CLUSTAL format seed alignment for MF_00260

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HEM3_AGRFC       ----------------MQTKPFRIGTRGSPLALAQAYETRSRLMAAHGLP--------EE
HEM3_BRUME       -----------MQTASFKNGTLKIGTRGSKLALAQAYLTRRLLQEAHGLP--------ED
HEM3_CAUVC       ---------------MSRQPPIRIGARGSKLSLAQSGLMQARIAHALGVPAGASKDEIEA
HEM3_NOSS1       ----------MTSVVSSARRTIRIGSRKSQLALVQTYWVREQLQNSF--P--------DI
HEM3_CHLTE       -----------------MKKELIIGTRSSPLALWQAEFTKAELSRHF--P--------EL
HEM3_AQUAE       -------------------MKIRIGTRKSKLALWQANYVKDFLEKHW-----------GV
HEM3_CAMJE       -------------------MKLIIATRKSQLALWQSEHVAQILKNTH-----------QI
HEM3_BUCAI       ----------------MYNKTLRIATRKSPLALKQTKYVQKKILSLY--P--------DL
HEM3_BACHD       ------------------MRKIIIGSRRSQLALTQTEWVISKLKEAG--A--------PF
HEM3_BACSU       -----------------MMRTIKVGSRRSKLAMTQTKWVIQKLKEIN--P--------SF
HEM3_CLOAB       -------------------MKLTIATRKSKLAQVQTELIINVLKDKY-----------GI
HEM3_RUMJO       ------------------MKKIRIGSRDSKLAIIQSELIMSAIRKYD--P--------DI
HEM3_CLOPE       -------------------MELIIATRKSKLAQVQTEKVMELLKGKE-----------NV
HEM3_DEIRA       ------------------MRTVTVGTRGSTLALAQTRWVVARLKEEW--P--------ET
HEM3_RALSO       MSSNARPTSVESPLAAQAPTKLVIASRESRLAMWQAEYVRAALQKYY--P--------AC
HEM3_SYNY3       ------------MTVSTSAPTVRIGSRKSQLALVQTYWVQEELQKHF--P--------DR
HEM3_LISIN       -----------------MKRKIIVGSRRSKLALTQSNWVIKKLKENY--P--------EI
HEM3_LISMO       -----------------MKRKIIVGSRRSKLALTQSNWVINKLKENY--P--------EF
HEM3_STAA8       ------------------MRKLVVGSRRSKLALTQSQQFIDKLKAVE--P--------NL
HEM3_STAAM       ------------------MRKLVVGSRRSKLALTQSQQFINKLKAVE--P--------NL
HEM3_STAAW       ------------------MRKLVVGSRRSKLALTQSQQFIDKLKAVE--P--------NL
HEM3_HELPY       ------------------MGNLVIGSRGSELALWQANHIKERLKKEC-----------LI
HEM3_HELPJ       ------------------MEKLVIGSRGSELALWQANHIKERLKKEC-----------SM
HEM3_RHILO       -----------------MQTTLKIGTRGSPLALAQAHETQARLMAAHGLP--------AE
HEM3_RHIME       ----------------MQTKPFRIGTRGSPLAMAQTHETRDRLAAAHGLP--------PE
HEM3_CORGL       -------------------MTLKIGTRGSKLATTQAGTIRDQLKHY------------GR
HEM3_MYCLE       --------------------MIRIGTRGSLLATTQAALVRDALIAN------------GH
HEM3_MYCTU       --------------------MIRIGTRGSLLATTQAATVRDALIAG------------GH
HEM31_STRCO      ----------------MTEKALRLGTRRSKLAMAQSGQVADAVSQV---T--------GR
HEM32_STRCO      -------------MRMSAPELIRIVSRDSPMALAQVERVRAELAALH--P--------GV
HEM3_METTH       ---------------------MIAGTRGSRLALVQTNHVIEMLSEVC--K---------E
HEM3_FUSNN       -----------------MKKNIIIGSRGSILALAQANLVKDRLQGNY--P--------NL
HEM3_RICPR       -----------------MINSIRIGTRNSTLALIQTNLVIEQIKQIF--P--------DI
HEM3_METAC       ---------------------MIIGTRGSQLALAQTENVARLLKER------------GV
HEM3_METMA       ---------------------MIIGTRGSQLALAQTENVARLLKEK------------GV
HEM3_AERPE       -------------------MRVRVAARGSRLSLLQVEQALEELSRYAGV---------SM
HEM3_METKA       -----------------MSETIRVATRSSRLAIIQTREVIELLERES--P-------RDV
HEM3_ARCFU       -------------------MKLIVGTRGSKLALAQTNKVAERLKERY-------------
HEM3_PYRAE       -------------------MRLKVATRGSRLSLLQTEEFLAQIKAVE--P--------RV
HEM3_SACS2       -------------------MKILIAARGSKLSRVQVDMVGEKLRKI------------GI
HEM3_SULTO       -------------------MRIRIAARGSKLSRIQVMMVENYLHKL------------GI
HEM3_THEAC       ------------------MITIRIGTRPSRLAVRQAEIVASAIRHA------------GY
HEM3_THEVO       -------------------MKIKIGTRPSNLAVAQANMVASSLEAI------------GI
HEM3_METJA       --------------------MIRIGTRGSKLALYQANKVAELLKNL------------GY
HEM3_ECOLI       ----------------MLDNVLRIATRQSPLALWQAHYVKDKLMASH--P--------GL
HEM3_ECO57       ----------------MLDNVLRIATRQSPLALWQAHYVKDKLMASH--P--------GL
HEM3_SALTY       ----------------MLDNVLRIATRQSPLALWQAHYVKDALMATH--P--------GL
HEM3_YERPE       ----------------MLDKIIRIATRQSPLALWQAHYVQHLLQANH--P--------GL
