CLUSTAL format seed alignment for MF_00262

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MINE_BUCAI       ----MALLDFFL---SRNK---NTANVAKERLQIIVAEQR-----KYNN-EPDYFPQLKR
MINE_BUCAP       ----MALLDFFL---SRNK---NTAHVAKERLQIIVAEQR-----KFKS-EPDYLPQLKR
MINE_ECOLI       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SHIFL       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_ECOL6       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_ECO57       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_ECOUT       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_ECOK1       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_ECOL5       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SHIBS       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SHIDS       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SHIF8       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SHISS       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SALCH       ----MALLDFFL---SRKK---STANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SALPA       ----MALLDFFL---SRKK---STANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SALTI       ----MALLDFFL---SRKK---STANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SALTY       ----MALLDFFL---SRKK---STANIAKERLQIIVAERR-----RSDA-EPHYLPQLRK
MINE_SODGM       ----MALLDFFL---SRKK---STANIAKERLQIIVAERR-----RGDN-EPHYLPQLKR
MINE_YERPE       ----MALLDFFL---SRKK---PTANIAKERLQIIVAERR-----RGDS-EPHYLPDLKR
MINE_YERPS       ----MALLDFFL---SRKK---PTANIAKERLQIIVAERR-----RGDS-EPHYLPDLKR
MINE_YERE8       ----MALLDFFL---SRKK---PTANIAKERLQIIVAERR-----RGDS-EPHYLPDLKR
MINE_YERPA       ----MALLDFFL---SRKK---PTANIAKERLQIIVAERR-----RGDS-EPHYLPDLKR
MINE_YERPN       ----MALLDFFL---SRKK---PTANIAKERLQIIVAERR-----RGDS-EPHYLPDLKR
MINE_YERPP       ----MALLDFFL---SRKK---PTANIAKERLQIIVAERR-----RGDS-EPHYLPDLKR
MINE_PHOLL       ----MALLDFFL---SRKK---TTANIAKERLQIIVAERR-----RGDS-EPAYLPDMKR
MINE_PECAS       ----MALLDFFL---SRKK---TTANIAKERLQIIVAERR-----RGDN-EPHYLPQLKR
MINE_BUCBP       ----MALLDFFL---SRKK---NTANIAKERLQIIVAERR-----RMDT-EPQYLPKLKK
MINE_BAUCH       ----MALFNFLF---SRKR---NTANLAKERLQIIIAKKR-----QNEI-IPDYLPQLKY
MINE_BLOFL       ----MVLTNFFL---RKKTS--TTASIAKKRLHIIVTERKI----DNTP-ELNYLPKFKK
MINE_BLOPB       ----MVLVNFFF---FRKK---TPADIAKKRLQEIVSDHNI----RNNF-APYFLPQLKK
MINE_BUCCC       -----MILNLFI---SKKQ---YTASLAKKRLKTLIKKKK-----KFFY-QSSYLPQLKN
MINE_WIGBR       ----MALLKFFI---SKKE---ITSDIAKERLQIIVSEQR-----KNSK-EPNYLPMLKK
MINE_VIBVU       ----MSLLEFFR---PQKK---TSASLAKERLQIIVAERRS----QNDP-APSYLPQLKE
MINE_VIBVY       ----MSLLEFFR---PQKK---TSASLAKERLQIIVAERRS----QNDP-APSYLPQLKE
MINE_VIBPA       ----MSLLEFFR---PQKK---TSASLAKERLQIIVAERRS----QNDP-APSYLPQLKE
MINE_VIBCH       ----MSLLEFFR---PQKK---TSASVAKERLQIIVAERRS----QNDP-APSYLPQLKE
MINE_ALIF1       ----MALLEFFR---PQKK---ATANIAKERLQIIVAERRN-----GGP-APSYLPQLKE
MINE_PHOPR       ----MALLEFFR---PKKT---TTASVAKERLQIIVAERRS----AGQS-TPSYLPQLKL
MINE_COLP3       ----MALLDYFL---RKKEKQVTTASKAKERLQIIVAHERN----SRNK-QPDYLPQLTE
MINE_AERHH       ----MSLLDYFR---SNKKQ--STAQLAKERLQIIVAHERS----SRG--GPDYLPQLKQ
MINE_AERS4       ----MSLLDYFR---SNKKQ--NTAQLAKERLQIIVAHERS----SRG--GPDYLPQLKQ
MINE_SHEDO       ----MSLLDYFR---STKKP--NTASLAKERLQIIVAHQRS----GRGGGAPEYLPKMKQ
MINE_SHEFN       ----MSILDYFR---SSKKP--NTASLAKERLQIIVAHQRG----ERG--APDYFPKMKQ
MINE_SHEON       ----MSLLDYFK---SKKKP--STAVMAKERLQIIVAHQRG----QRD--TPDYFPQMKQ
MINE_SHESW       ----MSLLDYFK---SKKKP--STAVMAKERLQIIVAHQRG----QRD--TPDYFPQMKQ
MINE_SHESA       ----MSLLDYFK---SKKKP--STAVMAKERLQIIVAHQRG----QRD--TPDYFPQMKQ
MINE_SHESM       ----MSLLDYFK---SKKKP--STAVMAKERLQIIVAHQRG----QRD--TPDYFPQMKQ
MINE_SHESR       ----MSLLDYFK---SKKKP--STAVMAKERLQIIVAHQRG----QRD--TPDYFPQMKQ
MINE_SHELP       ----MSLLDYFR---AKKEP--TTATTAKERLQIIVAHQRG----ERD--APDYFPAMKQ
MINE_SHEAM       ----MSLLDYFR---SNKKA--SSASLAKERLQIIVAHQRT----ERG--APDYFPQMKQ
MINE_PSET1       ----MSLLDYFR---SEKK---NSASLAKERLQIIVAHERS----QRG--TPDYLPQLKQ
MINE_RHIEC       ----MNIFR-LF---NKQ----RTAPAARERLQVLLAHERS----SAG---SDLVSLLRE
MINE_RHIL3       ----MNIFR-LF---NKQ----RTAPAARERLQVLLAHERS----SAG---SDLVTLLRE
MINE_AGRFC       ----MSIFS-IF---RKQ----KSAPLARERLQVLLAHERA----SSG---TDLVAVLRE
MINE_CHESB       ----MKIFG-FF---GKR----ASAPMARERLQVLLAHERA----SLGK--SDLVAILRE
MINE_RHIME       ----MSIFR-FF---SKQ----TSAPTARERLQVLLAHERA----SVGQ--SDLVAVLRE
MINE_BRUAB       ----MSIFR-FF---TRQQ---ASAPQARERLQVLLAHERA----SYGGQ-SDLVAVLRE
MINE_BRUA2       ----MSIFR-FF---TRQQ---ASAPQARERLQVLLAHERA----SYGGQ-SDLVAVLRE
MINE_BRUME       ----MSIFR-FF---TRQQ---ASAPQARERLQVLLAHERA----SYGGQ-SDLVAVLRE
MINE_BRUSU       ----MSIFR-FF---TRQQ---ASAPQARERLQVLLAHERA----SYGGQ-SDLVAVLRE
MINE_RHILO       ---MMNVFD-LF---KRR----SSAPVARERLQVLLAYERR----NRSQ--PDLVSILRE
MINE_GRABC       ----MSLFG-FL---QRK----PTAQVARNRLQILLAHERG----LEGN--ADLAAILQE
MINE_BRASB       ----MSVLR-LF---TGRA---ASAPVARERLQILLAHERS----LRGQ--PDLLMQLRE
MINE_BRASO       ----MSVLR-LF---TGRA---ASAPVARERLQILLAHERS----LRGQ--PDLLMQLRE
MINE_RHOP5       ----MALLR-LF---SGRK---ASAPVARERLQILLAHDRG----LCGQ--PNLLGLLRE
MINE_BRADU       ----MGLLR-LL---RGNK---ASAPVARERLQILLAHERG----MRGQ--PDLLGVLRE
MINE_GLUOX       ----MSFLSNIF---ARRQ---QSSSVAKDRLQILLAHERG----AGEAGESDLIRQLHK
MINE_PARDP       ----MFGFS-FR---QRKP---SSAQTAKERLQILLAHERS----SGGSN-PDFLPLLQR
MINE_DESPS       ----MSLFS-FF---KNEEK-PSSAARAKERLQVVIAHERG----AVER--PDYLPQLQR
