CLUSTAL format seed alignment for MF_00268

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RECA_MESFL      --------MSSK-----------NEIWKNEALISALKTIEKNYGKEALVVYNEG-DDIDH
RECA_MYCMS      --------MSTEIQKIEDNNLKESQMWNSKELKEAIKEIEKMFGKGSIMVLGQS-DNLNV
RECA_MYCH2      --------MTEINE--------------KSLLKQALAEIKKKFGNESIMVLGEK-PPIDT
RECA_MYCMO      -------------M--------------EKEIKNILMEIEKKFGKESIMLLGSK-QDLNV
RECA_MYCPU      --------MSENNQS-------NQNNQINKIIKSTIEEIEKKFGNESIMLLGQK-EKCDV
RECA_AQUAE      --------------------MSENLSEKKKALEVALSNIEKRFGKGAVMPLKSVEKVQ-V
RECA_THEMA      --------------------MPEEK-QKKSVLEKALKRIEENFGKGSIMILGDETQVQPV
RECA_THET8      ----------------------MDESKR-KALENALKAIEKEFGKGAVMRLGEM-PKQQV
RECA_DEIRA      ----------MSKDATKEISAPTDAKERSKAIETAMSQIEKAFGKGSIMKLGAE-SKLDV
RECA_ECOLI      ---------------------MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDR-SMDV
RECA_CHRVO      ---------------------MAS-EDKSKALAAALAQIEKQFGKGSIMRMSDNQITENL
RECA_FRATT      -------------------------MSKEKALESALSQIEKQFGKGAIMRLGDQEAAHDI
RECA_LEPIN      --------MGESIMKKAKEDAPSVDDSKKLAIEQAMSQIEKQFGKGSIMKLGSDSAKQTV
RECA_TREDE      --------MAKA---KNEVPAVANPDDKLKALEAARLQIEKQFGQGSLMKLGNNSAIGNI
RECA_TREPA      --------MSKAL--KGDVPVSSSFEEKMKALEAARLQIEKQFGQGSLMKLGKDDAVQGV
RECA_BORGP      --------MSKLKEKRGKIVVSMERVKKEEAIELARVQIEKTFGKGSLIKIGESSVGKGI
RECA_CHLPN      ----------------------MNLPDRKKALEAAVAYIEKQFGAGSIMSLGRHSATHEI
RECA_CAUVC      -----------MTSQAALKLVAKEEGDKQRALEAALAQIDRAFGKGSVMKLGEK-GKVEI
RECA_RICTY      ----------------------MSNTDKERAIAAALAQIEKSYGKGSVMKLGQR-PNIDI
RECA_GLUOX      -------------------------MDKTKALEGALSQIERAFGKGSIMRMGQR-PKVET
RECA_DESPS      -------------------MVGATAKDKAGSVENAISQIQKQFGKGSIMRLGEQ-ALEAI
RECA_WOLTR      ----------------MASNPEEKSNDRQKALDNAISQIEKAFGKGAIMKLKQN-PVEKI
RECA_WOLSU      ----------------MALD-----ENKRKAIDLAIKQIDKAFGKGALVRLGEK-PVEKI
RECA_STAHJ      -----------------------MDNDRQKALDTVIKNMEKSFGKGAVMKLGDN-KGRRV
RECA_LACLA      --------MATKKKTNFDDITKKYGAERDKALADALALIEKDFGKGSLMRLGEA-ANQKV
RECA_CLOTE      -----------------------MDKEKLKAIEAAMGNIEKQFGKGSVMKLGEK-NILDI
RECA_GEOSL      MTQ-----------------------EREKAIELALSQIEKQFGKGAIMRLGADEALPDV
RECA_RHOBA      MVKKPRMATPAASKGVKLDPGMKTILEKEPGLKTTLQQIEKSFGDGAIMPLGASQKLT-I
RECA_SYNY3      -------------------MASTNISDREKALNAALAQIERSFGKGAIMRLGDA-TQMRV
RECA_GLOVI      MARTT-----DDSKKAAPAAGTADEAQKQKALKMVLTQIKRNFGEGAIMRLGEN-TRIRV
RECA_TROW8      MSSND-----QIN--------------RTRALELALANIDRQYGKGAVMRMNDA-QKAYI
RECA_DESVH      MAKKP-----SLSPEEM----------RREALETALSTIERKYGLGAVMKLSDE-AHVAI
RECA_CORJK      ----M-----PPKKKQTAAAGKD----RSKALELAMAQIEKDFGKGAIMRLGDD-TRPPI
RECA_BIFLO      MALET-----KPAKDPAAEDKHELDPKRKAALDTALAQVEKSFGKGSAMRLGDQ-PEQNV
RECA_PORGI      MAEEK-----IPTVQ----DEKK-----LQALRMATEKIEKTFGKGAIMNMGAN-TVEDV
RECA_CHLTE      MEKEA-----TPQQQPPVVDPAR-----LKQLNLAIETLEKQFGKGAIMRLGDDSAVMHV
RECA_FUSNN      --------MAAKKDKSVPDSKITDKEGKEKAVKDAMAAITKGFGSGLIMKLGEK-SSMNV
RECA_LACLL      --------MEQPQYNSYKVRKLDDPEEKKLAILKATQSIEKKFGSNTILNEEGK-ASQHV
RECA_MYCGE      --------------------MAQKEIINKKNTQ-KNSSFIESNNLTSFDFFDAK-KNSEI
RECA_MYCPN      --------------------MVQKEMINKKISQ-DNS-FIQNNNLADFDFLDAK-KNSEI
RECA_UREPA      ----------------------MKENNNLEKLD-PIATLETKFAKSSYFIADEI-KDEKI
RECA_MYCPE      ----------------------MNSMTEQKALELAIKEIEKKFGKETFSQSESF-DNQVI
                                                      .                     