HEM3_PROMI       ----------------MPKSTIRIATRQSPLAMWQALYVKEQLQIAH--P--------SL
HEM3_VIBCH       ----------------MTETPIRIATRQSPLALWQANYVKDALMAAH--P--------GL
HEM3_PSEAE       ----------------MSSREIRIATRQSALALWQAEYVKARLEQAH--P--------GL
HEM3_PASMU       ---------------MMTRKSLRIATRQSPLALWQANYVKACLEKIH--A--------GL
HEM3_NEIMA       ----------------MNPKKLVIASRESLLAMWQAKHIQGRLKALY--P--------DC
HEM3_NEIMB       ----------------MNPKKLVIASRESLLAMWQAKHIQGRLKALY--P--------DC
HEM3_XANAC       ------------------MTTLRIATRKSPLALWQSEHVADALRQHH--P--------GL
HEM3_XANCP       ------------------MTTLRIATRKSPLALWQSEHVATALRQHH--P--------GL
HEM3_XYLFA       ------------------MPLLRIATRKSLLAMWQSEYVAARLRMLR--P--------DL
                                      .   :* * ::  *       :                 

HEM3_AGRFC       MFEIVVLSTKGDRITD--RALSEI-GGKGLFTEELENQLLSGELDIAVHSSKDMPTV--L
HEM3_BRUME       AIEILPMSTAGDRIQD--RPLSEV-GGKGLFTEEIEQALKDGRIDIAVHSTKDMPTA--L
HEM3_CAUVC       AAPLIPIVTSGDRIQD--RRLMEI-GGKGLFTKEIEEALLDGRIDCAVHSLKDMPAE--L
HEM3_NOSS1       NFEVHTMSTQGDKILD--VALAKI-GDKGLFTKELEVGMINEEIDFAVHSLKDLPTN--L
HEM3_CHLTE       NITLKLVKTTGDVLLD--SPLSKI-GDMGLFTKDIEKHLLAKEIDLAVHSLKDVPTG--T
HEM3_AQUAE       EVELVKITTTGDKITD--VPLAKI-GGKGLFVKEIEKALLEGSIDLAVHSLKDVPMV--I
HEM3_CAMJE       EVLLEGFKTKGDVLLD--SPLAKI-GGKGLFTKELEESMLRKEAHLAVHSLKDVPSF--F
HEM3_BUCAI       NIKLVPIVTHGDNILN--KSLSKI-GGKGLFIKELELALLENKADIAIHSMKDLPVK--I
HEM3_BACHD       DFEIKKIITKGDQILD--VTLSKV-GGKGLFVKEIEQAMANKEIDIAVHSMKDVPSV--L
HEM3_BACSU       AFEIKEIVTKGDRIVD--VTLSKV-GGKGLFVKEIEQALLNEEIDMAVHSMKDMPAV--L
HEM3_CLOAB       SSEKLLMETLGDKILD--KSLADI-GGKGLFIKDIERILLEDKADAAVHSMKDVPFE--V
HEM3_RUMJO       ELELITMKTTGDKILD--KTLDKI-EGKGLFVKELDNALYNNEVDITVHSYKDMPLE--E
HEM3_CLOPE       DSKKLLVMTEGDRRLD--VSLNKI-GGKGLFVKEIELALLNKEAHGAVHSMKDVPFE--L
HEM3_DEIRA       DFRIQTISTKGDRNRESLEQLAQK-GDKGFWVKEIEEALLAKKIDIAVHSLKDLPTE--Q
HEM3_RALSO       DVSILGMTTRGDQILD--RSLAKV-GGKGLFVKELEVALAEGRADLAVHSLKDVPME--L
HEM3_SYNY3       QFDVETMETQGDKILD--VALAKI-GDKGLFTQELEDGMLGKRTDLAVHSLKDLPTN--L
HEM3_LISIN       DFEIKEIVTKGDRILD--VTLSKV-GGKGLFVSEVEQALSDEVIDFAVHSMKDVPSS--L
HEM3_LISMO       DFEIKEIVTKGDRILD--VTLSKV-GGKGLFVSEVEQALSDEAIDFAVHSMKDVPSS--L
HEM3_STAA8       EIEIKEIVTKGDRIVD--KQLSKV-GGKGLFVKEIQHELFEKNIDMAIHSLKDVPSV--I
HEM3_STAAM       EIEIKEIVTKGDRIVD--KQLSKV-GGKGLFVKEIQHELFEKNIDMAIHSLKDVPSV--I
HEM3_STAAW       EIEIKEIVTKGDRIVD--KQLSKV-GGKGLFVKEIQHELFEKNIDMAIHSLKDVPSV--I
HEM3_HELPY       ESEIQIVKTKGDKILD--TPLNKI-GGKGLFTKELEELLLKGAIDLAVHSLKDVPVV--F
HEM3_HELPJ       ESEIRIVKTTGDKILD--APLNKI-GGKGLFTKELEELLLKGAIDLAVHSLKDVPVV--F
HEM3_RHILO       AFEVVVISTSGDRIQD--RPLSEA-GGKGLFTKEIEEALLAGAIDIAVHSSKDMPTQ--L
HEM3_RHIME       MFEIVILSTKGDRITD--RSLAEI-GGKGLFTEELEQQLLSGDLDFAVHSSKDMPTK--L
HEM3_CORGL       DAELHIVTTPGDVNM---SPVERI--GVGVFTQALRDVLHSGECDVAVHSMKDLPTA--T
HEM3_MYCLE       PAELVIVNTAGDQSS---ASIDSL--GVGVFTTALRAAIEEGCVDAAVHSYKDLPTA--D
HEM3_MYCTU       SAELVTISTEGDRSM---APIASL--GVGVFTTALREAMEAGLVDAAVHSYKDLPTA--A
HEM31_STRCO      PVELVEITTYGDTSRE---HLAQI-GGTGVFVAALRDALLRGEVDFAVHSLKDLPTA--Q
HEM32_STRCO      RTEVVPVRTTGDKWLG---DLSQV-EGKGAFTKEVDAALLSGEADLAVHCVKDVPADRPL
HEM3_METTH       KIEKKIIKTKGDRIRDS--QLYSM-DSRGLFTRELDMAVLNEEVDLAVHSLKDVPSD--L
HEM3_FUSNN       SFEIKEIVTSGDKDLKSNWENSDI-SLKSFFTKEIEQELLDGEIDIAVHSMKDMPAV--S
HEM3_RICPR       NCEIVPIITSGDLIQNK--PLYDI-GGKALFLKEIEQALLDKKIDLAVHSLKDIPGK--I
HEM3_METAC       ETSIKIIKTSGDRFTDR--PLHAVSGGVGAFVRELDDVMLAGEIDIAVHSMKDMPTI--R
HEM3_METMA       ETSIKIIKTSGDRFTDR--PLHAVSGGVGAFVRELDDVMLAGEIDIAVHSMKDMPTI--R
HEM3_AERPE       HWEVVRVKSAGDVWSDR--PLESI-GVVGVFTREVDRAVASGAADIAVHSLKDMPTS--G
HEM3_METKA       EVEIVKTKSRGDVVRDR--PLHKL-GEKGVFVKEVDRLVLEGKADIAVHSAKDVPSV--V
HEM3_ARCFU       EVEIRIVKTAGDIMKDK--PLYEF-KGMGAFVRALDTALAEGKVDVAVHSFKDVPSQ--R
HEM3_PYRAE       DFEIKIVKTTGDLVQDK--PLFQI-GVKGIFEKEVNLAVLKGEADIAIHSLKDLPSE--I