MINE_NITOC       ----MSWFNYFR---ATRG---NSARTAKERLQIVIAHERI----DRSG--PSYLPRLRG
MINE_NEIGO       ----MSLIELLF---GRKQ---KTATVARDRLQIIIAQERA----QEGQT-PDYLPTLRK
MINE_NEIG1       ----MSLIELLF---GRKQ---KTATVARDRLQIIIAQERA----QEGQT-PDYLPTLRK
MINE_NEIMA       ----MSLIEFLF---GRKQ---KTATVARDRLQIIIAQERA----QEGQT-PDYLPTLRK
MINE_NEIMB       ----MSLIEFLF---GRKQ---KTATVARDRLQIIIAQERA----QEGQA-PDYLPTLRK
MINE_NEIMF       ----MSLIEFLF---GRKQ---KTATVARDRLQIIIAQERA----QEGQA-PDYLPTLRK
MINE_ACIAC       ---MASFLSFLL---GEKK---KTASVAKERLQIILAHERN----GRNASEPDYLPALQR
MINE_VEREI       ---MASFLSFLL---GEKK---KTASIAKERLQIILAHERN----GRNACEPDYLPALQR
MINE_RHOFT       ----MSFFSFFV---GEKK---KSASVAKERLQIILAHERS----GRNAAEPDYLPALQR
MINE_ACISJ       ----MSLLSFLL---GEKK---KTASVAKERLQIILAHERS----GRSAGQPDYLPALQR
MINE_METPP       ----MSLLSFLL---GEKK---KTASVAKERLQIILAHERS----GRGGSRPDYLEALQR
MINE_POLNA       ---MASFFSFLL---GEKK---KTANVAKERLQIILAHERS----GRNSHEPDYLPALQR
MINE_POLSJ       ---MASFLSFLL---GEKK---QTASVAKERLQIILAHERT----GR-SHKPDYLPALQR
MINE_BORBR       ----MSFLSFLL---GQKK---SSASVAKERLQIILAHER-----GRGDS-PDYLPQLQQ
MINE_BORPA       ----MSFLSFLL---GQKK---SSASVAKERLQIILAHER-----GRGDS-PDYLPQLQQ
MINE_BORPE       ----MSFLSFLL---GQKK---SSASVAKERLQIILAHER-----GRGDS-PDYLPQLQQ
MINE_BORA1       ----MSFLSFLL---GQKK---SSASVAKERLQIILAHERS----GRGDS-PDYLPQLQQ
MINE_BURCA       ----MSILSFLL---GEKK---KSASVAKERLQLIIAHERV----GGRPP-ADYLPALQK
MINE_BURCH       ----MSILSFLL---GEKK---KSASVAKERLQLIIAHERV----GGRPP-ADYLPALQK
MINE_BURCM       ----MSILSFLL---GEKK---KSASVAKERLQLIIAHERV----GGRPP-ADYLPALQK
MINE_BURL3       ----MSILSFLL---GEKK---KSASVAKERLQLIIAHERV----GGRPP-ADYLPALQK
MINE_BURMA       ----MSILSFLL---GEKK---KSAAVAKERLQLIIAHERV----GGRPP-ADYLPALQK
MINE_BURTA       ----MSILSFLL---GEKK---KSAAVAKERLQLIIAHERV----GGRPP-ADYLPALQK
MINE_BURPS       ----MSILSFLL---GEKK---KSAAVAKERLQLIIAHERV----GGRPP-ADYLPALQK
MINE_BURP0       ----MSILSFLL---GEKK---KSAAVAKERLQLIIAHERV----GGRPP-ADYLPALQK
MINE_BURP1       ----MSILSFLL---GEKK---KSAAVAKERLQLIIAHERV----GGRPP-ADYLPALQK
MINE_PARXL       ----MSILSFLL---GEKK---KSASVAKERLQLIIAHERA----GGHAP-ADYLPALQR
MINE_CUPNH       ----MSILSFLL---GEKK---KSASVAKERLQIILAHERT----GHSAP-ADYLPALQR
MINE_CUPPJ       ----MSILSFLL---GEKK---KSASVAKERLQIILAHERT----GHSAP-ADYLPALQR
MINE_CUPMC       ----MSILSFLL---GEKK---KSASVAKERLQIILAHERS----GHSAP-ADYLPALQR
MINE_RALSO       ----MSILSFLL---GEKK---KTASVAKERLQIILAHERS----SHSAP-ADYLPALQR
MINE_AZOSB       ----MSLLARLF---GEKK---KTAEIAKNRLSLLIAHERS----GGAGT-ADFLPALQK
MINE_AROAE       ----MTFLARLF---GEKK---KTAEIAKNRLSLLIAHERG----DGVPK-VDFLPALQR
MINE_DECAR       ----MSLLSMLF---GNKP---KTAHLAKERLQLIIAHERD----GGGSS-ANFLPDLQR
MINE_THIDA       ----MSWLSLIF---GEKK---STASVAKERLQLIIAHERV-----GLSG-RDFLPDLQK
MINE_HERAR       ----MALLSFLF---NTKP---KTANAAKERLQIIIARERN-----GRTG-PDFLPALHK
MINE_CHRVO       ----MSLIDMIF---GKRQ---KSAAIARERLQIILAHERN----GRHAP--DYLPALQR
MINE_ALCBS       ----MSIFSYLL---PKKQ---NTASVAKERLQIIVARERS-----TRGG-PDYLPQLQE
MINE_ALKEH       ----MGFLSYFR---SQKK---RSASVAKERLQIIVARERS----QTATG-PDYLPMLKE
MINE_CHRSD       ----MKLLEFLK---RERK---KSASVAKERLQIIVAHQRG-----QRDQ-PDYMPMLEK
MINE_HALHL       ----MGIADYFRERRRSRR---GSASVAKERLQIIVSHERA-----ERGG-PDYLPMLRQ
MINE_NITEU       ----MSLLDYFR---SSKS---KTASVAKERLQILVAHERY-----YRNK-PSYLPQLQE
MINE_NITEC       ----MSLLDYFK---SSKS---KTASVAKERLQILVAHERY-----YRNK-PSYLPQLQE
MINE_METCA       ----MGLLDYFR---GSRT---DSAAVAKERLQILVAHERA-----ERNK-PDYLPLLQK
MINE_XYLFA       ----MGLIDFLR----NKT---KTAETAKNRLQIIIAQERT----QRGGP--DYLPLLQR
MINE_XYLFT       ----MGLIDFLR----NKT---KTAETAKNRLQIIIAQERT----QRGGP--DYLPLLQR
MINE_XANAC       ----MGLLDFLK----SKK---NTAETAKNRLQIIIAQERN----HRGGP--DYLPLMQR
MINE_XANOM       ----MGLLDFLK----SKK---NTAETAKNRLQIIIAQERN----HRGGP--DYLPLMQR
MINE_XANC5       ----MGLLDFLK----SKK---NTAETAKNRLQIIIAQERN----HRGGP--DYLPLMQR
MINE_XANOR       ----MGLLDFLK----SKK---NTAETAKNRLQIIIAQERN----HRGGP--DYLPLMQR
MINE_XANCP       ----MGLLDFLK----SKK---NTAETAKNRLQIIIAQERN----HRGGP--DYLPLMQR
MINE_XANC8       ----MGLLDFLK----SKK---NTAETAKNRLQIIIAQERN----HRGGP--DYLPLMQR
MINE_PSEAE       ----MSLLDFFRS--RKS---QNSASIAKERLQIIVAHERG------QRAQPDYLPQLQK
MINE_PSEAB       ----MSLLDFFRS--RKS---QNSASIAKERLQIIVAHERG------QRAQPDYLPQLQK
MINE_PSEPK       ----MNLFDFFRG--RQK---QTSASVAKERLQIIVAHERG------QRSEPDYLPALQK
MINE_PSEE4       ----MNLFDFFRG--RQK---QTSASVAKERLQIIVAHERG------QRSTPDYLPALQK
MINE_PSESM       ----MNIFDFFRD--RKK---ESTASVAKERLQIIVAHERG------QRSTPDYLPALQK
MINE_PSE14       ----MNIFDFFRD--RKK---ESTASVAKERLQIIVAHERG------QRSTPDYLPALQK
MINE_PSEU2       ----MNIFDFFRD--RKK---GSTASVAKERLQIIVAHERG------QRSTPDYLPALQK
MINE_PSEF5       ----MNLFDFFRA--SKK---VSTASVAKERLQIIVAHERG------QRSTPDYLPALQK
MINE_PSEPF       ----MNLFDFFRA--NKK---PSTASVAKERLQIIVAHERG------QRSTPDYLPSLQK
MINE_PSEU5       ----MNLLDFFRE--RKKK--ETPAAIAKERLQIIVAHERG------QRSEPDYLPALQK
MINE_SYNAS       ----MSILDYLRS--LQK---RRSASIAKERLQIIVAHERN----GLSRRTLDFLPLLQK
MINE_HAHCH       ----MSFWDYFRS---NK---QATASVAKERLQIIVAHERS------QRNQPDYLPQLQQ
MINE_MARHV       ----MSFFDYFRS---KK---NSTASVAKERLQIIVAHERG------QREQPDYLPQLQQ
MINE_LEGPL       ----MSIFNYLR----RR---ASTASVAKERLQIIISHERS------QRNTPDYLPKLQE
MINE_LEGPA       ----MSIFNYLR----RR---ASTASVAKERLQIIISHERS------QRNTPDYLPKLQE
MINE_PSEA6       ----MSIFNYFLK--KEK---KSSASLAKERLQIIVAHERS------KRQQPDYLPLMQK
MINE_HYDCU       ----MALLDYLLG--QKKK---KSANLAKDRLQILLAHERS------ERSAPEYLPKMRE