RECA_MESFL      DVISSGSFLIDQAIGIGGYPKGRVVEIFGPESSGKTTLALHAIAEAQKQGEIAAFIDAEH
RECA_MYCMS      ETFSSGSLLLDNALGIGGYPKGRIIEIYGPESSGKTTLSLHAICEIQKLGGIAAFIDAEH
RECA_MYCH2      EVFSSGSMAIDMALGIGGFPKGRIIEIYGPESSGKTTISLHAIAEVQKQGGIAAFIDAEH
RECA_MYCMO      EIFSTGSLAIDHALGINGFPKGRIIEIYGPESSGKTTIALHAIAEIQKSGGVAAFIDAEH
RECA_MYCPU      DVFSSGSYAINSALGIGGFPKGRIIEIFGPESSGKTTIALHTIAEIQKKNGFAAFIDVEH
RECA_AQUAE      ETIPTGSLALDIATGVGGIPKGRITEIFGVESSGKTTLALHVIAEAQKRGGVAVFIDAEH
RECA_THEMA      EVIPTGSLAIDIATGVGGYPRGRIVEIFGQESSGKTTLALHAIAEAQKMGGVAAFIDAEH
RECA_THET8      DVIPTGSLALDLALGIGGIPRGRIVEIYGPESGGKTTLALTIIAQAQRRGGVAAFVDAEH
RECA_DEIRA      QVVSTGSLSLDLALGVGGIPRGRITEIYGPESGGKTTLALAIVAQAQKAGGTCAFIDAEH
RECA_ECOLI      ETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH
RECA_CHRVO      QVISTGSLTLDLALGVGGLPRGRVVEIYGPESSGKTTLCLQAVAEAQKLGGTCAYIDAEN
RECA_FRATT      DVIPSGIIALDVALGIGGYPKGRIIEIYGHESSGKTTLTLLAIAQCQKQGGTAAFVDAEH
RECA_LEPIN      QVIPSGSLDLDIALGIGGYPIGRIVEIYGPESSGKTTLTLSAIAEAQKRGGVAAFIDAEH
RECA_TREDE      EIIPSGSILLDEALGIGGYPRGRIIEIFGPESSGKTTIALHAVAEAQKQGGIAAFIDAEH
RECA_TREPA      EVIPTGNILLDEALGIGGYPRGRIIEIFGPESSGKTTLALHAVAEAQKRGGIAAFIDAEH
RECA_BORGP      KSISSGSIVLDEALGIGGYPRGRIIEIFGPESSGKTTLTLQAIAEVQKEGGIAAFIDAEH
RECA_CHLPN      STIKTGALSLDLALGIHGVPKGRVIEIFGPESSGKTTLATHIVANAQKMGGVAAYIDAEH
RECA_CAUVC      ESVSTGSLGLDIALGIGGLPKGRIVEVYGPESSGKTTLALHVVAEVQKAGGTAAFVDAEH
RECA_RICTY      EAISTGSLGLDIALGIGGVPKGRIIEIFGPESSGKTTLTLHLIAESQKNGGTCAFIDAEH
RECA_GLUOX      NVISTGSIGLDIALGIGGMPRGRIVEIYGPESSGKTTLALHVLAEAQKKGGTVAFIDAEH
RECA_DESPS      PVISTGALSLDIALGVGGLPKGRMTEIYGPESSGKTTLALHVVAEAQKLGGIAAFIDAEH
RECA_WOLTR      DTISTGSIALDSALGVGGLPKGRIVEIFGPESSGKTTLALHVIAEAQKKGGLCAFIDAEH
RECA_WOLSU      DSISTGSLGLDIALGIGGIPQGRIIEIYGPESSGKTTLALQVIAECQKKGGICAFIDAEH
RECA_STAHJ      SSVSSGSVTLDNALGVGGYPKGRIIEIYGPESSGKTTVALHAIAEVQKNGGVAAFIDAEH
RECA_LACLA      SVVSSGSLALDIALGAGGYPKGRIVEIYGPESSGKTTVALHAVAAVQKEGGIAAFIDAEN
RECA_CLOTE      EAISTGCLGMDIALGIGGVPKGRIVEIYGPESSGKTTVALHIIAEAQKNGGVAAFIDAEH
RECA_GEOSL      AAIPTGSLSLDLALGVGGVPRGRIIEIYGPESSGKTTLALHIAAEAQKMGGIAAFVDAEH