HEM3_SACS2       EYDVIDIKTKADLFSTE--PLSKL--GKGVFEKEVNEAVLEGKADVAVHSMKDILSE--I
HEM3_SULTO       ETEFIEIKTKADLFQNE--PLSKL--GKGVFEKEVNQAVLDNKADVAVHSMKDILTE--I
HEM3_THEAC       EVEIVKYRSEGDSDLKS--PLYSI-GKTGVFVERLNSLILSGDIDAAVHSAKDIPYE--I
HEM3_THEVO       DTEIVKHRSAGDIDTKN--PIYSI-GKTGVFVQDLNNMILRGEIDVAVHSAKDIPSE--I
HEM3_METJA       KVEIKIIKTTGDRVLDK--KLSDI--GIGVFTKELDLAMLNNEIDIAVHSLKDIPTI--W
HEM3_ECOLI       VVELVPMVTRGDVILD--TPLAKV-GGKGLFVKELEVALLENRADIAVHSMKDVPVE--F
HEM3_ECO57       VVELVPMVTRGDVILD--TPLAKV-GGKGLFVKELEVALLENRADIAVHSMKDVPVE--F
HEM3_SALTY       TVELVPMVTRGDVILD--TPLAKV-GGKGLFVKELEIALLEKRADIAVHSMKDVPVA--F
HEM3_YERPE       QIELVPMVTRGDIILD--TPLAKV-GGKGLFVKELELALLDGRADIAVHSMKDVPIA--F
HEM3_PROMI       VVELVPMVTKGDIILD--TPLAKV-GGKGLFVKELELALLSSRADIAVHSMKDVPID--F
HEM3_VIBCH       QVELVTMVTRGDVILD--TPLAKV-GGKGLFVKELEIAMLEGRADLAVHSMKDVPVD--F
HEM3_PSEAE       TVTLLPMTSRGDKLLD--APLAKI-GGKGLFVKELETALLEGAADIAVHSMKDVPMD--F
HEM3_PASMU       VVELVPMVTKGDVILD--TPLAKI-GGKGLFVKELEQALLKGEADIAVHSMKDVPMQ--F
HEM3_NEIMA       EVEILGMTTRGDQILD--KTLSKV-GGKGLFVKELEQALYDGRADLAVHSIKDVPMD--L
HEM3_NEIMB       EVEILGMTTRGDQILD--KTLSKV-GGKGLFVKELEQALYDGRADLAVHSIKDVPMD--L
HEM3_XANAC       EVVLVPMSTRGDEVLD--RSLAAI-GGKGLFLKELELAMLRGEADCAVHSLKDVPME--L
HEM3_XANCP       EVVLVPMSTRGDEVLD--RSLAAI-GGKGLFLKELELAMLRGEADCAVHSLKDVPME--L
HEM3_XYLFA       DVVLVPMSTRGDEILD--RSLAAI-GGKGLFLKELELAMLRGDADCAVHSLKDVPMD--L
                         : .*                . :   :   :     . ::*. **:      

HEM3_AGRFC       PEG-LHLSAFLPREDMRDAFIGR---TA---P-KLLELPQGAVVGSASLRRQALIRRL--
HEM3_BRUME       PEG-LHLSVFLEREDPRDAFIGR---SA---R-RFMDLPQGATVGSSSLRRQALIRRL--
HEM3_CAUVC       PPG-LVLAATPEREDPRDAFISH---VC---E-RLEDLPKGARLGTASLRRQAQALHV--
HEM3_NOSS1       PEG-LALAAITERENPADALVVH---ENFKDK-QIDTLPAGAVIGTSSLRRLAQLRNQ--
HEM3_CHLTE       PEG-LVISSFTKREDTRDVIISK---SG---K-GLKDLPPNARMATSSLRRMSQLLSM--
HEM3_AQUAE       PKG-LKLGAITKRENPYDVLISR---SG---K-KLYELPSGSVIGTSSLRRQVQIKKR--
HEM3_CAMJE       PQG-LVLAAVSKREQSNDAMLSQ---NY---K-DFLSLPKGAKIGTTSLRRKMQLLLL--
HEM3_BUCAI       TKE-LCLVSICKRGNALDSLVSN---NY---Q-SINQLPKGAIVGTSSLRRQCQLITY--
HEM3_BACHD       QEG-FALGATTTRVDPRDALISN---EG---Y-TLAELPAGSIVGTSSLRRSAQILAK--
HEM3_BACSU       PEG-LVIGCIPEREDPRDALISK---NR---V-KLSEMKKGAVIGTSSLRRSAQLLIE--
HEM3_CLOAB       PDM-FEIAAVTLRVDVRDVFVSR---DG---T-HFKDLKNGAVIGTSSNRRAAQLKML--
HEM3_RUMJO       NPE-LPVVALSKREDPRDAFILP---QN---G-E-----NGEPIGSSSLRRQLQLKEL--
HEM3_CLOPE       PSE-FELVAMPEREDIRDAFVSL---NG---S-TLSNLRKGARIGTSSIRRAEQLKLF--
HEM3_DEIRA       PEG-LEISSIPKRVDGRDALIGR---EGM--K-KLAELPEGARIGTSSVRRKAFLRAY--
HEM3_RALSO       PPG-FVLSAILEREDPRDAFVSN---DY---A-DLAALPAGAVVGTSSLRREASLRAR--
HEM3_SYNY3       PAG-LMLGCVTKRVNPADALVLNAKHQG---K-DLASLPEGAVIGTSSLRRLAQLRYH--
HEM3_LISIN       KDG-LVIGAIPKRESPLDCFVFN---EV---S-TLDDLPKGAVIGTSSLRRAAQLLKH--
HEM3_LISMO       KEG-LIIGAIPKRESPLDCFVFN---QV---N-SLDELPQGSVIGTSSLRRAAQLLKH--
HEM3_STAA8       PEG-LTLGCIPDRELPFDAYISK---TH---T-PLSQLPEGSIIGTSSLRRGAQILSK--
HEM3_STAAM       PEG-LTLGCIPDRELPFDAYISK---TH---T-PLSQLPEGSIIGTSSLRRGAQILSK--
HEM3_STAAW       PEG-LTLGCIPDRELPFDAYISK---TH---T-PLSQLPEGSIIGTSSLRRGAQILSK--
HEM3_HELPY       EKG-LDLACITKRADVRDTFLSV---KF---P-DLMSLPKGAKVGTTSLRRSMQIKLK--
HEM3_HELPJ       EKG-LDLACITKRADVRDTFLSV---KF---P-DLMSLPKGAKVGTTSLRRSMQIKFK--
HEM3_RHILO       PDG-LELSAFLPREDARDAFVGK---AA---K-TIADLLRGAKVGSSSLRRQALIRRM--
HEM3_RHIME       PEG-LFLSAFLPREDIRDAFVGR---SA---K-RLVDLPQGATVGSSSLRRQALIRRL--
HEM3_CORGL       DPR-FHLV-VPTRADSREALIAR---DG---L-TLAELPEGAKVGTSAPRRISQLKAI--
HEM3_MYCLE       DPR-FTVAAIPPRNDPRDAVVTR---DE---L-VLAELPAGSLVGTSSPRRAAQLRAL--
HEM3_MYCTU       DPR-FTVAAIPPRNDPRDAVVAR---DG---L-TLGELPVGSLVGTSSPRRAAQLRAL--
HEM31_STRCO      HEG-LVVAAIPEREDPRDVVVAR---DA---R-KLTDLPRGARVGTGAPRRMAQLNAYAR
HEM32_STRCO      PAG-TVFAAFLKRDDVRDALVHP---DG---L-TLDELPDGTRVGTSSVRRVAQLAAT--
