CLUSTAL format seed alignment for MF_00267

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MINC_AGRFC      --MTKVLTDQRSIRIKGRSFLAVVLSP-ES----------PVDQWLERLDDLAA-RSAGF
MINC_RHIME      --MTKVLTDARSIRIKGRSFLALVLSP-EL----------PLDWWLGRLDDLAS-RSAGF
MINC_BRUME      --MNQVLTETRPIRLKGRSFLAMVLSP-EL----------PLDGWLERLDDLAR-RSSGF
MINC_ECOLI      -------MSNTPIELKGSSFTLSVVHLHEA----------EPKVIHQALEDKIA-QAPAF
MINC_ECO57      -------MSNTPIELKGSSFTLSVVHLHEA----------EPKVIHQALEDKIA-QAPAF
MINC_SALTY      -------MSNTPIELKGSSFTLSVVHLHEA----------EPEVIRQALEDKIA-QAPAF
MINC_YERPE      -------MSQSPIELKGSSFTLSVVHLHDS----------RPEVIRQALQEKVD-QAPAF
MINC_BUCAI      -------MQKKSIELKSNNFTLLVLYLNNQ----------NIDLINQSLYKKIQ-ECPKF
MINC_VIBCH      -------MSKNP-DLKGSSFTLSVLHLSDN----------QIAHTVQFLQEKIA-QAPAF
MINC_XANAC      -MASVNVDFEQAGELKIGQVGIANLRVRTL----------DVSRLVQEMRERVT-RAPKL
MINC_XANCP      -MSSVNVDFEQAGELKIGQVGIANLRIRTL----------DVPRLVREMQDRVT-RAPKL
MINC_XYLFA      -MSNVNMDFEQAGELKIGQVGIATLRIRTL----------NVPRLIQEMSDRVT-RAPKL
MINC_PSEAE      MSQADLLDQDPVFQLKGSMLAVTILELAHN----------DLARLERQLADKVA-QAPNF
MINC_NEIMA      ----MMVYIMNAFDIKSTKMDVLSISLHTS----------DLFDLEDVLVKLGK-KFQ-E
MINC_NEIMB      ----MMVYIMNAFDIKSTKMDVLSISLHTS----------DLFDLEDVLVKLGK-KFQ-E
MINC_BACHD      ----MTTQKKQAVTIKGTKDGLTFHLDDRC----------SFDSIVGELAEKLSSKHYQM
MINC_BACSU      ----MKTKKQQYVTIKGTKNGLTLHLDDAC----------SFDELLDGLQNMLSIEQYTD
MINC_LISIN      --------MKKNVQIKGTKSGISIFLSDKA----------SISELQQELSQLLADQKQNP
MINC_LISMO      --------MKKNVQIKGTKDGISIFLSDKA----------SISELQQELTQLLADQKQNP
MINC_CLOAB      -------MFRDGITIKGNKEGLNVIININSFK--------DFDEMLDAFIAKLS-KGKRF
MINC_CLOPE      -------MRDDRIFIKGNKLGINAIINMDKFG--------NFDEMLDSLVEKLS-RGKKF
MINC_CALS4      -------MVREPVKIQGTKEGLVIVVDEDV----------DIEVLKERIVDRIE-KSLKF
MINC_HELPY      -------------MLKTNQKNVHAFEIEKQ----------EPEAVIGFLEKNHA-----L
MINC_HELPJ      -------------MLKTNQKNVHAFEIEKQ----------EPEAVMEFLEKNHA-----L
MINC_RALSO      ----MSQKKAPLFEIRSGTVDALLLSPRTA----------DMDALAAELTRRFA-DTPEF
MINC_AQUAE      -----------MIEIKGKTLPVIQIKIKEK-G--------NIDKLLKELKEKLS---HNI
MINC_FUSNN      --------MSNHVIIKGKNDRLVIALDPNI----------DFLDICDILKTKIL-EAKDF
MINC_SYNY3      -MSDDTPHPEWQLVPQGNFVRLSLTLPTVTTAPDSPSLVFSHQQLEQSLGNYLRIMAGRW
MINC_THEMA      -----------MVDFKMTKEGLVLLIKDYQ----------NLEEVLNAISARITQMGGFF
MINC_PASMU      -------MAQDIVAFRTGQFSSIFLTLHSS----------SLSVIKRALSKKIK-SSPSI