MINE_PSYIN       ----MGLLGYFRSDIPKKS----SAKLAKDRLQIIVAHEHS----NAVC--PAYLPEMQN
MINE_FRATH       -----MLAKLFGL--SKKQ---QSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKD
MINE_FRATO       -----MLAKLFGL--SKKQ---QSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKD
MINE_FRATN       -----MLAKLFGL--SKKQ---QSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKD
MINE_FRATT       -----MLAKLFGL--SKKQ---QSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKD
MINE_FRAT1       -----MLAKLFGL--SKKQ---QSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKD
MINE_FRATW       -----MLAKLFGL--SKKQ---QSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKD
MINE_ACIBT       MA---GFWSKLFS--SEE--KPSSAQTAKDRLKVIVASEQG----LGRRLSQDKIDQMKK
MINE_ACIAD       MA---GFWSKIFG--NDE--KPSSAQTAKDRLKVIVASEQG----LGRRLSQDKIDQMKK
MINE_PSYA2       MSKKKGFWSSLFG--TDDNSNTGSANMATERLKVIVASENR----LSNRLTADRIEKMKR
MINE_PSYCK       MSKKKGFWSSLFG--TDD-SNAGSANMATERLKVIVASENR----LNNRLTADRIEKMKR
MINE_DEIRA       ---------MFGWFKGRR-----SKETLKDRLELVLAYDRAK-------IAPGKVEALRN
MINE_DEIGD       ---------MFSWLKGRR-----SKDTLKDRLELVLAYDRAQ-------IPPGKVDALRN
MINE_SYNY3       -----MILELIERLFSRSGK--NSGEDARRRLKLVIANDRSG-------LSPEMMEEMRR
MINE_GUITH       -----MITEFFERLF-LSNK--GSREDVKRRLKLVLAHDRST-------LNASTLEKMRE
MINE_NOSS1       -----MILELLDKLFLRTPD--TSRSHVKRRLQLVIAHDRAG-------LDPETLEKMRK
MINE_TRIV2       -----MILELLDKLFLRTPD--TSRSHVKRRLQLVIAHDRAG-------LDPETLEKMRK
MINE_TRIEI       -----MLNEIIEKLFYRNNP--KSREEVKRRLKLVIAHDRAD-------LNPEIIQAMRK
MINE_SYNP6       -----MLADLFERLFPRQQ---ASRDTVKQRLKLVLAHDRAD-------LSPELLQKMRQ
MINE_SYNE7       -----MLADLFERLFPRQQ---ASRDTVKQRLKLVLAHDRAD-------LSPELLQKMRQ
MINE_SYNJB       -----MLLDFLDQLFSRHSG--NSRQQAKQRLKLILAHDRAD-------LTPAALESMRL
MINE_SYNJA       -----MLLDFLDQLFSRHSG--NSREQAKQRLKLILAHDRAD-------LTPAALEAMRL
MINE_THEEB       -----MISELLERLFTRTP---PSRTTAKERLKLVLAHDRTA-------LTPEILDNLRR
MINE_PROM1       --MAMTLRDIINKLLRRQP---ASASTARERLQLVLAHDRSD-------LSTELLDQMRK
MINE_PROMT       --MAMTLRDIINKLLRRQP---ASASTARERLQLVLAHDRSD-------LSTELLDQMRK
MINE_PROMA       ----MTLRDILNKLMGRQP---ASAAKARERLQLVLAHDRTD-------LSPDLLEQMRE
MINE_PROM0       ---MMTLRDLINKLLGRET---ASANTARERLQLVLAHDRVDMS----SLTTDLLDKMRK
MINE_PROM9       ---MMTLRDLINKLLGRET---ASANTARERLQLVLAHDRVDMS----SLTTDLLDKMRK
MINE_PROMS       ---MMTLRDLINKLLGRET---SSANTARERLQLVLAHDRVDMS----SLTTDLLDKMRK
MINE_PROM5       ----MTLRDLINKLLGRET---SSANTARERLQLVLAHDRVDMS----SLTTDLLDKMRK
MINE_PROMP       ---MMTLRDLINKLLGRET---ASANTARERLQLVLAHDRVDMS----SLTTDLLDKMRK
MINE_PROM3       --MATTLRDILDKLLGRQP---ASAKTARERLQLVLAHDRSD-------LSPELLDQMRR
MINE_PROMM       --MATTLRDILDKLLGRQP---ASAKTARERLQLVLAHDRSD-------LSPELLDQMRR
MINE_SYNS3       ----MTLRDLVDKLLGRQP---ASASTARDRLQLVLAHDRSD-------LSPELLDQMRR
MINE_SYNPX       ----MTLQDLIDKLLGRQP---ASADTARQRLQLVLAHDRSD-------LNPELLDQMRR
MINE_SYNPW       ----MTLQDLLDRILGRQP---ASATTARERLQLVLAHDRSD-------LSPELLDQMRR
MINE_SYNSC       ----MTLKEFIDKLLRRQP---ASAETAKERLQLVLAHDRSD-------LNPELLEQMRR
MINE_SYNS9       ----MTVKDFIDKLLGRQT---SSASTAKQRLQLVLAHDRSD-------LNPELLAQMRR
MINE_GLOVI       -----MVFDLLERLFNRNKT--GSATVAKDRLKMVLAVDRTE-------IAPQTIEQIRK
MINE_CARHZ       -----------MKLFGKEQQ--NSKTMAKERLRLVLVQDRTN-------VSPELLQNLKE
MINE_DESHY       ------MLEFISRMLGKEP---ASKNVAKERLRLVLVHDRAT-------ISPHMLNQLKE
MINE_MOOTA       ------MLEFLLRFFGRDTA--SSKKVAKERLRLVLVHDRAG-------VSPHLLESLKN
MINE_SYMTH       ------MLDLISRVFGRDHS---SADIARERLRLVLVHDRTN-------VSPQFLETLKE
MINE2_SYNWW      ------MLDIINRLLGRENA--GSRDIARERLRLVLIHDRAS-------VSPNFLNALKE
MINE1_SYNWW      ------MLDFLKRVFADSS----SRKQANDRLRVVLTHDRTG-------TSSRLMETLKE
MINE_SYNFM       ------MLKAIRRFFGEKA----SGQVARRRMQVVLMHDRMD-------LTPDIMEALRN
MINE_HUNT2       ------MLLDLSKIFGK-SK--NSKDLAKERLKLVLIHDRAN-------VSPQFLEMVKG
MINE_CALS4       --------MDLFKAFGG-KS--NSKDIAKERLQLLLVHDRID-------TSPRFLEMIKE
MINE_CLOD6       -------MLDLFRVFSNEAK--TSKSVAKERLKLVLVHDRVD-------CSPQLLEMIKT
MINE_CLOPE       --------MSFLNVFSS-RP--TPKQVAKDRLKVILIHDRGE-------LSDEVLDKIRL
MINE_CLOP1       --------MSFLNVFSS-RP--TPKQVAKDRLKVILIHDRGE-------LSDEVLDKIRL
MINE_CLOPS       --------MSFLNVFSS-RP--TPKQVAKDRLKVILIHDRGE-------LSDEVLDKIRL
MINE_CLONN       --------MDLFKLFSG-KP--SSKEVAKDRLKLILIHDRSS-------IAPELLEVMKS
MINE_FUSNN       --------MGFFSNFFK-KE--NSKDDAKNRLKLVLIQDRAM-------LPSGVLENMKD
MINE_HELPJ       --------MSLFDFFK--NK--GSAATATDRLKLILAKERTL--------NLPYMEEMRK
MINE_HELAH       --------MSLFDFFK--TK--GSAATATDRLKLILAKERTL--------NLPYMEEMRK
MINE_HELPY       --------MSLFDFFK--NK--GSAATATDRLKLILAKERTL--------NLPYMEEMRK
MINE_HELPH       --------MSLFGFFK--NK--GSATTATDRLKLILAKERTL--------NLPYMEEMRK
MINE_HELHP       --------MSLLGMFGHSSQ--KSATLARERLKLVLSHERTA--------NIPYLEDMQK
MINE_WOLSU       --------MSFLDKFFGKEK--SSAKSASDRLKLVLAHERAV--------NLPYLEEMKR
MINE_CHLVU       ----MVELNFTQ---KQKQ-FLKDRKSLKSLVNQHLASDLG------ETSLSQYLDEFQI
                                                :   :                     .  

MINE_BUCAI       EILSVICKYVNIEPNMVT-------VQLDQ------KNE-DISILELNIILP--------
MINE_BUCAP       EILSVICKYVNIDPHMVT-------IQLEQ------KNE-DISVLELNIILP--------