HEM3_METTH       DPD-LAIAAVPPRESPAEVLVSR---L------DWEDLPQGSKLGTSSLRREAFCNHH--
HEM3_FUSNN       AKS-LICGAIPDREDPRDVLVSK---NG---L--LVTLPQGAKVGTSSLRRAMNLKTV--
HEM3_RICPR       PVE-LVIAAVLEREDPRDVLVCL---NY---Q-SIETLPQNAVIGSSAVRRKAFIKKI--
HEM3_METAC       PEG-LPTVAVLKRDTPFDILLTY---DG---T-TLDELPEQAIIGTSSLRRTAQIRRY--
HEM3_METMA       PKA-IPTVAVLKRDTPFDILLTY---DG---T-PLDELPEQSIIGTSSLRRTAQIRRY--
HEM3_AERPE       YGGPLKIVYIASRPSARDALISR---QG---PGRVEDLEPGSTLGTSSARRRALSLHY--
HEM3_METKA       DYP-VDVAAVPPRRDPRECLVSR---HG-----GLKELPRGATVGTSSPRRRAQILLE--
HEM3_ARCFU       VEG-TVVAAVIERDSPCDVLISR---DG---S-TLEELDEGAVVGTSSLRRRAQLSRL--
HEM3_PYRAE       SPG-LVLAGFSKRTLPYDAVVSA---VG---Y-DLESLPKGALVGTSSVRRAEFIKSL--
HEM3_SACS2       NPE-LEIFAVIERDPPYDILIAE--------K-NLHKLDPNTTIGTSSIRRKNFIKYI--
HEM3_SULTO       SEN-LEIYAVLPRDPPFDILISR--------K-NLFNLEPNSIIGTSSIRRKNFLTFY--
HEM3_THEAC       DRR-LRISAVMPRGRFEDALVSE---N------PLSKLPPGSVIGTSSLRRRYQILYQ--
HEM3_THEVO       ENR-LTIAATLKRGSFNDALVSK--------Y-DLRSLPISAKVGTSSIRRIFQLKYA--
HEM3_METJA       NEN-LMVGAVLERDSYHDLLIWN---KD---I-DFNE-DSKIVIGTSSMRRRAFLKFI--
HEM3_ECOLI       PQG-LGLVTICEREDPRDAFVSN---NY---D-SLDALPAGSIVGTSSLRRQCQLAER--
HEM3_ECO57       PQG-LGLVTICEREDPRDAFVSN---NY---D-SLDALPAGSIVGTSSLRRQCQLAER--
HEM3_SALTY       PDG-LGLVTICEREDPRDAFVSN---KY---H-SLDDLPAGSIVGTSSLRRQCQLAER--
HEM3_YERPE       PEG-LGLVTICEREDPRDAFVSS---HY---A-HLDDLPAGSVVGTSSLRRQCQLRER--
HEM3_PROMI       PEG-LGLVTICEREDPRDAFVSN---HY---D-SLEQLPAGSVVGTSSLRRQCQLKAL--
HEM3_VIBCH       PDG-LGLVTICEREDPRDAFVSN---TY---A-KIEDLPSGAIVGTCSLRRQCQLKAA--
HEM3_PSEAE       PEG-LGLYTICEREDPRDAFVSN---TY---A-SLEQLPAGSVVGTSSLRRQAQLLAR--
HEM3_PASMU       PAG-LMLSTICQREDPRDAFVSN---SY---R-TLMELPAGAVVGTSSLRRQCQLKQL--
HEM3_NEIMA       PEG-FALAAIGERANPFDAFVSN---QY---A-RLEEMPEGAVVGTSSLRREAQLRAR--
HEM3_NEIMB       PEG-FALAAIGERANPFDAFVSN---QY---T-RLEEMPEGAVVGTSSLRREAQLRAR--
HEM3_XANAC       DEP-FVLPAILERGDPADALVSN---LY---A-SLQALPLGARVGTSSLRRQAQLRAA--
HEM3_XANCP       DAP-FVLPAILERGDPADALVSN---LY---A-TLQALPLGARVGTSSLRRQAQLRAA--
HEM3_XYLFA       EPP-FMLAAVLSRDDPADALISN---VY---L-SLESLPIGARVATSSLRRQAQLRFY--
                             *    :  :                      :.: : **         

HEM3_AGRFC       --RPDLNVIVFRGLVDTRLRKLEEGQADATLLAFAGLKRLGKDNV--PTE--I--LDPKE
HEM3_BRUME       --RPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADV--ITD--V--LDPSV
HEM3_CAUVC       --RPDLEIVMLRGNVDTRLAKLERGEADAILLAQSGLNRLGLGHL--TRS--W--LDPDA
HEM3_NOSS1       --FPHLTFKDVRGNLNTRLAKLDAGEYDGLILAAAGLQRLGMGDR--VHQ--I--LPKEI
HEM3_CHLTE       --RPDLQILDIRGNLNTRFKKFDDGEFDAMMLAYAGVYRLEFSDR--ISE--I--LPHDV
HEM3_AQUAE       --RRDLKVEVLRGNVDTRMRKLKEGLYDAVILAYAGVKRMGYESE--ITE--VL----ED
HEM3_CAMJE       --RPDLEIISLRGNVNSRIEKLKNNDFDAIILAMAGIKRLNLDKQ--VNF--VYEFSKDE
HEM3_BUCAI       --RPDLIISPLRGNIETRIAKLDQGKYDAIILATEGLNRLRLKNR--ITQ--I--IPAEL
HEM3_BACHD       --RPDLEVKWIRGNIETRLRKLKEEDFDAIILAAAGLERMGWSNE-IVTE--Y--LDPDL
HEM3_BACSU       --RPDLTIKWIRGNIDTRLQKLETEDYDAIILAAAGLSRMGWKQD-VVTE--F--LEPER
HEM3_CLOAB       --RDDIKVVPIRGNVQTRIRKMGEEKLDGIILAAAGLKRLNMENI--ITD--Y--FSVEE
HEM3_RUMJO       --FPGCKTAPIRGNVQTRLKKLDSGEFSAIVLAAAGIKRLGLESR--IGR--Y--FSVDE
HEM3_CLOPE       --RDDLEIVPIRGNVQTRIKKITEENLDGIILAAAGLKRLGMEDV--ISD--Y--FDPKV
HEM3_DEIRA       --RPDLIVKDLRGNIDTRLAALGSGEYDAIILAAAGLIRTEQRHR--IDE--F--VDPDI
HEM3_RALSO       --FPHLVIQPLRGNLDTRLSKLDRGDYAAIILAAAGLKRLGLSER--IRA--V--IAPET
HEM3_SYNY3       --FPHLTFKDVRGNVNTRLAKLDSNEYDAIILAAAGLERLDMANR--IDQ--L--IPPEI
HEM3_LISIN       --RPDFVVKPIRGNIDTRLQKLHAENFDAIILAKAGLARMGWLEN-TSLKLED--ISPEL
HEM3_LISMO       --RPDFVIKPIRGNIDTRLQKLHAENFDAIILAKAGLARMGWLEN-TTLKLED--IPPEV
HEM3_STAA8       --YPNLEIKWIRGNIDTRLEKLQTEDYDAIILAAAGLRRMGWSDD-IVTS--Y--LDRDT
HEM3_STAAM       --YPNLEIKWIRGNIDTRLEKLQTEDYDAIILAAAGLRRMGWSDD-IVTS--Y--LDRDT
HEM3_STAAW       --YPNLEIKWIRGNIDTRLEKLQTEDYDAIILAAAGLRRMGWSDD-IVTS--Y--LDRDT