RECA_RHOBA      DCISTGSLSLDMALGGKGIPRGRIIEVFGPESSGKTTLALHIGAEAQKSGGIAAIIDAEH
RECA_SYNY3      ETISTGALTLDLALG-GGLPKGRIVEIYGPESSGKTTLALHAVAATQQAGGVAAFVDAEH
RECA_GLOVI      ETVPSGAITLDLALG-GGLPRGRVIEIYGPESSGKTTLALHAIAEIQKTGGVAAFVDAEH
RECA_TROW8      DVIPTGSIALDYALGVGGLPRGRIVEIYGPESSGKTTLTLHAIASVQRAGGIAAFIDAEH
RECA_DESVH      PVIPTGSIGLDLALGVGGVPRGRVTEIYGPESSGKTTLTLHIIAEAQKRGGTAAFIDAEH
RECA_CORJK      QAISSGNIAINAALGIGGFPRGRVVEIYGPESSGKTTVALHAIAEAQRAGGIAAFVDAEH
RECA_BIFLO      EVIPTGSLALDMALGIGGLPKGRIVEIYGPESSGKTTLALHVVANAQKKGGVAAYIDAEH
RECA_PORGI      SVIPSGSIGLDLALGVGGYPRGRIIEIYGPESSGKTTLAIHAIAEAQKAGGLAAIIDAEH
RECA_CHLTE      QVISTGSMALDYALGVGGLPRGRVTEIYGPESSGKTTLALHAIAEAQKNGGIAALVDAEH
RECA_FUSNN      ESIPTGSINLDIALGIGGVPKGRIIEIYGAESSGKTTLALHVIAEAQKQGGTVAFIDAEH
RECA_LACLL      QALPSGILSLDCAIGIGGYPKGRLIELFGAESSGKTTVALQAVAETQKNGGYVAYIDAEN
RECA_MYCGE      ETISTGSLNLDEALGSGGLPLGRIVELYGNESSGKTTIALNAVASFQKAGKTACYIDAEG
RECA_MYCPN      KTVSTGSLHLDEALGTGGLPLGRIVELYGNESSGKTTVALHAVASFQKAGKVACYIDAEG
RECA_UREPA      NAISTGSIHIDQITGINGIPVGKITEIYGNESSGKTTIALQTIAECQKTGGTVVLLDLEG
RECA_MYCPE      K---SGSILLDNAIGVGGYPKGKIIEIYGNESSGKTTIALQCVKECIKEGGSVAYIDAEC
                    :*   ::   *  * * *:: *::* **.****:         : .     :* * 

RECA_MESFL      SLDLNYAKKIGVDINSLLVSQPSYGEEALDILETLVKSNSISLIVVDSVAALVPKTELEG
RECA_MYCMS      SLDPKYCHNLGIDTNKLLVSQPDNGEQALDILEMLINSNSIDLIIVDSVAALVPKTELEG
RECA_MYCH2      SIDPQYAKNLGIDIDNLILSQPDSGEQALDIVDTLTKTKAIDLIVVDSVAALVPMAELQG
RECA_MYCMO      SIDPNYAKNLGVNIDNLILSQPDSGEQALEIVDILAKSSSIDLIVVDSVAALVPEVELNG
RECA_MYCPU      SIDPVYAKNLGIDIDNLLISQPDSGEQALEIVDILAKSGSIDLIVVDSVAALVPEAELNG
RECA_AQUAE      ALDPKYAKKLGVDVENLYISQPDYGEQALEIAESLINSGAVDVIVVDSVAALVPKDELEG
RECA_THEMA      ALDPVYAKNLGVDLKSLLISQPDHGEQALEIVDELVRSGVVDLIVVDSVAALVPRAEIEG
RECA_THET8      ALDPLYAQRLGVQVEDLLVSQPDTGEQALEIVELLARSGAVDVIVVDSVAALVPRAEIEG
RECA_DEIRA      ALDPVYARALGVNTDELLVSQPDNGEQALEIMELLVRSGAIDVVVVDSVAALTPRAEIEG
RECA_ECOLI      ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEG
RECA_CHRVO      ALDPVYAQKLGVNVEDLLISQPDTGEQALEICDMLVRSSGVDVIVVDSVAALVPKAEIEG