MINE_ECOLI       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SHIFL       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_ECOL6       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_ECO57       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_ECOUT       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_ECOK1       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_ECOL5       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SHIBS       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SHIDS       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SHIF8       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SHISS       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SALCH       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SALPA       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SALTI       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SALTY       DILEVICKYVQIDPEMVT-------VQLEQ------KDG-DISILELNVTLP--------
MINE_SODGM       DLLEVISKYVQIDPEMLS-------VQLEK------KDG-DISILELNVTLP--------
MINE_YERPE       DILAVICKYIQIDPEMLH-------VQFEQ------KGD-DISVLELNVTLP--------
MINE_YERPS       DILAVICKYIQIDPEMLH-------VQFEQ------KGD-DISVLELNVTLP--------
MINE_YERE8       DILAVICKYIQIDPEMLH-------VQFEQ------KGD-DISVLELNVTLP--------
MINE_YERPA       DILAVICKYIQIDPEMLH-------VQFEQ------KGD-DISVLELNVTLP--------
MINE_YERPN       DILAVICKYIQIDPEMLH-------VQFEQ------KGD-DISVLELNVTLP--------
MINE_YERPP       DILAVICKYIQIDPEMLH-------VQFEQ------KGD-DISVLELNVTLP--------
MINE_PHOLL       DILAVICKYIQVDPDMLS-------VQFEQ------KGD-DISVLELNITLP--------
MINE_PECAS       DILEVICRYVQIDPEMVT-------VQLEQ------KGD-DISVLELNVTLP--------
MINE_BUCBP       EIFQVICKYIKINPEKIK-------IQLDQ------TNK-NISILELNVTLS--------
MINE_BAUCH       DLLQVLCKYASITPEMLS-------VQLEM------KNG-DISILEVQVIRP--------
MINE_BLOFL       DLLRIIHQYIHE-PKKIS-------IQLQE------QDN-NAYMLQLTISFL--------
MINE_BLOPB       DLVQTISKYIHN-PRILS-------IQLEK------KDN-NTSILKCKIIFF--------
MINE_BUCCC       DLLLVIAKYIKIQPNKMS-------IQIEK------RKK-NLLILEINITNV--------
MINE_WIGBR       DLIKVIKKYINLNSETLC-------VKLDH------KNKKNIKIFELNIVFP--------
MINE_VIBVU       DILKVISKYVAIDPAMVD-------LTFEH------KDD-DISVLELNVKLP--------
MINE_VIBVY       DILKVISKYVAIDPAMVD-------LTFEH------KDD-DISVLELNVKLP--------
MINE_VIBPA       DILKVISKYVDIDPNMVD-------LTFEH------KDD-DISVLELNVKLP--------
MINE_VIBCH       DILKVIAKYVAIDPSMVE-------LSFEH------KGD-DISVLELNVKLP--------
MINE_ALIF1       DILKVISKYVEVNPDMVT-------VSLEQ------KEE-DLSVLELNVTLP--------
MINE_PHOPR       DLLEVIRKYVNINPDQVS-------VNLDQ------KDE-DLSVLELNVTLP--------
MINE_COLP3       DILKVLRKYIKVSDESFS-------INLDK------KDG-DLNVLELNIELH--------
MINE_AERHH       DILDVIRKYVQIDPDKIT-------VQLDK------KSD-ELSVLELNITFA--------
MINE_AERS4       DLLDVIRKYVQIDPDKIT-------VQLDK------KSD-ELSVLELNITFA--------
MINE_SHEDO       EIIEVIRKYVQISEDQVS-------VQLDQ------NDD-NLSVLELNVTLP--------
MINE_SHEFN       EIIEVIRKYVQISDDQVS-------VQLDQ------NDD-NLSVLELNVTLP--------
MINE_SHEON       EIIAVIRKYVQISDDQVS-------VQLDQ------NDD-NLSVLELNVTLP--------
MINE_SHESW       EIIAVIRKYVQISDDQVS-------VQLDQ------NDD-NLSVLELNVTLP--------
MINE_SHESA       EIIAVIRKYVHISDDQVS-------VQLDQ------NDD-NLSVLELNVTLP--------
MINE_SHESM       EIIAVIRKYVHISDDQVS-------VQLDQ------NDD-NLSVLELNVTLP--------
MINE_SHESR       EIIAVIRKYVHISDDQVS-------VQLDQ------NDD-NLSVLELNVTLP--------
MINE_SHELP       EIIEVIRKYVQIDSDQVS-------VQLDQ------NDD-NLSVLELNVTLP--------
MINE_SHEAM       EIIEVIRKYVYISEEQVS-------VQLEQ------NDD-NLSVLELNVTLP--------
MINE_PSET1       DILDVIRKYVNVSSDAVQ-------VQFDQ------NED-DLAVLELNVTLP--------
MINE_RHIEC       EILAVIAKHVELDHDKVQ-------VTIDR------NEF--VSTLEIDVEIP--------
MINE_RHIL3       EILAVIAKHVQLDHDKVQ-------VTIDR------NEY--VSTLEIDVEIP--------
MINE_AGRFC       EILSVIAKHVQIDNDRVH-------VKMDR------DEH--VSILEIDVEIP--------
MINE_CHESB       EIIAVIAKHIQVDSEKVN-------VKMDR------DEK--VSTLEIDVEIP--------
MINE_RHIME       EILAVIAKHVQVDRDKVN-------VTMER------GEH--VTTLEVDIEIP--------
MINE_BRUAB       EILAVIAKHIKVDREKVS-------VKMDR------GDQ--VSTLEVDIELP--------
MINE_BRUA2       EILAVIAKHIKVDREKVS-------VKMDR------GDQ--VSTLEVDIELP--------
MINE_BRUME       EILAVIAKHIKVDREKVS-------VKMDR------GDQ--VSTLEVDIELP--------
MINE_BRUSU       EILAVIAKHIKVDREKVS-------VKMDR------GDQ--VSTLEVDIELP--------
MINE_RHILO       EIMAVIAKHVQIDQDYLQ-------VSMDR------GET--MSTLEIDIQIP--------
MINE_GRABC       EIIAVIAKHVEIDREKVQ-------VKLDR------GSA--FSTLEIDVEMP--------
MINE_BRASB       EILAVVSRHVLLDPDKVI-------VRMDR------GKH--VSTLEVDIELP--------
MINE_BRASO       EILAVVSRHVLLDPDKVI-------VRMDR------GKH--VSTLEVDIELP--------
MINE_RHOP5       EILAVVSRHVQLDPEKVV-------VRMDR------GKS--VSTLAVDIELP--------
MINE_BRADU       EILAVVSKHVTLDPTKVI-------VRLER------GDE--VSTLEVDIEVP--------
MINE_GLUOX       EIMEVIARHVAVDQDKVQ-------IKVDR------GSG--CSMLEIDVEVP--------
MINE_PARDP       DILEVVRRHMEIDSDAVD-------VKLER------SDD--LSSLEINIELP--------
MINE_DESPS       DLLEVIKKYVDISEDKLD-------IKVDC------IGG--LSTLEVNVELP--------
MINE_NITOC       DIIEVIRKYIEIDEDQVK-------IQMEQ------EGD--MDVLALNIQLP--------
MINE_NEIGO       ELMEVLSKYVNVSLDNIR-------ISQEK------QDG--MDVLELNITLP--------
MINE_NEIG1       ELMEVLSKYVNVSLDNIR-------ISQEK------QDG--MDVLELNITLP--------
MINE_NEIMA       ELMEVLSKYVNVSLDNIR-------ISQEK------QDG--MDVLELNITLP--------
MINE_NEIMB       ELMEVLSKYVNVSLDNIR-------ISQEK------QDG--MDVLELNITLP--------
MINE_NEIMF       ELMEVLSKYVNVSLDNIR-------ISQEK------QDG--MDVLELNITLP--------
MINE_ACIAC       ELVAVISKYVKISPEDLK-------VQLER------QDN--LEVLEVKIELP--------
MINE_VEREI       ELVAVISKYVKINPEHLT-------VHLER------QDD--LEVLEVKIELP--------