HEM3_HELPY       --RQDLDTESLRGNVQTRLKKLECGEFDAIILAEAGLCRLEIQGA-KYRK--A--FSVEE
HEM3_HELPJ       --RKDLDTESLRGNVQTRLKKLECGEFDAIILAEAGLCRLNVQGA-KYRK--A--FSVKE
HEM3_RHILO       --RPDLDVVMFRGNVQTRLRKLDEGVAAGTILAYAGLKRLGLEHV--ATD--L--MPLDI
HEM3_RHIME       --RPDIDVITYRGQVETRLRKLAEGQVDGTLLAYAGLRRLGMEHV--PTE--L--LDPEE
HEM3_CORGL       --RPDLEILPLRGNIDTRMGKVTSGELDAVMLAYAGLTRVGMQDR--ATE--V--FDADI
HEM3_MYCLE       --GLGLEIRPLRGNLDTRLNRVSSGDLDAIVVARAGLARLGRLDE--VTE--T--LDPVQ
HEM3_MYCTU       --GLGLEIRPLRGNLDTRLNKVSSGDLDAIVVARAGLARLGRLDD--VTE--T--LEPVQ
HEM31_STRCO      THGMEIETVPIRGNVDTRIGYVRSGELDAVVLAAAGLNRVGRIDE--VTD--F--LSVDT
HEM32_STRCO      --HPHLRCVPFRGNANRRLAKLAAGEADALLLAVSGLERIGRTDV--ISE--V--LSTET
HEM3_METTH       --QKNFKMEPLRGNIDTRIRKVMDGEVHATIMAEAGLKRLGLEEH--IKR--R--FPVEY
HEM3_FUSNN       --RPDFEIKHLRGNIHTRLKKLETEDYDAIVLAAAGLKRTGLADK--ITE--Y--LNGEV
HEM3_RICPR       --RPDLNIKVFRGNVDSRIKKLMTGEVDAIILSYAGLKRLNVFNQ-KYCH--L--IEYSK
HEM3_METAC       --RPDLITQELRGNIDTRLRKLKEGQYDGILLAKAGLERMGWE---IDGE--I--LSPDF
HEM3_METMA       --RPDIITQNLRGNIDTRLRKLREGQYDGIMLAKAGLERMGWE---IEGE--I--FSPDF
HEM3_AERPE       --NPRIRVENLRGNLDTRLRKLREGLYDAIIASEAGLIRLGVDVE---YT-P---LDPSY
HEM3_METKA       --RPDLKVEPMRGNVDTRVSKVRRREYDAAVLAKVGLDRLGMTSE--VS--EV--YDPEE
HEM3_ARCFU       --RGDLRFENLRGNLDTRLRKLREGNYDAIVVAEAGLKRLGLDRE-VEYQP----FPPEV
HEM3_PYRAE       --RPDVRIEPLRGNVDTRVQKILQGKYDAAVMAAAGILRLYGESPPVKLSL----LRPEL
HEM3_SACS2       --RPEINTKDIRGNVDTRIRKYLSKEYDGLILAEASIKRLNIS---ISYHR----LNVYD
HEM3_SULTO       --RNDLNIKDLRGNIDTRLKKYFEGQYDGIIIAEASIYRLKEQ---VQYY-R---LDPHL
HEM3_THEAC       --RKDVKVSNIRGNVDTRIEKMRSEGMAGIVMALAAIDRLELN----LRYWP---FDPEK
HEM3_THEVO       --RQDLKFENIRGNIETRIAKMSELGLDAIVMAEAAIQRLGLNVE---YS-K---LDENK
HEM3_METJA       --YPNAKFELLRGNVDTRLRKLKEGLYDAIVLSEAGIIRLGVSLE-DFNYKR---LD---
HEM3_ECOLI       --RPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESR--IRA--A--LPPEI
HEM3_ECO57       --RPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESR--IRA--A--LPPEI
HEM3_SALTY       --RPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESR--IRT--A--LPPDV
HEM3_YERPE       --RPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLGLENR--IRY--A--MSAEE
HEM3_PROMI       --RPDLIIRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLKLTER--IRS--S--LSAEQ
HEM3_VIBCH       --RPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLELESR--IRS--F--IEPEQ
HEM3_PSEAE       --RPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFESR--IRS--S--ISVDD
HEM3_PASMU       --RPDLHIHSLRGNVGTRLAKLDNGDYDAIILAAAGLIRLGQQQR--ITS--L--IDVTQ
HEM3_NEIMA       --YPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLKLDGR--IRM--I--LSESD
HEM3_NEIMB       --YPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLKLDGR--IRM--I--LSESD
HEM3_XANAC       --RPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLEAR--ISA--R--LDAPE
HEM3_XANCP       --RPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLEAR--ITA--R--LDAPE
HEM3_XYLFA       --RPDLRLFDLRGNVNTRLAKLDNGDYDAIVLACAGLRRLGLEQR--MTA--R--LAPPE
                            **    *.         . . :  .: *                     

HEM3_AGRFC       FPPAPAQGAIGVESRIGDARMDKLLAPINDRPTYDAVTCERAFLAALDGSCRTPIAGYAT
HEM3_BRUME       FPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCRTPIAGLAT
HEM3_CAUVC       CPPAPGQGALVIETRAEDIGA-PWLEAVRCRQTTIAVAAERGALLALEGSCRTAIGARAI
HEM3_NOSS1       SLHAVGQGALGIECRADDAELITVLKAIEHPETRDRCLAERSFLRSLEGGCQVPIGVNTE
HEM3_CHLTE       MLPAVGQGALGIETRTDDAETIEIVRVMNDSNTEICCRAERALLRHLQGGCQIPIGCYGS
HEM3_AQUAE       FIPAVGQGSLAIEIREGDKRIEELIKPLNNEESFLCAIAERTFLRRLEGGCQVPVGAFAK
HEM3_CAMJE       LIPAASQGALGIES-INDEKILELLKCLNDENALIETSIEREFIATLEGGCQVPIGINAE
HEM3_BUCAI       SLPSCGQGAIGIQSRLHDKKVLFFLSRLNHINTFIEINAERAFCRKLESGCQIPIGSYAI
HEM3_BACHD       CVPAVGQGALGIECRADDDEVLEMLKTINDDTTAKTVLAERTFLHRMEGGCQVPIAGYAT
HEM3_BACSU       CLPAVGQGALAIECRESDEELLALFSQFTDEYTKRTVLAERAFLNAMEGGCQVPIAGYSV