                               :                                :           

MINC_AGRFC      FLSRPVVLDVSELS--LDKAGLKELLAALRERNVGIMGIEGVRPSMIEPGMPPSLKGGKP
MINC_RHIME      FLGRPVVLDVADLE--IDRKQLKSLLDELGQRNVRVMGIEGGRPSLFEPGMPPAMKGGRP
MINC_BRUME      FLGRPVVLDMENLA--IERAQLVYLLQALNDRGVWIMGVEGARPSLLGPGMPPAMRGGQP
MINC_ECOLI      LKHAPVVLNVSAL---EDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILT
MINC_ECO57      LKHAPVVLNVSAL---EDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILT
MINC_SALTY      LKHAPVVINVSGL---ESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLT
MINC_YERPE      LKNAPVVINVATL---PNGANWKDLQQAVTSAGLRIVGISGCQDERQKRAIARAGLPLLS
MINC_BUCAI      FKNAPIIVNVSKL---CNTVDWKKIKKIIISHGFFVVGVSGCQDGILKKNIIDSGLPILS
MINC_VIBCH      FANAPVVINVAKV---EGDIDYPALKQGISQAGLIPVGVTGCKDKRSQNLAVEAGFAVMT
MINC_XANAC      FGRAAVILDFGGLSQVPDLATAKALLEGLRDAGVLPVALAYGTSE-IDLLSQQLGVPLLA
MINC_XANCP      FGRAAVILDFGGLAQAPDLATAKALLDGLRSAGVLPVALAYGTSE-IDLLSQQLGIPLLA
MINC_XYLFA      FRRTAVILDFGELPHTPDLTTAKALVEGLRAANVLPVAIAYGTNE-IDLLSQQLGLPLLS
MINC_PSEAE      FRDTPLVMALDKLPEGEGRLDLPALLEVCRRHGLRTLAIRAGREE-DIAAAQALDLPVLP
MINC_NEIMA      SGVVPFVLDVQEFDY-PESLDLAALVSLFSRHGMQILGLKHSNERWAAAAMKYHLLFCLS
MINC_NEIMB      SGVVPFVLDVQEFDY-PESLDLAALVSLFSRHGMQILGLKHSNERWAAAAMKYHLLFCLS
MINC_BACHD      EDQPRIQVKVDVGYRYLTVEQKRHIQELITDGRNLDVEEFVSQVMT-----KEEAEEKRK
MINC_BACSU      GKGQKISVHVKLGNRFLYKEQEEQLTELIASKKDLFVHSIDSEVIT-----KKEAQQIRE
MINC_LISIN      YSGEKLEVQVQIGNRLFSEEEEREISTIIHNNSQMKISAFYSNVMS-----KDEAKKWKE
MINC_LISMO      YSGEKLEVQVQIGNRLFSEEEELEISTIIHENSQMEISAFYSNVMS-----KDEAKKWKE
MINC_CLOAB      YKGCTLRITTQL--KEINERNTRKLKDILFDEFLIKDCIFEDSDEN-----KSKVFSGIY
MINC_CLOPE      YKGATLTVTTDL--KYINERQISKLKDVLFDEILIKDCIFEERLEK-----QSSVFSGVY
MINC_CALS4      FEGATLNVRVKN--SKFKDEELEDLKDFILKNYGVEIFIKKFQEKHIKNVTDDEIFNGLE
MINC_HELPY      LQYFLIIFKYDIESEVKAVLRKHQLLFLETNRVLNGRHIKTMPL-------KDETDHPKP
MINC_HELPJ      LQYFLIIFKYDIESEVKAVLHKHQLLFLETNRALNGRYIKTTE--------KDANLLKQN
MINC_RALSO      FSNDVIAIDVRRLAA-DERLPIDRLVETLTGLRARAIGVVASPEQ--AEWAQACGLPLLD
MINC_AQUAE      FKGSLIILENPE---VLKPEERKKVEEILKEFSRGFIEG------------KKEGKEKRE
MINC_FUSNN      IGNSRMAIEFSG--RALTNEEENKLIGIITDNSDIVVSYIFSKRAE--S--EEENIDLNS
MINC_SYNY3      QDQTLVRLAVNN--QLLDARQLQAIAAGLKEQNLTLQWVETNRRQTAVAAASAGLSVDQT
MINC_THEMA      AKGDRISLMIEN--HNKHSQDIPRIVSHLRNLGLEVSQILVGSTVE----GKENDLKVQS
MINC_PASMU      FQHIAVILQFTPE---LEKVNLQALKSLCEEFNIHIIGVSDWTNHLQKELIMTSGLALLG
