRTKAGLFDVSH
GCST_LISIN      -------MTELLKTPIHPLYAKYGAKTIDFGGWDLPVQFAGIKAEHEAVRTDAGLFDVSH
GCST_LISMO      -------MTELLKTPIHPLYAKYGAKTIDFGGWDLPVQFAGIKAEHEAVRTDAGLFDVSH
GCST_CALS4      -MKGCDSLDNLKKTPLYEIYPKYNAKIIDFAGWAMPVQFESIISEHEAVRNAAGLFDVSH
GCST_STAAM      ------MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSH
GCST_STAES      ------MTTDLKKTPLYQNYVDSGAKIVEFGGWAMPVQFSSIKEEHNAVRYNVGLFDVSH
GCST_AQUAE      -----MILFYFMQTPLYYVHKHLKAKFTNFAGWTMPLQYTSIIEEVRAVRXRAGVFDISH
GCST_LEPIN      -------MSQDKKTPLYETHRTLGAKMIPFGGWDMPVQYSGIIAEHNATREAAGLFDVSH
GCST_THEMA      ----------MKRTPLFEKHVELGAKMVDFAGWEMPLYYTSIFEEVMAVRKSVGMFDVSH
GCST_STRCO      -----MSSTELRRTALDATHRALGATMTDFAGWDMPLRYGSEREEHVAVRTRAGLFDLSH
GCST_AERPE      --------MPVRRHILEDLHRSLGATFGEFAGWSVPMSYEGTLKEHMAVRREAGIFDISH
                               :             * .: :*: : .   *   .    *:**:**

GCST_MYCLE      LGKALVRGPGA--AQFVNSVLTNDLGRIR-PGKAQYTLCCSESGGVIDDLIAYY------
GCST_MYCTU      LGKALVRGPGA--AQFVNSALTNDLGRIG-PGKAQYTLCCTESGGVIDDLIAYY------
GCST_CHLTE      MGNFYVRGARA--LEFLQYMTTNDLAKIV-DGQAQYTLMLYPDGGIVDDLIIYRVSAD--
GCST_HALSA      MGEIEVSGPDA--ERLMQRLTTNDVSRLD-PGDAQYAAITDDDGIMIDDTVVYRTPADW-
GCST_NOSS1      MGKFTLQGKNL--ISQLQGLVPSDLSRLQ-PGQAQYTVLLNPQGGIIDDIIVYYQGED-N
GCST_SYNY3      MGKFVLTGQKV--LAALQSLVPSDLDRLT-PGKAQYTVLLNAQGGIIDDIIVYDQGKN-P
GCST_THEEB      MGKLVLRGEGV--LGALQTLVPTNLSQLQ-PGQAKYTVLLNEAGGIVDDVILY-------
GCST_ECOLI      MTIVDLRGSRT--REFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYY------
GCST_ECO57      MTIVDLRGSRT--REFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYY------
GCST_ECOL6      MTIVDLHGSRT--REFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYY------
GCST_SALTY      MTIVDLHGSRT--REFLRYLLANDVAKLTKTGKALYSGMLNASGGVIDDLIVYY------
GCST_YERPE      MTIVDLHGNRT--REFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYF------
GCST_SHEON      MTVVDVTGTDA--CAFLRKLLANDVAKLKVPGKALYGGMLDDNAGIIDDLITYY------
GCST_PSEPK      MTVIDVDGTDA--TVWLQRLLANDVARLDDPGKALYSPLLNEQGGVIDDLIVY-------
GCST_PSESM      MNVIDVLGREA--KAWLRRLLANDVDKLKTPGRALYSAMLDEQAGVIDDMIVY-------
GCST_PSEAE      MTVVDVAGEQA--TAYLQHLLANDVARLGETGKALYSAMLNEEGGVVDDLIVY-------
GCST_XANAC      MTVVDLHGARV--REFLRYLLANSVDKLKVSGKALYTCMLNPQGGVIDDLIVYY------
GCST_XANCP      MTVVDLHGVRV--REFLRYLLANSVDKLKVSGKALYTCMLNPQGGVIDDLIVYF------
GCST_XYLFA      MTVIDLHGTQV--RPLLRRLLANSVDKLKVPGKALYSCMLNPQGGVIDDLIVYY------
GCST_XYLFT      MTVIDLHGTQV--RPLLRRLLANSVDKLKVPGKALYSCMLNPQGGVIDDLIVYY------
GCST_RALSO      MCVVDLTGARV--RDFLRGLLANNIDKLQTPGKALYTCMLNPKGGVIDDLIVYF------
GCST_NEIMA      MLVTDVAGANA--KAFFRKLIANDVAKLAFVGKALYSALLNDNGGVIDDLIVYRTN----
GCST_NEIMB      MLVTDVAGANA--KAFFRKLIANDVAKLAFVGKALYSALLNDNGGVIDDLIVYRTN----
GCST_PYRAB      MGEIYFRGKDA--LKFLQYVTTNDISKPP-AISGIYTLVLNERGAIKDETLIFN------