MINE_RHOFT       ELMAVISKYVKINLEDIK-------VNVER------QDD--LEVLEVKIELP--------
MINE_ACISJ       ELVAVISKYVKINADDLK-------VHFER------QDD--LEVLEVKIELP--------
MINE_METPP       ELVAVISKYVSIKPEDIK-------VHLQK------QDN--LEVLEVKLELP--------
MINE_POLNA       DLIAVIAKYININPNDIK-------LNLER------QEN--LDVLEVKIELP--------
MINE_POLSJ       DLIAVIAKYIHINPNDIK-------LHLER------QDN--LDVLEVKIELP--------
MINE_BORBR       ELVAVISKYVKIDPEDIK-------VHLER------QDT--LEVLEVKIEMP--------
MINE_BORPA       ELVAVISKYVKIDPEDIK-------VHLER------QDT--LEVLEVKIEMP--------
MINE_BORPE       ELVAVISKYVKIDPEDIK-------VHLER------QDT--LEVLEVKIEMP--------
MINE_BORA1       ELVAVISKYVKINPDDIK-------VHLER------QDT--LEVLEVKIEMP--------
MINE_BURCA       ELVAVISKYVHISDDDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_BURCH       ELVAVISKYVHISDDDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_BURCM       ELVAVISKYVRISNDDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_BURL3       ELVAVISKYVHISNDDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_BURMA       ELVAVISKYVKISNDDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_BURTA       ELVAVISKYVKISNDDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_BURPS       ELVAVISKYVKISNDDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_BURP0       ELVAVISKYVKISNDDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_BURP1       ELVAVISKYVKISNDDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_PARXL       ELVAVISKYVKISHEDIR-------VSLER------QDD--LEVLEVKIEIP--------
MINE_CUPNH       ELVAVISKYVKIGDQDLR-------VSLER------QDN--LEVLEVKIEIP--------
MINE_CUPPJ       ELVAVISKYVKISDQDLR-------VSLER------QDN--LEVLEVKIEIP--------
MINE_CUPMC       ELVAVISKYVKISDQDLR-------VSLER------QDN--LEVLEVKIEIP--------
MINE_RALSO       ELVAVISKYVKIGNDDIK-------VNLER------QDN--LEVLEVKIEIP--------
MINE_AZOSB       DLIDVISKYVNVNPDDIK-------VQLDK------QDN--VEVLEVNIVLP--------
MINE_AROAE       ELIEVISKYVPVNSDDIK-------VHLDK------QNN--YEVLEVNIVLP--------
MINE_DECAR       ELIAVISKYVKVNTEDIR-------VSLEK------QGN--YEVLEVNIVLP--------
MINE_THIDA       DLVAVISKYVKIDPDDIK-------VGLEK------QGN--YEVIEVNIVLP--------
MINE_HERAR       ELIAVISKYVKVNPDDIK-------ISLNS------QGN--LEVLDVNVVLP--------
MINE_CHRVO       ELMEVISKYVSVNLEDIK-------VQVER------QDD--YEVLEVNIVLP--------
MINE_ALCBS       ELLQVVRKYVPVDQDAVN-------VQVDR------ESG--CEILELNITLP--------
MINE_ALKEH       ELLDVIRKYVQVDRDAVN-------FQLDR------EGD--CEVLELNITLP--------
MINE_CHRSD       ELLEVIRRYVQVDQDAIN-------ISLDR------DND--CSVLELNVTLP--------
MINE_HALHL       ELLEVVRRYVTVDPDAVR-------VDVER------DGP--HEVLELNITLP--------
MINE_NITEU       ELMQVIRKYVQVDQDAIS-------VKFEQ------DDN--QETLELNIILP--------
MINE_NITEC       ELMQVIRKYVQVDQDAIS-------VKFEQ------DDN--QETLELNITLP--------
MINE_METCA       ELLEVIRKYVNVGQDAIT-------VTMEK------DDN--REVLELNVVLP--------
MINE_XYLFA       ELLEVIKKYVKIDADAVK-------VDLIK------DGA--NDVLDISVALP--------
MINE_XYLFT       ELLEVIKKYVKIDADAVK-------VDLIK------DGA--NDVLDISVALP--------
MINE_XANAC       ELLEVIKKYVNIDADAVR-------VDLVK------DGE--HDVLDISVALP--------
MINE_XANOM       ELLEVIKKYVNIDADAVR-------VDLVK------DGE--HDVLDISVALP--------
MINE_XANC5       ELLEVIKKYVNIDADAVR-------VDLVK------DGE--HDVLDISVALP--------
MINE_XANOR       ELLEVIKKYVNIDADAVR-------VDLVK------DGE--HDVLDISVALP--------
MINE_XANCP       ELLEVIKKYVNIDADAVR-------VDLVK------DGE--HDVLDITVALP--------
MINE_XANC8       ELLEVIKKYVNIDADAVR-------VDLVK------DGE--HDVLDITVALP--------
MINE_PSEAE       DLLEVIRKYVPIDQEQIQ-------VELEN------QGN--CSILELNITLP--------
MINE_PSEAB       DLLEVIRKYVPIDQEQIQ-------VELEN------QGN--CSILELNITLP--------
MINE_PSEPK       ELLEVIRKYVNIGNDDVH-------IELEN------QGS--CSILELNITLP--------
MINE_PSEE4       ELVEVIRKYVNIGNDDVQ-------VALEN------QGS--CSILELNITLP--------
MINE_PSESM       ELVEVIRKYVNIESDQVQ-------VALES------QGS--CSILELNITLP--------
MINE_PSE14       ELVEVIRKYVNIESDQVQ-------VALES------QGS--CSILELNITLP--------
MINE_PSEU2       ELVEVIRKYVNIESDQVQ-------VALES------QGS--CSILELNITLP--------
MINE_PSEF5       ELVEVIRKYVNIGSDDVH-------VALEN------QGS--CSILELNITLP--------
MINE_PSEPF       ELVEVIRKYVNIGNDDVH-------VALES------QGS--CSILELNITLP--------
MINE_PSEU5       ELVEVIRKYVNIDSDQVH-------VALED------QGS--CSILELNITLP--------
MINE_SYNAS       ELLDVVRKYVEVSDSQIK-------VNLEK------NGN--YEVLEVNIALA--------
MINE_HAHCH       EILEVIGKYVKINREDIQ-------VQIDR------NDD--CAVLELNITLP--------
MINE_MARHV       ELLQVIRKYVQISDDMVQ-------VEVDR------NDH--CSVLELNVTLP--------
MINE_LEGPL       EILAVIAKYVNISRDQVS-------VNLER------MED--SAVLELNITMP--------
MINE_LEGPA       EILAVIAKYVNISRDQVS-------VNLER------MED--SAVLELNITMP--------
MINE_PSEA6       EIMDVIRKYVNIDEEQVI-------VQLDN------NED--CSVLELNITLP--------
MINE_HYDCU       EILAVISKYVTIDQEQLQ-------ISIDE------ANG--FEVLELNLVLP--------
MINE_PSYIN       EIIEVIRKFMKISNDDVK-------CEFSD------NAEDDMSVLEVNITLP--------
MINE_FRATH       EIIEVVKKYVALSEENIRD------IDLKV------EDSSKNSTIEVNIPFN--------
MINE_FRATO       EIIEVVKKYVALSEENIRD------IDLKV------EDSSKNSTIEVNIPFN--------
MINE_FRATN       EIIEVVKKYVALSEENIRD------IDLKV------EDSSKNSTIEVNIPFN--------
MINE_FRATT       EIIEVVKKYVALSEENIRD------IDLKV------EDSSKNSTIEVNIPFN--------
MINE_FRAT1       EIIEVVKKYVALSEENIRD------IDLKV------EDSSKNSTIEVNIPFN--------
MINE_FRATW       EIIEVVKKYVALSEENIRD------IDLKV------EDSSKNSTIEVNIPFN--------
MINE_ACIBT       EIMQVVSRYVSGVGEQHIQ------MQVRS------EAN--IEMLEMNINLP--------