HEM3_CLOAB       MIPAVGQGALGVEIKKENKN-RDLFRKLDNKNSRMCVEAERSFMRTLNGDCHSTIGAYAE
HEM3_RUMJO       ILPAASQGIIAVQGRVGEN--FDFLKLFHSEESLCISLAERTFVREMNGGCSTPIAAYAT
HEM3_CLOPE       FLPAIGQGALGIECLKGG-EFNDYFKALDSKEVRTTVEAERSFMKVLNGGCHSLIGAYSE
HEM3_DEIRA       LLPAPGQGALALETRTEDDLTIEVAYAIHDHATDDRITAEREFLAGLGAGCMAPVGAHAV
HEM3_RALSO       SLPAAGQGALGIESRVDRHDVQAWLAPLHHAPTALAVTAERAVSRQLGGSCQVPLAAFAQ
HEM3_SYNY3       SLHAVGQGALGIECREGDQEILSLLKVLEDENSRDRCLAERAFLRQLEGGCQVPIGVNTH
HEM3_LISIN       CLPAVGQGALAIECRETDLQICDMLASIHHEETGICVEAERVFLKKLNGGCEIPIAGFAT
HEM3_LISMO       CLPAVGQGALAIECRESDQQIRDMLTSIHHEETGICVEAERVFLKKLNGGCEIPIAGFAT
HEM3_STAA8       LLPAIGQGALGIECRSDDEELLTLLSKVHNDEVAKCVTAERTFLAEMDGSCQVPIAGYAT
HEM3_STAAM       LLPAIGQGALGIECRSDDEELLTLLSKVHNDEVAKCVTAERTFLAEMDGSCQVPIAGYAT
HEM3_STAAW       LLPAIGQGALGIECRSDDEELLTLLSKVHNDEVAKCVTAERTFLAEMDGSCQVPIAGYAT
HEM3_HELPY       MIPSMGQGALGVEMLKNHKHF-ATLQKLNDEKSAFCCRLEREFIKGLNGGCQIPIGVHAS
HEM3_HELPJ       MIPSMGQGALGVEMLKNHKHF-ITLQKLNNEESAFCCHLEREFIKGLNGGCQIPIGVHAN
HEM3_RHILO       FPPAPGQGAIGIETRIGDRAVEKMLVAIHDVPTGQALACERAFLAALDGSCRTPIAGHAT
HEM3_RHIME       FPPAPAQGAICVEARIGDDRINTLLAAIDDPRTHEAVSCERGFLATLDGSCRTPIAGYAQ
HEM3_CORGL       IMPAPAQGALAIECRADDTETVRALNMLMHADTFVSAVAERTVLNRLEAGCTAPVAAHAT
HEM3_MYCLE       MVPAPAQGAIAVECRAGDSRLVAVLAALDDADTRAAVTAERVLLAELEAGCSAPVGAIAQ
HEM3_MYCTU       MLPAPAQGALAVECRAGDSRLVAVLAELDDADTRAAVTAERALLADLEAGCSAPVGAIAE
HEM31_STRCO      VLPAPGQGALAVECAADNASLIAALAELDDPFTRAAVTAERSLLAALEAGCSAPVGALAD
HEM32_STRCO      MMPPIGAGILALQCREGDRALIEAVSALGDPRTHREATAERMFLHVLQGHCNSPIAGHAQ
HEM3_METTH       FTPAAGQGALAVITRAD-SELISSIGRITHHPSLQEVTAEKTLLRELGAGCQCPLGVIGR
HEM3_FUSNN       FPPAPAQGVLYIQCRENDEEIKEILKSIHNEAIAKIVEIEREFSKIFDGGCHTPMGCYSQ
HEM3_RICPR       MLPCIGQGVIAVEIRKDDNAMFNICSQINHLPTFELIKPERAFLEYLDANCSTPIAAYAQ
HEM3_METAC       FCPSPNQGTVAVVTRA-DPEIEAAVSGLDHTESRIVTEIERILISELGGGCTTPIGSYAE
HEM3_METMA       FCPSPNQGTVAVVTREG-TEAEAAVSMLDHTESRIVTEIERILIAELGGGCTTPVGSYAE
HEM3_AERPE       FPPAPGQGFVAVVARVG-SNVEKMLRDLDKPPWWHVAWAERGVLEGARAGCRTPVAAYAE
HEM3_METKA       FVPPAGQGALMITCRKDDDRVKRLLEVVDDEKSRVEVETEKAVVRELGVGCSEPVGVHVR
HEM3_ARCFU       IVPPANQGIIAIATRKGEE---DLVAFLNDEKTWLEAMVERAVIKELGVGCAVPVGVYAE
HEM3_PYRAE       LPPPPGQGIVAAVVREGEGWLIDLLKKASDPRATVEALAEREFLKNVGAGCHVAVGGTAF
HEM3_SACS2       FTPEANQGIIVVLGRKKDEKVKEVFKEITHKDTLDEALAERATISVVGGGCHSPIGVLFR
HEM3_SULTO       FTPEANQGIIVVIGRKKDETIKKIFNEINDKDTLEIAIAERKALSIVGGGCHSPIGVYFE
HEM3_THEAC       FVPAPNQGIIAVVSE-DGSKASEVLSSINDADTYDDMMAERSITQGLKLGCSTPVGILSR
HEM3_THEVO       FVPAPNQGIIAVVSK-KEGTVRKILEEINDENTFEEMQIERSVVQQLKLGCSTPVGILSR
HEM3_METJA       ILPAPAQGIIAVACKRDDEEMKSILKEINHERTYLESLCERTALNEFGGGCSVPFGALAV
HEM3_ECOLI       SLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQVPIGSYAE
HEM3_ECO57       SLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQVPIGSYAE
HEM3_SALTY       SLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRLEGGCQVPIGSYAE
HEM3_YERPE       SLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRLEGGCQVPIGSYAE
HEM3_PROMI       SLPAVGQGAVGIECRLDDHDTQALLAALNHADTATCVKAERAMNTRLEGGCQVPIGSYAI
HEM3_VIBCH       SLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTLQGGCQVPIGSYAL
HEM3_PSEAE       SLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKRLNGGCQVPIACYAI
HEM3_PASMU       CLPAVGQGAVGIECRQ-EAEIELLLAPLADPETTACVLAERAMNRHLQGGCQVPIAGYAI
HEM3_NEIMA       SLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARALGGSCQVPLAAYCT
HEM3_NEIMB       SLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARALGGSCQVPLAAYCT
HEM3_XANAC       WLPAPAQGAVAVECRGDDARIHSLLAVLDAGRTRVCVEAERAMNRALHGSCHVPVAAFAR
HEM3_XANCP       WLPAPAQGAVAVECRGDDARIHDLLAVLDAGRTRACVEAERAMNRALHGSCHVPVAAFAR
HEM3_XYLFA       WLPAPGQGAIAVESLTEDARIGTLLAGLDDLPTRQCVVAERTMNRALHGSCHVPVGAYAS
                        * :                             *:         *   ..    