GCST_PYRHO      MGEIVFRGKDA--LKFLQYVTTNDISKPP-AISGTYTLVLNERGAIKDETLVFN------
GCST_PYRFU      MGEILFKGKDA--LKFLQYTTTNDISKPP-AISGTYTLVLNERGAIKDETLVFN------
GCST_BACTN      MGEFWVKGPQA--LAFLQKVTSNNVAALV-PGKIQYTCFPNEEGGIVDDLLVYC------
GCST_BACHD      MGEVEVTGAQA--LNYLQRLVTNDVSKIK-DGQAQYTAMCYENGGTVDDLLIYR------
GCST_BACSU      MGEVEVSGNDS--LSFLQRLMTNDVSALT-PGRAQYTAMCYPDGGTVDDLLIYQ------
GCST_OCEIH      MGEISVKGPKS--ESFLQYVLTNDISKLE-PGKAQYTIMCYEDGGTVDDLIVYK------
GCST_LISIN      MGEILVEGPDS--TSYLQYLLSNDIEKIK-IGKAQYNIMCYETGGTVDDLVVYK------
GCST_LISMO      MGEILVKGPDS--TSYLQYLLSNDIEKIK-IGKAQYNIMCYETGGTVDDLVVYK------
GCST_CALS4      MGEIIVKGKDA--FPFLQNLLTNDLSKLN-DNQVLYTFMCNHNGGVIDDLLVYK------
GCST_STAAM      MGEIEVTGKDA--SQFVQYLLSNDTDNLT-TSKALYTALCNEEGGIIDDLVIYK------
GCST_STAES      MGEIEISGKDA--EQFIQYILSNDTNLLT-NDKAMYSALCNDEGGIIDDLVTYK------
GCST_AQUAE      MGRLLIEDPEK----KLQYFTTNNLDKLS-VGKVQYNLLPNEKGGIKDDVTVYM------
GCST_LEPIN      MGEIFITGNPKSILLFLESITCNSVASLS-DFQVQYNAILNQNGGLVDDVTIYK------
GCST_THEMA      MGEFLVKGPEA--VSFIDFLITNDFSSLP-DGKAIYSVMCNENGGIIDDLVVYK------
GCST_STRCO      MGEITVTGPQA--AELLNFALVGNIGTVK-PGRARYTMICREDGGILDDLIVYR------
GCST_AERPE      MGRMIVSGEGA--TELLERIYTKRVSKTKVGFMSGPTLALNEYARVKDDEMPYR------
                :    . .        .                          .   *:   :       

GCST_MYCLE      VDDDEIFLVSNAANTAAVVDALQAV------VPA-GLTIINQH-------RSHAVLAVQG
GCST_MYCTU      VSDDEIFLVPNAANTAAVVGALQAA------APG-GLSITNLH-------RSYAVLAVQG
GCST_CHLTE      ----TFFLIVNASNCEKDFDWLSSHIG---QFE--GVALENHT-------SELSLIALQG
GCST_HALSA      --PGAFLFVPNAGHDAAAFDRWTDHRD---AHDL-DASVDNVT-------TDYGMVAVQG
GCST_NOSS1      TGTQQAFIIVNAATTSKDKAWILSH------LDQNQVQFQDIS-------PAKVLIAIQG
GCST_SYNY3      EGQERVTLIVNAATTVKDKQWLLEH------LPE-EIDFQDLS-------REKVLIALQG
GCST_THEEB      MGDGQVRCIVNAATTAKDWAWFQKY------LPA-SIEVIDES-------ASQVLIALQG
GCST_ECOLI      FTEDFFRLVVNSATREKDLSWITQH------AEPFGIEITVR--------DDLSMIAVQG
GCST_ECO57      FTEDFFRLVVNSATREKDLSWITQH------AEPFGIEITVR--------DDLSMIAVQG
GCST_ECOL6      FTEDFFRLVVNSATREKDLSWITQH------AEPFGIEITVR--------DDLSMIAVQG
GCST_SALTY      FTEDFFRLVVNSATREKDLSWITQH------AEPYAIDITVR--------DDLSLIAVQG
GCST_YERPE      LSEDYFRLVVNSATRDKDLAWISQH------AEPYQVEVTVR--------DDLALIAVQG
GCST_SHEON      LTDTFYRVVVNSATREKDLAWIAKQ------SQGFDVTVTER--------PELAMIAVQG
GCST_PSEPK      RTETGYRLVTNAATRAKVLDWLQLQ------RAGFSVDFQVR--------PDLAILAIQG
GCST_PSESM      LTADGYRLVVNAATGAKDLAWMQSQ------LGDFDVQLLAR--------SEMAMLAIQG
GCST_PSEAE      LTEHGYRVVVNASTRDKDIAWMQAQ------AAGFKVDLQER--------GDLAMLAIQG
GCST_XANAC      MTEDFFRLVVNAATREKDLQWIGEQ------AARFDVRVEER--------SDFAMIAVQG
GCST_XANCP      MQEEFFRLVVNAATRDKDLQWIGEQ------AARFEVRVKER--------ADFAMIAVQG
GCST_XYLFA      LREDYFRFIVNAATREKDLAWINTQ------ASAFNVRVEER--------ADLAMLAVQG