                     . .                :                                   

MINC_AGRFC      ASDVEVEPVAVAAELPEDK--------------PHASGEVRA----V--VQSLVINEPVR
MINC_RHIME      APDFEVPEVDPADPPKAGKGKAAA---------PITPEEVQP----VRATASIIVREPVR
MINC_BRUME      AADFEAPAGEPQANPGAPE--------------PQISQAVRAPGHAVHAMPSMVITEPVR
MINC_ECOLI      EGKEKAPRPAP----TPQA--------------PAQNTTP--------VTKTRLIDTPVR
MINC_ECO57      EGKEKAPRPAP----APQA--------------PAQNTTP--------VTKTRLIDTPVR
MINC_SALTY      EGKEKAVRPAPVEPATPSE--------------PPQNANP--------ITKTRLIDVPVR
MINC_YERPE      EGKGQKLAPEP-----VIS--------------PPENVP----------TQTRIINTPVR
MINC_BUCAI      ERKNNKSNIITNFFINSYKNK------------KKETINK--------VEKTHIIDIPVR
MINC_VIBCH      ATNSPAQAPAQ-------------------------------------MAPTKVIRTPVR
MINC_XANAC      KFRAQYEPTAVSPPPPPPPP-------------PARAEPAPP---AARPAPGRMQRTAVR
MINC_XANCP      KFRAQYETAAVSPPPPPPPP-------------PARAEPAAP---VARPAPGRMQRNAVR
MINC_XYLFA      KFRAHYERQEVAAPPPQSTP-------------PINT--------------GRIQHTTVR
MINC_PSEAE      PSGARERPLDIKDSAPRKPAEEPSPSAGEARPEPAKAEEKPA---EPVSRPTKVVKTPVR
MINC_NEIMA      HSENVKELGQVEVQNTEDGQ---------------------------KARKTVLITSPVR
MINC_NEIMB      HSENVKELGQVEVQKTEDGQ---------------------------KARKTVLITSPVR
MINC_BACHD      EA------------------------------------------------QIVSVAKVIR
MINC_BACSU      EA------------------------------------------------EIISVSKIVR
MINC_LISIN      ND------------------------------------------------QIFSMATIIR
MINC_LISMO      ND------------------------------------------------QIFSMATIIR
MINC_CLOAB      EG------------------------------------------------RTKFLRRTVR
MINC_CLOPE      EG------------------------------------------------RTKFVRKTVR
MINC_CALS4      EG------------------------------------------------ITKFHRGTVR
MINC_HELPY      NHSKTEP-------------------------------------------KTTIYERHIR
MINC_HELPJ      SPNAIEP-------------------------------------------KTTIYERNIR
MINC_RALSO      SHGRRPRGERSEEAAEAVPAAAEPVP-------APAASPAPPVEAVAMQPGAMIIEKPLR
MINC_AQUAE      ES------------------------------------------------RLLIIERTLR
MINC_FUSNN      LNPLIEEG------------------------------------------KTHFFRGTLR
MINC_SYNY3      MADKPLVDPSE----------------------------------TPSLPKPLVVRHTLR
MINC_THEMA      RTTVES--------------------------------------------TGKVIKRNIR
MINC_PASMU      KSGEFTEILPE----P--R-----------------------------CLPVKIIHQHVA
                                                                          : 