HEM3_AGRFC       CEG---------DNLHFSGLILTPDGQTSHGVEIS------GNRRDALILGKKAGEEVRA
HEM3_BRUME       VEG---------DRLSFRGMILTPDGRQAHEVTAE------GVVSDAAALGTDAANRVRA
HEM3_CAUVC       LDG---------ARLSMIVEALTPDGAQRFRREGDITLTGADDIAEARAFGLTLGAEVRA
HEM3_NOSS1       ING---------NELILTGVVASVDGQNLVKDTVS------GNASDAEAIGIRLAELLRE
HEM3_CHLTE       YIS---------GTLKLLAFVGSVDGKTALRNELTKPV---NTPEEAEAVGIELAEVLLS
HEM3_AQUAE       IEN---------GTLKMKAFISDIEAERYIEGYRE------GNPEEAEKLGLSLAEELLK
HEM3_CAMJE       LLG---------DEICVRAVLGLPDGSEILKDKRM------IKKNDFKGFGESLAKEFIA
HEM3_BUCAI       LKK---------NKIWLRGLVGSPNGKIILKGERI------GCYNTGEKMGYSLADELLK
HEM3_BACHD       LTDE--------GEIELTALVGTPDGEQIFKEILR------G--KDPVQLGETMAQALMD
HEM3_BACSU       LNGQ--------DEIEMTGLVASPDGKIIFKETVT------G--NDPEEVGKRCAALMAD
HEM3_CLOAB       IVN---------GQMNVLGFY-EIDGRRV-KKDVS------GNIEDYMSLGKTLAEKILE
HEM3_RUMJO       IQG---------SEIILKGLYCNETTGELRKECVS------GNRNNPVELGYELVKKMKS
HEM3_CLOPE       VKD---------NDLYMIGTFTV--NNRIVKKDIL------GNKEDNILLGKKLAEKILE
HEM3_DEIRA       IKN---------GLLTLEGWVGALDGTQVIRATSQGD------VAECADIGAELAADMLE
HEM3_RALSO       WTDA--------GALRLRAFVASPDGRRKLAAEAEATP---ATPAEAEALGARVAQQMLD
HEM3_SYNY3       LDG---------DNLTLTGMVASLDGQRLIKDTLSAP------RKEAEKLGQDLALKLRE
HEM3_LISIN       KTG---------DSVHFKGLVGNADGSIILESERT------G--ASPAEIGNQVAEELLS
HEM3_LISMO       RAN---------EFVQFKGLVGNADGSIILESEQV------G--ANPSEIGNKVAEDLLS
HEM3_STAA8       ISDQ--------NEIEFTGLIMTPDGKERFEYTM--------NGTDPVELGKTVSNKLKE
HEM3_STAAM       ISDQ--------KEIEFTGLIMTPDGKERFEYTMN------G--TDPVELGKTVSNKLKE
HEM3_STAAW       ISDQ--------KEIEFTGLIMTPDGKERFEYTMN------G--TDPVELGKTVSNKLKE
HEM3_HELPY       LMG---------DRVKIQAVLGLPNGKEVITKEKQ------GDKTKAFDLVQELLEEFLQ
HEM3_HELPJ       LMG---------DEVKIRAVLGLPNGKEVIAKEKQ------GDKTKAFDLVQELLEEFLQ
HEM3_RHILO       IET---------GNLSFAGLIISPDGTQSHTVELQ------GPAQDAARIGDEAARTVRA
HEM3_RHIME       SDG---------THIRFAGMILTPDGTTSHQIEID------GRAADAERLGQEAGERIRA
HEM3_CORGL       LDGY------SGDTMTLTAGVYALDGSDQLVFSAEGDG------ARPEELGELVAQQLID
HEM3_MYCLE       VVESIDGEGRVFEELSLRGCVAALDGSDVIRASGIST------SGRASELGLAVAVELFE
HEM3_MYCTU       VVESIDEDGRVFEELSLRGCVAALDGSDVIRASGIGS------CGRARELGLSVAAELFE
HEM31_STRCO      LLAD----GQTVKEMRLRGVVGTTDGSTLVQLSTTGPV--PETHEAALALGGELAAEMLA
HEM32_STRCO      VDR--------SGELSLRACVFTPDGKVRLNAHEWAG------RLDPATLGTSVAVALLR
HEM3_METTH       ATG---------NQLTLYAVLLTREGEMLRKVTVRG------PLAEAEDIGKKAAKEMED
HEM3_FUSNN       VNG---------DKIKFTAVYLD-EGKQ-IRAVV----------EDDLAKGKEIAY----
HEM3_RICPR       YLDA--------YNIQIDFMLGNLDCTKIIFQTEI------TNIKTSKICGIKAAKMML-
HEM3_METAC       LTSD-------KQEIHIRAEVLSLDGKEDVRIDEFI------PMLGGLEKARELGHRLVE
HEM3_METMA       ITPD-------RQEIHVRAEVLSLDGREAIRIDEFIPL--RGGIEKARELGHRLVEMGGR
HEM3_AERPE       PLGR--------SMVRVTAAALSPDGSRAYWARAE------GRIEEARRIGVSLGEEL--
HEM3_METKA       ARD--------GDHVRLVLGLFEEDGSCGHVLKMR------GSPEDVVREAVSQAREVLS
HEM3_ARCFU       AQS----------RVRLICEI--LD-KKYLRVEEKLSK--DTAVEEAAEIGKDLRKEIY-
HEM3_PYRAE       SRN---------GYIEFIAGYAA-SGKRFV-VKLFG--------EDPVEVGRRAAEEIKR
HEM3_SACS2       KEGK-----------EFYGIASYSDGKKKITVSISKAG---DPYTIGSELGLLLKKEMKN
HEM3_SULTO       KYDK-----------DFHGIISSSFGRKKITIEEYFHN--MTPYEAGELLGKRFLEEIKN
HEM3_THEAC       HTG---------KGMRILAQFFAMDGSDMMMFDQHV-----DGLDDVD--G--IVSYIRE
HEM3_THEVO       PSGK--------GH-KIIAQFFSMQGDDVSVFEQY--------LNDLSDV-DSLVSYIRE
HEM3_METJA       YDEK-------NELLKLKAAVVTNDELKNASGEVKCKI---DEIDKAVELGKKIGLKLKN
HEM3_ECOLI       LID---------GEIWLRALVGAPDGSQIIRGERR------GAPQDAEQMGISLAEELLN