GCST_XYLFT      LREDYFRFIVNAATREKDLAWINTQ------ASAFNVRVEER--------ADLAMLAVQG
GCST_RALSO      FREDWFRLVVNAGTAPTDIEWITAQNA----AAGTGVAITPRRSDNNAGAEPLGIVAVQG
GCST_NEIMA      EAETQYRIVSNGATREKDTAQFHKV------GQEFGVSFNPR--------YDLGMLAVQG
GCST_NEIMB      EAETQYRIVSNGATREKDTAQFHKV------GQEFGVAFNPR--------YDLGMLAVQG
GCST_PYRAB      MGNNEYLMICDSDAFEKLYAWFTYLKKTIEQFTKLDLEIELKT-------YDIAMFAVQG
GCST_PYRHO      MGNNEYLMICDSDAFEKLYAWFTYLKRTIEQFTKLDLEIELKT-------YDIAMFAVQG
GCST_PYRFU      MGNNEYLMICDADAFEKLYAWFTYLKKTIEQFTKLDLEIELKT-------YDIAMFAVQG
GCST_BACTN      YEPEKYLLVVNAANIEKDWNWC--V-----SHNTEGAELENSS-------DNMAQLAVQG
GCST_BACHD      RSEDQYLLVINAANIDKDIAWMEK-------HAIDGVSITNVS-------NQTAQLALQG
GCST_BACSU      KGENRYLLVINASNIDKDLAWMKE-------HAAGDVQIDNQS-------DQIALLAVQG
GCST_OCEIH      LDDEDYLLVVNAANTEKDANWIKQKN----TYSNDEIVIEDVS-------NQYVQLAIQG
GCST_LISIN      KSETEYILVVNAANTEKDYEWMVQ-------NIVGDVTVKNAS-------SEFGQLALQG
GCST_LISMO      KSETEYILVVNAANTDKDFEWMVK-------NIRGDVSVTNVS-------SEYGQLALQG
GCST_CALS4      YSNNYYLLVVNAANIEKDYKWMLNN------AGIYKVEIENVS-------DKIAELAIQG
GCST_STAAM      LADDNYLLVVNAANTEKDFNWILKH------KEKFDVEVQNVS-------NQYGQLAIQG
GCST_STAES      LNENHYLLIVNAANTNKDYQWIKKH------SSNFTVDVSNTS-------DKYGQLAIQG
GCST_AQUAE      LSEIEFFLCVNAANRQKVINWLSPHL-----------KLRDLS-------GELVQIALQG
GCST_LEPIN      FSSEKYMICSNASNYEAVTEHLLEHLP------ISGVKVDNQS-------LQWHQIALQG
GCST_THEMA      VSPDEALMVVNAANIEKDFNWIKSH------SKNFDVEVSNIS-------DTTALIAFQG
GCST_STRCO      LEEAEYMVVANASNAQVVLDALTER------AAGFDAEVRDDR-------DAYALLAVQG
GCST_AERPE      LGEEEWLIVPNAAVADAMLEYFSSIAS----SMGLNVSIRDLR-------ERYALLALQG
                          :.                          .                .*.**

GCST_MYCLE      PRSTDVLGELGLPTGIDYMGYVDASYAGVPVR-------VCRTGYTGEQGYELLPP----
GCST_MYCTU      PCSTDVLTALGLPTEMDYMGYADASYSGVPVR-------VCRTGYTGEHGYELLPP----
GCST_CHLTE      PKSFDILARVFPGAGIDKLGSFHFIKLPFEGAE----IMVARTGYTGEAGVEICLP----
GCST_HALSA      PDAPDLVAAR-AGDGVHDLGRFEAATVGVAGVE----CLVANTGYTGEAGVEIVFP----
GCST_NOSS1      PKAIGYLQPFVQQNL-QPIKAFGHLEATVLGQA----GFIARTGYTGEDGFEILVD----
GCST_SYNY3      PEALTILQPLVDQNL-GELPAFGHLEAEFLREK----AFIARTGYTGEDGFEIMVS----
GCST_THEEB      PAATATLSPLCDRPL-GEIKTYRHAPVNLLGQP----AWIARTGYTGEDGWEILVP----
GCST_ECOLI      PNAQAKAATLFNDAQRQAVEGMKPFFGVQAGD-----LFIATTGYTGEAGYEIALP----
GCST_ECO57      PNAQAKAATLFNDAQRQAVEGMKPFFGVQAGD-----LFIATTGYTGEAGYEIALP----
GCST_ECOL6      PNAQAKAATLFNDAQRQAVEGMKPFFGVQAGD-----LFIATTGYTGEAGYEIALP----
GCST_SALTY      PNAQEKAATLFTDQQRHAVEGMKPFFGVQAGD-----LFIATTGYTGEAGYEIAMP----
GCST_YERPE      PQAQQKVATLLTTEQQQAIAGMKPFFGIQTGD-----LFIATTGYTGEAGYEIALP----
GCST_SHEON      PNAKAKAAAVFSSEQNAAIEGMKPFFGKQAGS-----LFIATTGYTGEAGYEIIVP----
GCST_PSEPK      PRAREKVAALLSPARAALIRELRPFEGVADGD-----WFIARTGYTGEDGLEIIFP----