MINE_ACIAD       EIMQVVSRYVRGVDEDHIQ------MQVRS------EAN--IEMLEMNINLP--------
MINE_PSYA2       EILEVVNKYVNGVQIDDVN------INHRS------EDS--LDVLEMNINLP--------
MINE_PSYCK       EILEVVNKYVNGVQIDDVN------INHRS------EDS--LDVLEMNINLP--------
MINE_DEIRA       DLLEVVQKYFPSG---NSK------VEVEQ--------DGDKVVLMASISI---------
MINE_DEIGD       DLLEVVKRYFPAG---SSN------VEVEQ--------RGDQVVLMASIAL---------
MINE_SYNY3       EIVEVVSRYVEID-PGEME------FSLES--------DQRMTALIANLPV---------
MINE_GUITH       EILLVVSKYVELD-TDSLE------FSIRT--------DSKMTALIANLPI---------
MINE_NOSS1       EILDIVCRYVEVE-PDGLE------FALES--------NQRTTALIANLPI---------
MINE_TRIV2       EILDIVCRYVEVE-SDGLE------FALES--------NQRTTALIANLPI---------
MINE_TRIEI       DIIDVVSRYVEID-DTDSE------FLLEN--------NQRATSLVANLPI---------
MINE_SYNP6       EILEVVSRYVELD-SEGME------LSLEN--------DQRVTALVANLPI---------
MINE_SYNE7       EILEVVSRYVELD-SEGME------LSLEN--------DQRVTALVANLPI---------
MINE_SYNJB       EILGVVSRYVELD-SEGMQ------FHLAT--------EGGTTALIANLPI---------
MINE_SYNJA       EILGVVSRYVELD-SEGMQ------FHLAA--------EGGTTALIANLPI---------
MINE_THEEB       DILEVVSRYVELE-TEGLA------VSLES--------DQRTTALIANLPI---------
MINE_PROM1       EILEVVAKYVEID-VDEGA------VSLET--------EDRMTALVANLPI---------
MINE_PROMT       EILEVVAKYVEID-VDEGA------VSLET--------EDRMTALVANLPI---------
MINE_PROMA       EILSVVAKYVEID-FEEGA------VSLET--------EDRMTALVANLPI---------
MINE_PROM0       EILDVVAKYVEID-FEEVA------VSLET--------EDRMTALVANLPI---------
MINE_PROM9       EILDVVAKYVEID-FEEVA------VSLET--------EDRMTALVANLPI---------
MINE_PROMS       EILDVVAKYVEID-FDEVA------VSLET--------EDRMTALVANLPI---------
MINE_PROM5       EILDVVAKYVEID-FEEVA------VSLET--------EDRMTALVANLPI---------
MINE_PROMP       EILDVVAKYVEID-FEEVA------VSLET--------EDRMTALVANLPI---------
MINE_PROM3       EIFEVVAKYVEID-IEGGD------VSLET--------EDRMTALVANLPI---------
MINE_PROMM       EIFEVVAKYVEID-LEEGE------VSLET--------EDRMTALVANLPI---------
MINE_SYNS3       EIFEVVAKYVDID-LEEGD------VSLET--------EDRVTALVANLPF---------
MINE_SYNPX       EILEVVSRYVEID-LSEGD------VSLET--------EDRVTALVANLPI---------
MINE_SYNPW       EIFEVVAKYVDID-LEEGD------VTLET--------EDRVTALVANLPI---------
MINE_SYNSC       EILEVVARYVEID-LAQGD------VSLET--------EDRVTALVANLPI---------
MINE_SYNS9       EILEVVARYVEID-IEEGD------VSLET--------EDRMTALVANLPI---------
MINE_GLOVI       EILDVIVRYFEIDENEKFD------VTLER--------ERGSTAIIANVPI---------
MINE_CARHZ       DLIAVITKYMEID-EKALE------VNIDS--------HEDQVALIANIPI---------
MINE_DESHY       DLIKVISNYMEID-EGALE------VNLNQ--------DDREVALIANIPV---------
MINE_MOOTA       DLIKVISEYLDID-TDGLE------VSLTH--------ENDAVALVANIPI---------
MINE_SYMTH       ELIEVISRYMEIE-EEGMD------VTLQT--------AENQVALVANIPV---------
MINE2_SYNWW      ELIRVIREYMEID-EESLI------VDLEN--------EENSVALVANIPI---------
MINE1_SYNWW      EILEVISRHVEIE--GRPE------VKIIR--------EGRHSALDINIPL---------
MINE_SYNFM       DILAVISRYMEID-SRSIR------VDLEQ--------GKEYMALVSNIQI---------
MINE_HUNT2       EIIKVISNYMDVD-EESLD------IQMTRTK--SEDGNSVVPALVANIPI---------
MINE_CALS4       DILNVISNYVDID-EKGLR------VEITKER--KSD-DTFISALHANIPI---------
MINE_CLOD6       DILKVIANYAEIE-DDGLE------IKMSKCR--GEHDDKPVSALVANIPL---------
MINE_CLOPE       EILDVLSKYVEIE-NEDVD------ITVTK----SNPIEGESPSLVANIPI---------
MINE_CLOP1       EILDVLSKYVEIE-NEDVD------ITVTK----SNPIEGESPSLVANIPI---------
MINE_CLOPS       EILDVLSKYVEIE-NEDVD------ITVTK----SNAIEGESPSLVANIPI---------
MINE_CLONN       DILKVISKYVIID-DDEVE------VRLTK----TEEVDASSPALIASIPI---------
MINE_FUSNN       DILKVLSKYVEIE-KSKLN------IEMCP----YED-DPRKIALVANIPILKSSTREVT
MINE_HELPJ       EIIAVIQKYTKSS-----D------IHFKTL-------DGNQSVETIEVEI---------
MINE_HELAH       EIIAVIQKYTKSS-----D------IHFKTL-------DSNQSVETIEVEI---------
MINE_HELPY       EIIAVIQKYTKSS-----D------IHFKTL-------DSNQSVETIEVEI---------
MINE_HELPH       EIIAVIQKYTKSS-----D------IHFKTL-------DSNQSVETIEVEI---------
MINE_HELHP       EILQVVQKYTRSS-----K------IEFST--------NSNQNINTLEVEI---------
MINE_WOLSU       EILEVIKKYTHAE-----K------IEIKA--------DSNQQIDTLEVEI---------
MINE_CHLVU       LYNRFFCFYFFSYGENVFCSEEIFSSQLKNGFFPTKTKDEILSSPALNVIFSEKD-FLLL
                      .  .                                       :           

MINE_BUCAI       D-----------------------------------------
MINE_BUCAP       D-----------------------------------------
MINE_ECOLI       EAEELK------------------------------------
MINE_SHIFL       EAEELK------------------------------------
MINE_ECOL6       EAEELK------------------------------------
MINE_ECO57       EAEELK------------------------------------
MINE_ECOUT       EAEELK------------------------------------
MINE_ECOK1       EAEELK------------------------------------
MINE_ECOL5       EAEELK------------------------------------
MINE_SHIBS       EAEELK------------------------------------
MINE_SHIDS       EAEELK------------------------------------
MINE_SHIF8       EAEELK------------------------------------
MINE_SHISS       EAEELK------------------------------------
MINE_SALCH       EAEESK------------------------------------
MINE_SALPA       EAEESK------------------------------------
MINE_SALTI       EAEESK------------------------------------
MINE_SALTY       EAEESK------------------------------------
MINE_SODGM       ETEETTK-----------------------------------
MINE_YERPE       ETEETPK-----------------------------------