MINC_AGRFC      SGQSIMFPEGDVTVIGSVASGAEIIAGGSVHIYGALRGRAMAGSLGNVSARIFCRKLEAE
MINC_RHIME      SGQSVIFPEGDVTVVGSVASGAEIVAGGSVHIYGTLRGRALAGSVGNASARIFCRRLEAE
MINC_BRUME      SGQSVYFPEGDVTIVGSVASGAEVVAGGSIHIYGTLRGRALAGTAGNTSARIFCRKLEAE
MINC_ECOLI      SGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAE
MINC_ECO57      SGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAE
MINC_SALTY      SGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDREAQIFCTHLTAE
MINC_YERPE      SGQQIYARNCDLIVISSVSAGAELIADGNIHIYGMMRGRALAGASGDAKCQIFCTHLGAE
MINC_BUCAI      SGQKIYAKHADLIVINNVSAGAELVADGNIHVYGIVRGRVLAGANGDTSRKIFCTGLFAE
MINC_VIBCH      SGQQIYAKDGDLVILSHVSAGAEVIADGSIHIYGTLRGRAIAGASGQREARIICHDLQAE
MINC_XANAC      SGQQLYAENCDLTVLSTVGAGAEVIADGSIHIYGTLRGRALAGAQGNPDARIFCRDFHAE
MINC_XANCP      SGQQLYAENCDLTVLSTVGAGAEVIADGSIHIYGTLRGRALAGAQGNPDARIFCRDFHAE
MINC_XYLFA      SGQQLYAEHCDLTILNTVGAGAEVIADGNIHIYGTLRGRAMAGARGNAEMRIFCRDFQAE
MINC_PSEAE      GGMQIYAAGGDLIVLAAVSPGAELLADGNIHVYGPMRGRALAGVKGDATARIFCQQLAAE
MINC_NEIMA      TGQQVYAEDGDLIVTGAVSQGAELIADGNIHIYAPMRGRALAGAKGDTSARIFIHSMQAE
MINC_NEIMB      TGQQVYAEDGDLIVTGAVSQGAELIADGNIHIYAPMRGRALAGAKGDTSARIFIHSMQAE
MINC_BACHD      SGQ-VFSVDGDLLLIGDVNPGGTIRASGNIFVIGSLRGIAHAGYKGNGEAVIATSHMAPA
MINC_BACSU      SGQ-VLQVKGDLLLIGDVNPGGTVRAGGNIFVLGSLKGIAHAGFNGNNQAVIAASEMLPT
MINC_LISIN      SGQ-VVQVPGDFLLIGDVNPGGQIRSNGNVFVLGNIKGIIHAGFEGDENAVVAGKFLYPS
MINC_LISMO      SGQ-VVQVPGDFLLIGDVNPGGQIRSNGNVFVLGNIKGIIHAGFEGNENAVVAGKFLYPS
MINC_CLOAB      SGQ-IIKYSGNVVIVGDVNPGSEIYAGGNVIVFGILRGDVHAGSTGNDKAIIAALRLQPK
MINC_CLOPE      SGQ-CLNYAGNLIIIGDVNNGGEVRAHGNVIVLGDLKGKVFAGDNGNENAIIAAYSLEPE
MINC_CALS4      SGQ-VVKYYGNLVIIGDVNPGGLVQAAGNIVVTGTLRGIAHAGFTGNKEAFIVASSLKAM
MINC_HELPY      SGEEIYSTN-HLIFLGNIHNGAKIISEGCVSVYGVCEGAIVC-----FGECLILKEVKSA
MINC_HELPJ      SGEEIYSTN-HLIFLGNIHNGAKIISEGSVSVYGVCEGAIVC-----FGEYLILKEVKSA
MINC_RALSO      SGQRVYARG-DLVVLDLVSDGAEVIAEGNIYVYASLRGRALAGVKGNLDARIFCTCLEPQ
MINC_AQUAE      AGQ-RIEHRGDILILGDVNKDAEVLAGGNIIVMGKLRGVAKAGLIGDHSAVIVALKMEPQ
MINC_FUSNN      SGS-KIESDGNVVVLGDVNPSSMIRARGNVIVLGHLNGTVCAGLGGDDRAFIAAIYFNPI
MINC_SYNY3      SGG-EIRHGGDVVIIGDVNPGSSIVADGDILIWGCLRGMAHAGAKGNDQAVIMILRLAAC
MINC_THEMA      SGQ-TVVHSGDVIVFGNVNKGAEILAGGSVVVFGKAQGNIRAGLNEGGQAVVAALDLQTS
MINC_PASMU      SKQVIYAKNSDLIIHGNVEPGAEVAADGNVHIYGKLLGRAMAGVN-NNVGSIYTQYLDAE
                          .. .   :  .. : : * : : .   *   .         :    . . 