GCST_PSESM      PQARNRIAQLVSSARAELIRQLKPFEGLDDGD-----WFIARTGYTGEDGLEIMLP----
GCST_PSEAE      PNARVHSSELVSPARAALIRELKPFQGRAEGD-----WFIARTGYTGEDGLEIMLP----
GCST_XANAC      PSARTKVIDLLDPADTAAASKLGRFAALQTRSRDGIELFLARTGYTGEDGFEIVLP----
GCST_XANCP      PNARSKVIDLLDPADASAASKLGRFAALQTRTRDGVALFLARTGYTGEDGFEIVLP----
GCST_XYLFA      PAARAQVTNLLAETHRDAVEKLGRFAALEVASHSKKILFISRTGYTGEDGFEILLP----
GCST_XYLFT      PAARAQVTNLLAETHRDAVEKLGRFAALEVASHSKKPLFISRTGYTGEDGFEILLP----
GCST_RALSO      PNARAKAYAALPGTQ-AVGEALKPFNAGFATIDGVGEIMVARTGYTGEDGFELVVP----
GCST_NEIMA      PKAIEKLLTVKPEWA-DVVHNLKPFQGADLGND----WFVARTGYTGEDGVEVILP----
GCST_NEIMB      PKAIEKLLTVKPEWA-DVVHNLKPFQGADLGND----WFVARTGYTGEDGVEVILP----
GCST_PYRAB      PKARDLARDLFGIDINEMWWFQAR-WVELDGIK----MLLSRSGYTGENGFEVYIEDANP
GCST_PYRHO      PKARDLAKDLFGIDINEMWWFQAR-WVELDGIK----MLLSRSGYTGENGFEVYIEDANP
GCST_PYRFU      PKARDLAMDLFGIDINEMWWFQGR-WVELDGIK----MLLSRSGYTGENGFEVYIEDLNP
GCST_BACTN      PKAILALQKLTDIDLSAIPYYTFT-VGRFAGKE---NVIISNTGYTGAGGFELY------
GCST_BACHD      PVAENVLQTLTEEPLADIKFFRFVDGVNIAGV----NVLLSRTGYTGEDGFELYCL----
GCST_BACSU      PKAEAILKNLTDADVSALKPFAFIDEADISGR----KALISRTGYTGEDGYEIYCR----
GCST_OCEIH      PKAVEILQKCTDENVQEIKFFRFKNNVALKGIEA--KALISRTGYTGEDGFEIYID----
GCST_LISIN      PNAEKILSKLTDADLSSISFFGFIEDADVAGV----KTIISRSGYTGEDGFEIYMQ----
GCST_LISMO      PNAEKILSKLTDVDLSSISFFGFVEDADVAGV----KTIISRSGYTGEDGFEIYMP----
GCST_CALS4      PKAEEILQKLTDEDLSQIKFFYFKDKVKIAGV----ECLVSRTGYTGEDGFEIYMP----
GCST_STAAM      PKARDLINQLVDEDVTEMKMFEFKQGVKLFGA----NVILSQSGYTGEDGFEIYCN----
GCST_STAES      PHSRALINELVDIDVSHMAMFEFKQNVQIFGK----SIILSQSGYTGEDGFEIYCK----
GCST_AQUAE      PKSEEIISKFYP--VSDLKYYRFKVF----DK-----TIISRTGYTGEDGFEIYVS----
GCST_LEPIN      PKANEIFSKFLKRDLDSIQYYRFMLLPYQGEE-----IIVSRTGYTGEDGFEIYSS----
GCST_THEMA      PKAQETLQELVEDGLEEIAYYSFRKSI-VAGV----ETLVSRTGYTGEDGFELMLE----
GCST_STRCO      PESPGILASLTDADLDGLKYYAGLPGTVAGVP-----ALIARTGYTGEDGFELFVK----
GCST_AERPE      PGAARVMEEMGGGDLLDLKPLQFRENAGIAGVT---AYIVSRSGWTGEDGFEIIAE----
                * :                                    :. :*:**  * *:       

GCST_MYCLE      -WESADV---------VFDALVAAVVDARGEPAGLGARDTLRTEMGYPLYGHELS-----
GCST_MYCTU      -WESAGV---------VFDALLAAVSAAGGEPAGLGARDTLRTEMGYPLHGHELS-----
GCST_CHLTE      -NERAVA---------LWSALMEAGKSDGIQPIGLGARDTLRLEMGYSLYGHEIER----
GCST_HALSA      -ADGAGA---------VWDAIAND-----CQPCGLGARDTLRMEHGFLLSGQDFDP----
GCST_NOSS1      -PEVGVE---------LWRSLYDA----GVIPCGLGARDTLRLEAAMALYGQDID-----
GCST_SYNY3      -PEVGKQ---------LWQTFGSK----GVTPCGLGARDTLRLEAGMGLYGQDMN-----
GCST_THEEB      -AELGQQ---------LWQTLLAA----GVTPCGLGARDTLRLEAAMLLYGQDMD-----
GCST_ECOLI      -NEKAAD---------FWRALVEA----GVKPCGLGARDTLRLEAGMNLYGQEMD-----
GCST_ECO57      -NEKAAD---------FWRALVEG----GVKPCGLGARDTLRLEAGMNLYGQEMD-----
GCST_ECOL6      -NEKAAD---------FWRALVEA----GVKPCGLGARDTLRLEAGMNLYSQEMD-----