MINE_YERPS       ETEETPK-----------------------------------
MINE_YERE8       ETEETPK-----------------------------------
MINE_YERPA       ETEETPK-----------------------------------
MINE_YERPN       ETEETPK-----------------------------------
MINE_YERPP       ETEETPK-----------------------------------
MINE_PHOLL       EAEETQK-----------------------------------
MINE_PECAS       EAEETPK-----------------------------------
MINE_BUCBP       E-----------------------------------------
MINE_BAUCH       EMLDNNRLNNE-------------------------------
MINE_BLOFL       TKNQDLINSKKQDNTTV-------------------------
MINE_BLOPB       NEETQ-------------------------------------
MINE_BUCCC       K-----------------------------------------
MINE_WIGBR       EKNFLNKK----------------------------------
MINE_VIBVU       DEEK--------------------------------------
MINE_VIBVY       DEEK--------------------------------------
MINE_VIBPA       DDEK--------------------------------------
MINE_VIBCH       DDEK--------------------------------------
MINE_ALIF1       DEDDH-------------------------------------
MINE_PHOPR       EDK---------------------------------------
MINE_COLP3       DEQTAD------------------------------------
MINE_AERHH       DDKKG-------------------------------------
MINE_AERS4       DDKKG-------------------------------------
MINE_SHEDO       DTK---------------------------------------
MINE_SHEFN       DSK---------------------------------------
MINE_SHEON       DR----------------------------------------
MINE_SHESW       DR----------------------------------------
MINE_SHESA       DR----------------------------------------
MINE_SHESM       DR----------------------------------------
MINE_SHESR       DR----------------------------------------
MINE_SHELP       EKP---------------------------------------
MINE_SHEAM       ER----------------------------------------
MINE_PSET1       DEEPKI------------------------------------
MINE_RHIEC       LNAA-VQAA---------------------------------
MINE_RHIL3       LNAA-VQAA---------------------------------
MINE_AGRFC       LGAH-LRAA---------------------------------
MINE_CHESB       LQAG-GRAA---------------------------------
MINE_RHIME       MKAG-VRAA---------------------------------
MINE_BRUAB       LTAKKGRAA---------------------------------
MINE_BRUA2       LTAKKGRAA---------------------------------
MINE_BRUME       LTAKKGRAA---------------------------------
MINE_BRUSU       LTAKKGRAA---------------------------------
MINE_RHILO       NKSAVPMAIAG-------------------------------
MINE_GRABC       NGKK---A----------------------------------
MINE_BRASB       NGADRAFASAG-------------------------------
MINE_BRASO       NGADRAFASAG-------------------------------
MINE_RHOP5       NGLA--------------------------------------
MINE_BRADU       NDLERKRVAVA-------------------------------
MINE_GLUOX       QELSGKRGS---------------------------------
MINE_PARDP       YAKQLKRA----------------------------------
MINE_DESPS       DS----------------------------------------
MINE_NITOC       DASPPLSETRHSSKQ---------------------------
MINE_NEIGO       EQKKV-------------------------------------
MINE_NEIG1       EQKKV-------------------------------------
MINE_NEIMA       EQKKV-------------------------------------
MINE_NEIMB       EQKKV-------------------------------------
MINE_NEIMF       EQKKV-------------------------------------
MINE_ACIAC       DTVR--------------------------------------
MINE_VEREI       DSVR--------------------------------------
MINE_RHOFT       DSR---------------------------------------
MINE_ACISJ       EATAK-------------------------------------
MINE_METPP       EAARG-------------------------------------
MINE_POLNA       DK----------------------------------------
MINE_POLSJ       DAK---------------------------------------
MINE_BORBR       QN----------------------------------------
MINE_BORPA       QN----------------------------------------
MINE_BORPE       QN----------------------------------------
MINE_BORA1       QSETQASV----------------------------------
MINE_BURCA       QA----------------------------------------
MINE_BURCH       QA----------------------------------------
MINE_BURCM       QA----------------------------------------
MINE_BURL3       QA----------------------------------------
MINE_BURMA       QA----------------------------------------
MINE_BURTA       QA----------------------------------------
MINE_BURPS       QA----------------------------------------
MINE_BURP0       QA----------------------------------------
MINE_BURP1       QA----------------------------------------
MINE_PARXL       QA----------------------------------------
MINE_CUPNH       QN----------------------------------------
MINE_CUPPJ       QN----------------------------------------
MINE_CUPMC       QA----------------------------------------
MINE_RALSO       QA----------------------------------------
MINE_AZOSB       EH--GR------------------------------------
MINE_AROAE       EQNQGR------------------------------------
MINE_DECAR       EK--G-------------------------------------
MINE_THIDA       EMR---------------------------------------
MINE_HERAR       EDELVKP-----------------------------------
MINE_CHRVO       EHQR--------------------------------------
MINE_ALCBS       EG----------------------------------------
MINE_ALKEH       DQQDQAAAHDRG------------------------------
MINE_CHRSD       -RDE--------------------------------------