MINC_AGRFC      LLAIDGVYKVAEDID-DKLRG-----QPVQLWLENDTIKAAKLG----------------
MINC_RHIME      LLAIDGVYKTAEDMA-PNLRG-----QSVQLWLEGDSIMAERLN----------------
MINC_BRUME      LVAIDGLYKTAEDLE-PRFRG-----QAVQLWLDGDYMMIDTLS----------------
MINC_ECOLI      LVSIAGEYWLSDQIP-AEFYG-----KAARLQLVENALTVQPLN----------------
MINC_ECO57      LVSIAGEYWLSDQIP-AEFYG-----KAARLQLVENALTVQPLN----------------
MINC_SALTY      LVSIAGVYWLSDKIP-AEFYG-----KAARLRLADNALTVQPLN----------------
MINC_YERPE      LVSIAGQYWLSDQIP-LEYFG-----QAARLYLQDNTLTIQPLN----------------
MINC_BUCAI      LVSISGEYWLSDQIP-SEFIG-----KSAQIYLKNKFLTINSLS----------------
MINC_VIBCH      LISIAGRYWLSDQIE-SQFWQ-----QRVMLSMTDESLYLETLTI---------------
MINC_XANAC      LVAIAGHYKVLDDVP-MDLRG-----KAVQVWLEQDQIKIAALD----------------
MINC_XANCP      LVAIAGHYKVLDDVP-MDLRG-----KAVQVWLEQDQIKIAALD----------------
MINC_XYLFA      LIAIAGRYKVLDDIP-TELRG-----KAVQVWLEQNQIKIAALD----------------
MINC_PSEAE      LVSIAGNYKVAEDLRRSPQWG-----KAVHVSLSGDVLNITRL-----------------
MINC_NEIMA      LVSVAGIYRNFEQDLPNHLHK-----QPVQILLQDNRLVISAIGSE--------------
MINC_NEIMB      LVSVAGIYRNFEQDLPNHLHK-----QPVQILLQDNRLVISAIGSE--------------
MINC_BACHD      QLRIGEQIFHWSKEEQQAGDRI---MECAYIASDTNEIQLDRVQKLLKIRPNLATFLDEM
MINC_BACSU      QLRI-NHVLNRSPDHIQKGNE----MECAYLDTDGNMV-IERLQHLAHLRPDLTRLEGGM
MINC_LISIN      QVRIAGKVYGFDSEDYKEVADT---DLFSAFVNDAGEIVIDEIHKIRKIRPEISNFQGGR
MINC_LISMO      QVRIADKVYGFDSEDYKEVTET---DLFSAFVNDAGEIVIDGIHKIRKIRPEISNFQGGR
MINC_CLOAB      ILQIANRISRAPEDDDKPDYP-------EVARLKGDAIIVEPYSPNKFNI----------
MINC_CLOPE      LISISGKITISPDDFEKTGYP-------EVARLNENNIIVEPYLPDKYSY----------
MINC_CALS4      QLRIANIISRAPDKEEEVEYP-------EIAVVRKNKIIVRPLYHLSDLW----------
MINC_HELPY      QIVFQNKILSLKEVEPLLVNK-----NIKIITKNDDILDIKEVL----------------
MINC_HELPJ      QIVFQNKILSLKEVERLLVNK-----NIKIITKNDDILDIKEVL----------------
MINC_RALSO      LISIAGIYRTGETPWPEAFAS-----KPAQIRLSENTLVLEPLRMK--------------
MINC_AQUAE      LLQIGKKKAIMSEAD-RNSPG-----YPEVAKIEGEDIVLEPIEGAERWLKLLL------
MINC_FUSNN      QITIGMKTITDIQDEILDSTRVDKKSKFKVASIKNQEIVVEELI----------------
MINC_SYNY3      QIRIGDRLARVGADAVDRREP-------EIAYITSEGIRLTPVRQFQRSALL--------
MINC_THEMA      LIQIAGFITHSKGEE-----N-----VPSIAHVKGNRIVIEPFDKVSFERSE--------
MINC_PASMU      FIAVSSRFLYKDNLPHEYQHE------AVRIFADKDKLRFHFLLEKET------------
                 : .                                 :                      

MINC_AGRFC      ---
MINC_RHIME      ---
MINC_BRUME      ---
MINC_ECOLI      ---
MINC_ECO57      ---
MINC_SALTY      ---
MINC_YERPE      ---
MINC_BUCAI      ---
MINC_VIBCH      ---
MINC_XANAC      ---
MINC_XANCP      ---
MINC_XYLFA      ---
MINC_PSEAE      ---
MINC_NEIMA      ---
MINC_NEIMB      ---
MINC_BACHD      VEQ
MINC_BACSU      ---
MINC_LISIN      ---
MINC_LISMO      ---
MINC_CLOAB      ---
MINC_CLOPE      ---
MINC_CALS4      ---
MINC_HELPY      ---
MINC_HELPJ      ---
MINC_RALSO      ---
MINC_AQUAE      ---
MINC_FUSNN      ---
MINC_SYNY3      ---
MINC_THEMA      ---
MINC_PASMU      ---