GCST_SALTY      -NEKAAD---------FWRALVEA----GVKPCGLGARDTLRLEAGMNLYGQEMD-----
GCST_YERPE      -KQQVVA---------FWQQLLAA----GVKPAGLGARDTLRLEAGMNLYGQEMD-----
GCST_SHEON      -ETEAEA---------LWQALLDQ----GVKPCGLGARDTLRLEAGMNLYGLDMD-----
GCST_PSEPK      -GDQAVA---------FFNDLVGA----GIAPSGLGARDTLRLEAGMNLYGQDID-----
GCST_PSESM      -ADEAQR---------FFNELVGA----GISPIGLGARDTLRLEAGMNLYGQDIG-----
GCST_PSEAE      -AAEAPG---------FLNELVGA----GISPAGLGARDTLRLEAGLNLYGQDMD-----
GCST_XANAC      -QQAAVA---------FWNALLAQ----GVKPAGLGARDTLRLEAGMNLYGQDMD-----
GCST_XANCP      -QADAVA---------FWNALLAH----GVAPAGLGARDTLRLEAGMNLYGQDMD-----
GCST_XYLFA      -QEETIT---------LWNALLKT----GVKPIGLGARDTLRLEAGMNLYGQDMD-----
GCST_XYLFT      -QEETIT---------LWNALLKT----GVKPIGLGARDTLRLEAGMNLYGQDMD-----
GCST_RALSO      -AAQIAG---------VWERLLQA----GVRPCGLGARDTLRLEAGMNLYGQDMD-----
GCST_NEIMA      -GTEAVA---------FFKALQAA----GVQPCGLGARDTLRMEAGMNLYGNDMD-----
GCST_NEIMB      -GTEAVA---------FFKALQQA----GVQPCGLGARDTLRMEAGMNLYGNDMD-----
GCST_PYRAB      YHPDESKRGEPEKALHVWERILEEGKKYGIKPAGLGARDTLRLEAGYTLYGNETKELQLL
GCST_PYRHO      YHPDESKRGEPEKALHVWERILEEGKKYGIKPCGLGARDTLRLEAGYTLYGNETKELQLL
GCST_PYRFU      YHPDEEKRGKPEKALHVWERILEEGQKYGIKPAGLGARDTLRLEAGYTLYGNDTKELQLL
GCST_BACTN      FYPDAA---EA-----IWKAVFEAGEEFGIKPVGLGARDTLRLEMGFCLYGND------L
GCST_BACHD      -AEDAPV---------LWKKLIEAGKEHGVVPCGLGARDTLRFEAKLPLYGQE------L
GCST_BACSU      -SDDAMH---------IWKKIIDAGDAYGLIPCGLGARDTLRFEAKLPLYGQE------L
GCST_OCEIH      -ASSGVA---------LWKLLLEKGEANGLEPIGLGARDTLRFEANLALYGQE------L
GCST_LISIN      -SADAGK---------VFEAIL----AEGVAPIGLGARDTLRLEAVLALYGQE------L
GCST_LISMO      -SADAGK---------VFEAIL----AEGVAPIGLGARDTLRLEAVLALYGQE------L
GCST_CALS4      -NEHAVT---------LWEKILEAGKDYGLKPAGLGARDTLRFEAGLPLYGNE------L
GCST_STAAM      -IDDTEK---------IWDGLL----EYNVMPCGLGARDTLRLEAGLPLHGQD------L
GCST_STAES      -QEDTKD---------IWEQLL----EYDVTPCGLGARDTLRLEAGLPLHGQD------L
GCST_AQUAE      -PEEGKE---------LFLELVKLAKP-----CGLGARDVLRIEAGLPLYGNE------L
GCST_LEPIN      -IPIGLK---------LWNELLEFGKPYGLLPCGLGARDTLRIEAKYPLYGHE------L
GCST_THEMA      -AKNAPK---------VWDALMNLLRKIDGRPAGLGARDVCRLEATYLLYGQD------M
GCST_STRCO      -PEHAVG---------LWQALTGAGEAAGLIPCGLSCRDTLRLEAGMPLYGNELS-----
GCST_AERPE      -VEAAKR---------IFKAAVEA----GAKPAGIAARDTLRIEAGFVLGGHEYGE----
                                .                *:..**. * *    * . :       

GCST_MYCLE      ----LDISPLQARCGWAIGWK---KDAFLGRDALLAEKAAGP---RRLLRGLRMAGRG--
GCST_MYCTU      ----LDISPLQARCGWAVGWR---KDAFFGRAALLAEKAAGP---RRLLRGLRMVGRG--
GCST_CHLTE      --DVNP---LEARLKWVVKLN---KPNFIGKQACEQVEIN-P---RKSVVGFSLEGRA--
GCST_HALSA      --EENPRTPFEAGIGFAVAP----ESGFVGRDALADTDS--P---EQQFVGLTLDERG--
GCST_NOSS1      ----DNTTPLEAGLGWLVHLD-T-KGDFIGRSVLEQQKATGV---QRRLIGLQTQGRN--