HEM3_ECO57       LID---------GEIWLRALVGAPDGSQIIRGERR------GAPQDAEQMGISLAEELLN
HEM3_SALTY       IIN---------GEIWLRALVGAPDGSVMVRGERR------GSPEQAEQMGISLAEELLE
HEM3_YERPE       LEG---------DTLWLRALVGAPDGSQMIRGERR------GPAAEAEQMGIELADELLS
HEM3_PROMI       WQN---------DKIWLRALVGAPDGKTILRGERL------VSPEDAEQAGISLAEELLD
HEM3_VIBCH       LEG---------DTIWLRALVGEPDGSQIVRGEIR------GPRTQAEQLGITLAEQLLS
HEM3_PSEAE       REG---------DQLWLRGLVGQPDGTQLLRAEGR------APLAEAEALGVRVAEDLLE
HEM3_PASMU       IEE---------GQLFLRALVGEVDGSSILRAEGR------SAVADAETLGIQVAEKLLQ
HEM3_NEIMA       EEN---------GLLTLRGLVGHPDGSVVLRADAQ------APAEYADALGRAVAKKLAD
HEM3_NEIMB       EEN---------GLLTLRGLVGHPDGSVVLRADAQ------APAEYADALGRAVAKKLAD
HEM3_XANAC       WEG---------QDLFLQGMVGSASDGRLIHADAH------GSADDTEALGRRVAQGLFD
HEM3_XANCP       WEG---------EDLFLQGMVGSASDGRLIHAEAH------GSPDATEDLGRLVADGLFE
HEM3_XYLFA       YEV---------GGMRLQGLVGCVADGRLVRAELC------SAKDEGDMLGRAVAQCLLD
                                 .                                           

HEM3_AGRFC       KAGSNFFEGWS----------------
HEM3_BRUME       MAGPHFFDGWQ----------------
HEM3_CAUVC       AGGDAIILPE-----------------
HEM3_NOSS1       QGAQEILNTIFAEIQRGS---------
HEM3_CHLTE       MGAEKILADIRKTR-------------
HEM3_AQUAE       KGGEEILKEIYSSQ-------------
HEM3_CAMJE       KGAKELLKKAESMI-------------
HEM3_BUCAI       NGAKNILNNLHIKQSYCI---------
HEM3_BACHD       QGAKEVLEQVKKGLESQ----------
HEM3_BACSU       KGAKDLIDRVKRELDEDGK--------
HEM3_CLOAB       DK-------------------------
HEM3_RUMJO       SKS--I---------------------
HEM3_CLOPE       EV-------------------------
HEM3_DEIRA       RGAAELIEAVRE---------------
HEM3_RALSO       GGAHDILATLGADAPPAT---------
HEM3_SYNY3       QGAGEILAEILAEAGRG----------
HEM3_LISIN       EGADTIIKELRNI--------------
HEM3_LISMO       EGADTIIKELRNV--------------
HEM3_STAA8       QGAYEIIKRLNEQH-------------
HEM3_STAAM       QGAYEIIKRLNEQH-------------
HEM3_STAAW       QGAYEIIKRLNEQH-------------
HEM3_HELPY       SGAKEILEKAQLF--------------
HEM3_HELPJ       SGAKEILEKAQLF--------------
HEM3_RHILO       KAGEKFFDGWV----------------
HEM3_RHIME       KAGPGFFSSWS----------------
HEM3_CORGL       AGAANLLGDRS----------------
HEM3_MYCLE       LGARELMWGARSDRARGS---------
HEM3_MYCTU       LGARELMWGVRH---------------
HEM31_STRCO      QGAAGLMGERAQ---------------
HEM32_STRCO      QGAREIIDGIAH---------------
HEM3_METTH       Y----I---------------------
HEM3_FUSNN       MAAEEIKNKIVK---------------
HEM3_RICPR       --AQQ----------------------
HEM3_METAC       MGGKRLAEEALLQISRNACGTENSFDY
HEM3_METMA       RLAEEALLQISRGADSENSCDY-----
HEM3_AERPE       ---SRVVEGWHKTGGGS----------
HEM3_METKA       DG-------------------------
HEM3_ARCFU       -GG------------------------
HEM3_PYRAE       VAA-----SVR----------------
HEM3_SACS2       EG---IIP-------------------
HEM3_SULTO       EG---IIP-------------------
HEM3_THEAC       N-----LPEEYGYKL------------
HEM3_THEVO       N-----IPREYGYIASEE---------
HEM3_METJA       ---------------------------
HEM3_ECOLI       NGAREILAEVYNGDAPA----------
HEM3_ECO57       NGAREILAEVYNGDAPA----------
HEM3_SALTY       NGARAILTEVYNGETPA----------
HEM3_YERPE       RGAREILAAVYLDNPAR----------
HEM3_PROMI       KGAREILTAVYQGNTAI----------
HEM3_VIBCH       QGAKEILERLYCDHE------------
HEM3_PSEAE       QGAEAILEAVYGEAGHP----------
HEM3_PASMU       QGADKILQTLYSN--------------
HEM3_NEIMA       DGARELIGAVLNTEN------------
HEM3_NEIMB       DGARELIGAVLNTEN------------
HEM3_XANAC       KGAAQLLAEL-----------------
HEM3_XANCP       KGAAQLLAEL-----------------
HEM3_XYLFA       AGAAELLAATA----------------