CLUSTAL format seed alignment for MF_00261

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOL_SULAC      --------MEIKVIKEEQNYLELQIDGEEHTIGNLLKGMLLKVPGVKFAAYSLPHPL---
RPOL_SULTO      --------MEIKILRSGENYLELQIDGEEHTVGNLLKGYLLKVPGVKFASYSKPHPL---
RPOL_SACS2      --------MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPL---
RPOL_NANEQ      ---MITIPTEVKILEETDNLIKVQFKGETHTLFNALKEIAYTINGVKKAAYFIEHPL---
RPOL_METAC      --------MELNILNKTNNELEVELRGETHTLLNLLKDLLIKDERVEAAFYDMKHVS---
RPOL_METMA      --------MELNILNKTNNELEVELRGETHTLLNLLKDLLIKDERVVTAFYDMKYVS---
RPOL_ARCFU      --------MEVKIIDIGEDYVRLVIKGEGHTYLNLLQHYLVEDEDVIVARYNIPHPL---
RPOL_METJA      --------MEIKILERKDNLVEIELINEDHSLPNLLKDILLTKEGVKMASYSIDHPLLHP
RPOL_METMP      -------MNYVKIIEKNKNFIELELVNDDHSLSNLVKEILLAKDGVILASYGVEHPVLDP
RPOL_PYRAB      --------MKIEVIKKEQDLLEFYLEGEDHTFANLLTETLRENPHVKFVAYTIEHPI---
RPOL_PYRHO      --------MKIEVIKKEEDMLEFYLEGEDHTFANLLTEVLREDPHVKFVAYTIEHPI---
RPOL_PYRFU      --------MKIEVIKKEENLLEFYLEGEDHTFANLLVETLRENPHVKFTAYTIEHPI---
RPOL_METTH      ----------MEVILDKRNEMEIVFEGETHTLCNVLRSILMEDEKVKAAAYSIDHPI---
RPOL_THEAC      MQRERTAESSLRVISKEKNSITVEMINYDNTLLRTLVEEILKDDQVDEARYYIKHPV---
RPOL_THEVO      MQRERTNETSLRVVSKEKDSIIVEMINYDNTLLRTLVEEILKDDQVIEARYYIKHPI---
RPOL_PICTO      -----MNDAHFNIISKDKNSITVEMINYDNTLLRPLVEEISRDDSVDEIHYYIKHPN---
RPOL_HALSA      --------MDLRVIEKDDAELTIEVAGENHTFMNVLKGTLLETDGVTAASYDMNPEQ---
RPOL_METKA      ---MKLPEVEVVVKKYDKDEVLLELPGEDHTLCNLLRWALNRQDGI-IATYRIEHPILGK
RPOL_PYRAE      ----MSPVLRLEILKLDDKYLELKAKGETYTLFSPLVEYLSNDPDVEYVQFDVDHPL---
RPOL_AERPE      -------MERLRIIRESRGSYVIQVYGEDHTLGTLLVEAIKRVSNPKLAYYEAVHPM---
                          . :         .   .   :    :              :         

RPOL_SULAC      -----IT---SITIKILTDG-SISAREALIKAIELAENYANLFIDEVKKI----------
RPOL_SULTO      -----ID---SIILKIMTDG-SISPKEALVKAIELAEEDTNKFIEEVKSIEKR-------
RPOL_SACS2      -----SD---KIIVKILTDG-SITPKDALLKAIENIRGMTSHYIDEIKGLTK--------
RPOL_NANEQ      -----KD---NNYFIIETDG-SIKARDALIQALKKLKEELLNFKDWYYSNL---------
RPOL_METAC      -----IS---DPILYIKT-D-GTDPILVLKETAAIIIAQCDEFIDVFSKAANA-------
RPOL_METMA      -----IS---DPVLYIKT-D-GADPILVLKDVVAIIVSECDEFIDVFSKAANA-------
RPOL_ARCFU      -----IG---EPEIYIKT-S-GVDPLEAVKRANEKIIAACNTLLEQL-------------
RPOL_METJA      ETGRYIS---NPKITIITEE-GTDPLEVLKEGLRDIIKMCDTLLDELKEKK---------
RPOL_METMP      DTGRYIS---NPTIMLKTDE-KTDAETVLKEALKDIVDLCNKTLEDL-------------
RPOL_PYRAB      ---LMAR---KPRFRVVTDG-KITPEKALEEAAKKIFDRAKEVLDAWEKAIKG-------
RPOL_PYRHO      ---TMAR---KPRFRVVTDG-KVTPEKALEEAARKIFNRAKEVLDAWEKVVKS-------
RPOL_PYRFU      ---TMAR---KPRFRVVTDG-EITPEEALEEAAKKIFERAKEVLEAWEKAVKS-------
RPOL_METTH      ---VGE-----PQLYIRAG----SPKKSLKAAAETLRDRCDEFRRLIESL----------
RPOL_THEAC      -----ID---NPQIYVRVKS-G-KPQSAIKRAVRKLSKLYEDLGTQFQKEFQRYESDHMI
RPOL_THEVO      -----ID---NPQIYVKVKS-G-KPQAAIKRSIRKLSKLYEDLGAQVEKEIEKYRSNHII
RPOL_PICTO      -----LD---NPQIHVKVKS-G-KPQSAIKKSIRRIDRIYNSLIDDLEREEKRLNVSK--
RPOL_HALSA      --SGGQT---EPLLTIKTDG-DVDPVDALQAAAGHTSQKLQSFADTFEAAV---------
RPOL_METKA      EHKVDEERYVPPKMRIRAVDEDADAREALERAIEELLELVEEAKEEFSGALEEKES----
RPOL_PYRAE      -----QE---NAYFKLKVKR--GNPLEAIQRAVNAILSDLEELERGFFS-----------
RPOL_AERPE      -----ED---IIQVYVKYED-DVDIKEVLRKASDYLLEVIGDFRRRYLEALERRGGGG--
                             . :            :                               

RPOL_SULAC      ----
RPOL_SULTO      ----
RPOL_SACS2      ----
RPOL_NANEQ      ----
RPOL_METAC      ----
RPOL_METMA      ----
RPOL_ARCFU      ----
RPOL_METJA      ----
RPOL_METMP      ----
RPOL_PYRAB      ----
RPOL_PYRHO      ----
RPOL_PYRFU      ----
RPOL_METTH      ----
RPOL_THEAC      KAVE
RPOL_THEVO      KTTE
RPOL_PICTO      ----
RPOL_HALSA      ----
RPOL_METKA      ----
RPOL_PYRAE      ----
RPOL_AERPE      ----