GCST_SYNY3      ----DETTPLEAGLGWLVHLD-S-KGDFIGRAVLTEQKANGV---EKRLVGLEMLAKQ--
GCST_THEEB      ----EQTTPLEAGLDGLIDWQ---KPDFVGRAALLAQKQQGI---ERQLVGLELLGKG--
GCST_ECOLI      ----ETISPLAANMGWTIAWEPA-DRDFIGREALEVQREHG----TEKLVGLVMTEKG--
GCST_ECO57      ----ETISPLAANMGWTIAWEPA-DRDFIGREALEVQREHG----TEKLVGLVMTEKG--
GCST_ECOL6      ----ETISPLAANMGWTIAWEPA-DRDFIGREALEAQREHG----TEKLVGLVMTEKG--
GCST_SALTY      ----EGISPLAANMGWTIAWEPA-DRDFIGREALEMQREKG----HEQLVGLVMTEKG--
GCST_YERPE      ----EKTSPLAANMGWTVAWQPE-DRQFIGRAALERQRMKG----TEQLVGLIMTEKG--
GCST_SHEON      ----ETINPLAANMGWTIAWEPT-DRDFIGRKALEALRDAG----TDKLVGLVMEEKG--
GCST_PSEPK      ----ENHTPLTSNLGWSIAWEPA-ERNFIGRVGLLAEIEHGV---QEKLVGLVLEERG--
GCST_PSESM      ----EHVSPLASNMAWSIAWEPA-ERDFIGRQALESERAEGT---AFKLVGLVLEERG--
GCST_PSEAE      ----ESVSPLAANMGWTVAWEPV-ARDFVGRRALEAQKAAGD---QPKLVGLVLEERG--
GCST_XANAC      ----DGVTPYEAGLAWTIALD-E-GRDFIGRSVLESQKAQGA---PRQLIGVVMDEKG--
GCST_XANCP      ----DNVTPYEAALAWTITLD-E-GRDFIGRSVLESQKAQGA---PRQMIGVVMDEKG--
GCST_XYLFA      ----EQVSPYEAALGWTVMLD-E-GRNFIGRNVLEQQKTNGV---SRQMIGLLMDEKG--
GCST_XYLFT      ----EQVSPYEAALGWTVMLD-E-GRNFIGRNVLEQQKTNGV---SRQMIGLLMDEKG--
GCST_RALSO      ----EHVSPLDAGLAWTVDLQ-S-ERDFNGKAALAAN---GQ---RDQFVGLLLRDKGG-
GCST_NEIMA      ----DDTSPLEAGMGWTVDLKDE-SRDFVGKAALLALKEKGV---AVKQVGLLLGKGG--
GCST_NEIMB      ----DDTSPLEAGMGWTVDLKDE-SRDFVGKAALLALKEKGV---AVKQVGLLLEKGG--
GCST_PYRAB      STDIDEVTPLQANLEFAIYWD----KDFIGKDALLKQKERGL---GRKLVHFKMVDKG--
GCST_PYRHO      STDIDEVTPLQANLEFAIYWD----KDFIGKDALLKQKERGV---GRKLVHFKMIDKG--
GCST_PYRFU      STDIDEVTPLQANLEFAIYWD----KDFIGKDALLKQKEKGL---GRKLVHFKMLEKS--
GCST_BACTN      D---DKTSPIEAGLGWITKFVE--GKEFINRPMLEKQKSEGT---TRKLVGFEMIDRG--
GCST_BACHD      T---KDISPIEAGIGFAVKVDK--E-DFIGKEILKKQKEQGA---PRKLVGLEMVDKG--
GCST_BACSU      T---RDITPIEAGIGFAVKHKK--ESDFFGKSVLSEQKENGA---KRKLVGLEMIEKG--
GCST_OCEIH      S---KDISPIEAGLGFAVKVNK--GPDFIGKEVLKNQVENGT---DRKLVGIEMIDKG--
GCST_LISIN      S---KDITPLEAGLNFAVKLKK--EADFIGKQALIKQKEAGL---TRKLVGIELIERG--
GCST_LISMO      S---KDITPLEAGLNFAVKLKK--EADFIGKEALIKQKEAGL---NRKLVGIELIERG--
GCST_CALS4      G---EDITPLEAGLGFFVKFDK--G-NFIGKDALLKQKEQGL---KRKLVGFEMIGNG--
GCST_STAAM      T---ESITPYEGGIAFASKPLI--DADFIGKSVLKDQKENGA---PRRTVGLELLEKG--
GCST_STAES      S---ESITPYEGGIAFAAKPLI--ENHFIGKSVLKAQKENGS---ERRTVGLELLGKG--
GCST_AQUAE      S---EEITPIEVNLEKFVDFSK--E--FIGKEAMLKKK---V---KKKLFGLELTEKG--
GCST_LEPIN      N---DQWTPIESGIGWIVKEKE--NPYFSSEKILFQKKN-GV---PSKIVSFALTEAG--
GCST_THEMA      D---ENTNPFEVGLSWVVKLNK----DFVGKEALLKAKEK-V---ERKLVALELSGKR--
GCST_STRCO      ----TALTPFDAGLGRVVKFEK--EGDFVGRAALTEAAERAASRPPRVLVGLVAEGRR--
GCST_AERPE      ---DPLRWPCAVSLRYGLGAIDWGKKGFVGEAALRACRREGV---RWIRVGLVMKKKYAR
                                           * ..                    .        