MINE_HALHL       EREEEGAQR---------------------------------
MINE_NITEU       DSQNTRNTQQDAVRNSF-------------------------
MINE_NITEC       DTQNPRNTQQDMIRNAL-------------------------
MINE_METCA       DAIESRPKRKRG------------------------------
MINE_XYLFA       DDSER-------------------------------------
MINE_XYLFT       DDSER-------------------------------------
MINE_XANAC       EDGDK-------------------------------------
MINE_XANOM       EDGDK-------------------------------------
MINE_XANC5       EDGDK-------------------------------------
MINE_XANOR       EDGDK-------------------------------------
MINE_XANCP       EDGDK-------------------------------------
MINE_XANC8       EDGDK-------------------------------------
MINE_PSEAE       DR----------------------------------------
MINE_PSEAB       DR----------------------------------------
MINE_PSEPK       DR----------------------------------------
MINE_PSEE4       ER----------------------------------------
MINE_PSESM       DR----------------------------------------
MINE_PSE14       DR----------------------------------------
MINE_PSEU2       DR----------------------------------------
MINE_PSEF5       DR----------------------------------------
MINE_PSEPF       DR----------------------------------------
MINE_PSEU5       DR----------------------------------------
MINE_SYNAS       DAEGRFSMS---------------------------------
MINE_HAHCH       E-----------------------------------------
MINE_MARHV       EK----------------------------------------
MINE_LEGPL       DKALEDSNS---------------------------------
MINE_LEGPA       DKALEDSNS---------------------------------
MINE_PSEA6       E-----------------------------------------
MINE_HYDCU       DK----------------------------------------
MINE_PSYIN       KNR---------------------------------------
MINE_FRATH       ------------------------------------------
MINE_FRATO       ------------------------------------------
MINE_FRATN       ------------------------------------------
MINE_FRATT       ------------------------------------------
MINE_FRAT1       ------------------------------------------
MINE_FRATW       ------------------------------------------
MINE_ACIBT       EER---------------------------------------
MINE_ACIAD       EER---------------------------------------
MINE_PSYA2       EHKK--------------------------------------
MINE_PSYCK       EHKK--------------------------------------
MINE_DEIRA       EEASLSTEEESAAEDKSDKPSA--------------------
MINE_DEIGD       DEGIENP-------GRRER-----------------------
MINE_SYNY3       RRVRRTK--------AKSEAQES-------------------
MINE_GUITH       RRILKDI-----------------------------------
MINE_NOSS1       RRVKPEL---------PIFDETSQ------------------
MINE_TRIV2       RRVKPEL---------PAFDETSQ------------------
MINE_TRIEI       RRIKAK----------PTQDQED-------------------
MINE_SYNP6       RRVKPA----------TAEG----------------------
MINE_SYNE7       RRVKPA----------TAEG----------------------
MINE_SYNJB       RRVKPL-E----TGLSRSEGEKA-------------------
MINE_SYNJA       RRVKPLAE----ARLNSCEGENPQQDPGAAPSEGGHLSSPSP
MINE_THEEB       KRLKLSPEDAPLPENFPPENEAKER-----------------
MINE_PROM1       KRTITGQIQLKEPKNQSELDSPETEGTDQKS-----------
MINE_PROMT       KRTMTGQIQLKEPKNQSEVDSPETEGKDQNS-----------
MINE_PROMA       KRTLSGEIKIKE---QSSADNSAKAVS---------------
MINE_PROM0       KRTIDGEIKFKKTDKTDKANKDIKK-----------------
MINE_PROM9       KRTISGEIKFKKNDKTDQADKDIKK-----------------
MINE_PROMS       KRTISGEIKFK---KADKANKDIKK-----------------
MINE_PROM5       KRTLTGEIEFK-----KNHDNPKKK-----------------
MINE_PROMP       KRTLTGEIEFK-----KNEDTQKKK-----------------
MINE_PROM3       KRSQAKAVSNQAKAVSNQEKAVSSQEKVSNSQESVSTPEAME
MINE_PROMM       KRS-------QAKAVSSQENGASSQEAVS-SQESVSTPGAME
MINE_SYNS3       RRP-----------ITSAPPKSD-------------------
MINE_SYNPX       RRT-----------L---------------------------
MINE_SYNPW       RRS-----------MASSKPGS--------------------
MINE_SYNSC       RRP-----------IAQTAKVEPSEQQPAQA-----------
MINE_SYNS9       RRS-----------IQQSPNGGTL------------------
MINE_GLOVI       RRIRPEHI----------------------------------
MINE_CARHZ       KNVKRSVRVQTN------------------------------
MINE_DESHY       IKMKRDYSVKG-------------------------------
MINE_MOOTA       LRVKRTFKSVQEPAFKV-------------------------
MINE_SYMTH       RRMKRAAVGSKR------------------------------
MINE2_SYNWW      RGFKRAANE---------------------------------
MINE1_SYNWW      KGR---------------------------------------
MINE_SYNFM       KRVYRKAAPDIRS-----------------------------
MINE_HUNT2       RSVKNSGK----------------------------------
MINE_CALS4       KKMKQVIR----------------------------------
MINE_CLOD6       KNIKDRCM----------------------------------
MINE_CLOPE       KNIKGKAR----------------------------------
MINE_CLOP1       KNIKGKAR----------------------------------
MINE_CLOPS       KNIKGKAR----------------------------------
MINE_CLONN       KKMKQR------------------------------------
MINE_FUSNN       KTTKQQKRK---------------------------------
MINE_HELPJ       -ILPK-------------------------------------
MINE_HELAH       -ILPK-------------------------------------
MINE_HELPY       -ILPR-------------------------------------
MINE_HELPH       -ILPK-------------------------------------
MINE_HELHP       -TLGN-------------------------------------
MINE_WOLSU       -VLGKNS-----------------------------------
MINE_CHLVU       KNIRIFLGMDSNNFFLTEELFN--------------------