GCST_MYCLE      -VLRPGLTVCAGDI----PIGVTTSGTFSPTLQVGVALALIDSEAAVQDGQQIIVDVRG-
GCST_MYCTU      -VLRPGLAVLVGDE----TVGVTTSGTFSPTLQVGIGLALIDSDAGIEDGQQINVDVRG-
GCST_CHLTE      -IPRQHFKVYNSDK---QEIGEVCSGTVSPTLQEPIGTASLLLDYAQPGTP-IFVEIRG-
GCST_HALSA      -VPRHGYAVTTPAG---DEIGTVTSGTMSPTLGEPIGLGYVDSAHAADGTT-VAVRIRG-
GCST_NOSS1      -IARHGYQVLSDGK----VVGGVTSGTLSPTLGYPVALAYVPSKLAKVGQP-LEVEIRG-
GCST_SYNY3      -IARHDYPILHNGE----IMGIVTSGTLSPTLQKAIALGYVPTELAKVGQE-LEVEVRG-
GCST_THEEB      -IARHGYPIYAGAQ----AVGEVTSGTLSPTLGKAIALGYVFPEFAHIGRE-LAVQVRD-
GCST_ECOLI      -VLRNELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVPEG---IGET-AIVQIRN-
GCST_ECO57      -VLRNELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVPKG---IGET-AIVQIRN-
GCST_ECOL6      -VLRNELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVPEG---IGET-AIVQIRN-
GCST_SALTY      -VLRNELPVRFTDAQGNQQEGIITSGTFSPTLGYSIALARVPAG---IGET-AIVQIRN-
GCST_YERPE      -VLRNELPVYFFDAAGNQHVGVITSGSFSPTLGFSIALARVPAG---IGEH-AVVQIRN-
GCST_SHEON      -VLRHDMPVFFTDAAGVEQQGVITSGTFSPTLGYSIAMARVPSS---IGDT-AEVEMRK-
GCST_PSEPK      -VLRAHQVVRVAGIG----EGEITSGSFSPTLSKSIALARVPMA---TGDR-AEVEIRG-
GCST_PSESM      -VLRAHQVVRVAEIG----EGEITSGSFSPTLSKSIALARVPMA---TADR-AEVEIRG-
GCST_PSEAE      -VLRAHQVVRVAGIG----EGEITSGSFSPTLNKSIALARVPAA---TGDR-AEVEIRG-
GCST_XANAC      -VLRHGQTVLTANG-----EGEILSGTFSPTLGKAIAFARVPAG---SIEQ-LRVDIRG-
GCST_XANCP      -VLRHGQKVLSAGG-----EGEILSGTFSPTLGKAIAFARVPAG---SIDD-LRVDIRG-
GCST_XYLFA      -VLRHGQKVLTAQG-----EGHILSGTFSPTLNKAIGFARVPAG---KPSE-VRVNIRD-
GCST_XYLFT      -VLRHGQKVLTAQG-----EGHILSGTFSPTLNKAIGFARVPAG---KPSE-VRVNIRD-
GCST_RALSO      -VLRAHQKVITAAG-----DGEITSGTFSPSLSQSIALARLPKDVA-IGAD-VQVEIRD-
GCST_NEIMA      -ILRAHMEVLTDKG-----KGETTSGVFSPSLKQSIAIARVPKDF--DGDT-AKVLIRG-
GCST_NEIMB      -ILRAHMEVLTDKG-----QGETTSGVFSPSLKQSIAIARVPKDF--DGDT-AKVLMRG-
GCST_PYRAB      -IPREGYK-VYANG---ELIGEVTSGTLSPLLNVGIGIAFVKEEYAKPGIE-IEVEIRG-
GCST_PYRHO      -IPREGYK-VYANG---EMIGEVTSGTLSPLLNVGIGIAFVKEEYAKPGIE-IEVEIRG-
GCST_PYRFU      -VPREGYK-VYANG---ELIGEVTSGTLSPLLNIGIGIAFVKEEYAKPGVE-IEIDIRG-
GCST_BACTN      -IPRHGYELVNEEG---EGIGVVTSGTMSPTRKIGIGMGYVKPEYAKVGTE-ICIDMRG-
GCST_BACHD      -IPRTGYEVYV-DN---QKIGFVTTGTQSPTLKKNVGLALLQAEHSELGTE-VIVHVRK-
GCST_BACSU      -IPRHGYEVFQ-NG---KSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTV-VDVEIRK-
GCST_OCEIH      -IPRHEYEVLK-DN---KEIGFITSGTQSPTLNKNVGLALINISYTEIGTE-VDVKVRK-
GCST_LISIN      -IPRHDYPVFL-ND---KEIGVITSGTQSPTLGTNIGLALIDTAYTELDQE-LEVGIRN-
GCST_LISMO      -IPRHDYPVFL-NE---EQIGVVTSGTQSPTLGINIGLALIDTAYTELGQE-VEVGIRN-
GCST_CALS4      -IPRHGYEVQA-DN---QKIGYVTTGYFSPTLKKNIGLALIDSKYAQIGNQ-IEVIIRN-
GCST_STAAM      -IARTGYEVMDLDG---NIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGRE-LLVQVRK-
GCST_STAES      -IARTGYDVLDENS---NEIGFVTSGTQSPSSGKSIALAIIDRDAFEMGKK-VIVQIRK-
GCST_AQUAE      -IPRKGYRVFKGD----REIGWISSGTYSPTLNKGIALCFVDIEERKEGNE-VEIEVRG-
GCST_LEPIN      -VPRENFRVLDSQG---NEIGKTTSGTFSPSLKKGIGLALIQSEKIKDGEP-IQIEIRE-
GCST_THEMA      -IARKGYEVLK-NG---ERVGEITSGNFSPTLGKSIALALV-SKSVKIGDQ-LGVVFPGG
GCST_STRCO      -VPRSGYRVVAGGE----VIGEVTSGAPSPTLGRPIAMAYVDPAHAAPGTEGVGVDIRG-
GCST_AERPE      MIPRSGYRLYVDDV----DVGWVTSGTFSPVIGRGVAQAYIDSRYAYIGDT-IEVDVRG-
                 : *                *   :*  **     :.   :             : .   

GCST_MYCLE      RAVECEVVRPPFIEVKTR-------
GCST_MYCTU      RAVECQVVCPPFVAVKTR-------
GCST_CHLTE      TMQPGAVRRLPFVHADRP-------
GCST_HALSA      TDKQATITTPPFLDQ----------
GCST_NOSS1      KAYPAVVVKRPFYRSSNKG------
GCST_SYNY3      KTYGIKVVKKLFYRSEQKPR-----
GCST_THEEB      RWVPAVVVPRPFYRRPRSTAKI---
GCST_ECOLI      REMPVKVTKPVFVRNGKAVA-----
GCST_ECO57      REMPVKVTKPVFVRNGKAVA-----
GCST_ECOL6      REMPVKVTKPVFVRNGKAVA-----
GCST_SALTY      REMPVKVTKPVFVRNGKAVA-----
GCST_YERPE      REMPVRVTKPGFVRAGKAIVL----
GCST_SHEON      KRVAVRVVAPNFVRNGKQAF-----
GCST_PSEPK      KWYPVRVVKPTFVRHGKILI-----
GCST_PSESM      KWYPVRVVQPAFVRHGKTLI-----
GCST_PSEAE      KWYPVRVVQPSFVRHGKPLI-----
GCST_XANAC      KQVPLRAVKFPFVRDGQAQPGVLGD
GCST_XANCP      KQVPLRAVKFPFVRDGQAQPGVLGA
GCST_XYLFA      REIPVRVVRFPFVREGQTQPNIFD-
GCST_XYLFT      REIPVRVVKFPFVREGQTQPNIFD-
GCST_RALSO      RRLTATVVKLPFVRNGKALVS----
GCST_NEIMA      KEADVRVLKLPFVRNGQKQFD----
GCST_NEIMB      KEVDVRVLKLPFVRNGQKQFD----
GCST_PYRAB      ARKKAITVTPPFYDPKKYGLFRET-
GCST_PYRHO      QRKKAVTVTPPFYDPKKYGLFRET-
GCST_PYRFU      TRKKAITVTPPFYDPKKYGLFREE-
GCST_BACTN      RKLKAIVVKPPFRK-----------
GCST_BACHD      RQLIAKVVATPFYKRGN--------
GCST_BACSU      KLVKAKVVKTPFYKR----------
GCST_OCEIH      RILKAKIVPTPFYKRGR--------
GCST_LISIN      KKVKAKVVQTPFYKRAK--------
GCST_LISMO      KKVKAKIVPTPFYKRAK--------
GCST_CALS4      KPLKAVIVDKNFYKKNYKK------
GCST_STAAM      RQLKAKIVKKNQIDK----------
GCST_STAES      RQVEAKIVKKNQIEK----------
GCST_AQUAE      RRVRGVLRKYPFVRTPAGRYQK---
GCST_LEPIN      QPKQAIITMKPFIPGSIRKN-----
GCST_THEMA      KLVEALVVKKPFYRGSVRREV----
GCST_STRCO      SHEPYEVVALPFYKRQK--------
GCST_AERPE      KRGEARLQEFPLVPLGSRG------