RECA_FRATT      ALDPKYAKLLGVDVDNLIVSQPDTGEQALEIADMLVRSGGVDIVVIDSVAALTPKAEIEG
RECA_LEPIN      ALDPSYAKKLGVNIDELLVSQPDNGEEALEICESLVRSNAIDLIVIDSVAALVPKAEIEG
RECA_TREDE      ALDPQYAKALGVNIDELWVSQPDTGEQALEIAESLVRSGAVDVIVIDSVAALTPQAEIAG
RECA_TREPA      ALDPQYAKDLGVSVGDLWISQPDTGEQALEIAESLVRSGAVDIIVVDSVAALTPQAEIQG
RECA_BORGP      ALNPVYAKALGVNVSELWLSQPDTGEQALEIAEHLIRSGGIDLIVVDSVAALTPKLEIDG
RECA_CHLPN      ALDPSYASLIGVNIDDLMISQPDCGEDALSIAELLARSGAVDVIVIDSVAALVPKSELEG
RECA_CAUVC      ALDPSYAYKLGVNLDNLLVSQPDNGEQALEITDTLVRSGAVDIVVVDSVAALTPKAEIEG
RECA_RICTY      ALDPAYAKKLGVNIDELIISQPDTGEQALEIADTLIRSGGIDMIIIDSVAALVPKSEIEG
RECA_GLUOX      ALDPGYARKLGVNIDDLLLSQPDAGEQALEIADTLVRSGAVDVLVVDSVAALVPRAELEG
RECA_DESPS      ALDTAYAEKLGVNIDNLLVSQPDFGEQALEIAEILIRSGGVDIIVVDSVAALTPKAEIDG
RECA_WOLTR      ALDVMYARKLGVNTDNLVISQPDTGEQALHIVEYLVCSSAVDVIVVDSVAALTPRAEIEG
RECA_WOLSU      ALDVSYAKRLGVDAENLLVSQPDYGEQALEILETLTRSGAVDLIVVDSVAALTPKSEIDG
RECA_STAHJ      ALDPVYAEALGVDIDNLYLSQPDHGEQGLEIAEAFVRSGAVDIVVVDSVAALTPKAEIEG
RECA_LACLA      ALDPEYAKALGVNIDELLLSQPDYGEQGLQIAEKLITSGAVDLVVIDSVAALVPKAEIDG
RECA_CLOTE      ALDPSYARKLGVDIDNLIVSQPDTGEQGLEIAEALVRSNAIDIVVVDSVAALVPKAEIQG
RECA_GEOSL      ALDIGYARKLGVKTDDLLVSQPDTGEQALEIAEMLVRSGAVDVLVIDSVAALVPKAEIEG
RECA_RHOBA      AFDPSWAKKLGVELDSLLVSQPSSGEEAMQICEMLVKSNAVDVIIIDSVAALVPKAELEG
RECA_SYNY3      ALDPVYSKALGVDIDNLLVAQPDNGESALEIVDQLVRSTAVDIIVVDSVAALVPRAEIEG
RECA_GLOVI      ALDPAYAKVLGVNVDDLIISQPDTGEMAMEIVDQLVRSAAIDVIVIDSVAALVPRAEIEG
RECA_TROW8      ALDPEYAKKLGVDIDALLVSQPDSGEQALEISDMLIRSTAIDLIVIDSVAALVPRAELEG
RECA_DESVH      ALDVAYARRLGVNTEELLISQPDFGEQALDIADMLVRSAAVDLVVIDSVAALIPQAELEG
RECA_CORJK      ALDPEYARALGVDTDALLVSQPDTGEQALEIADMLIRSGAIDIIVVDSVAALTPKAEIDG
RECA_BIFLO      ALDPAYARKLGVDTDSLIVSQPDNGEQALEIADMLIRSGALDVIVIDSVAALVPKAEIEG
RECA_PORGI      AFDRTYAEKLGVNVDNLWIAQPDNGEQALEIAEQLIRSSAVDIIVIDSVAALTPKAEIEG
RECA_CHLTE      AFDPTYARKLGVDINALLVSQPESGEQALSIVETLVRSGAVDIIVIDSVAALVPQAELEG
RECA_FUSNN      ALDPVYAKALGVDIDELLISQPDYGEQALEIADTLVRSGAIDLIVIDSVAALVPKAEIDG
RECA_LACLL      SLDIEYAENLGVKSDSLIFAQPDTGEEAFYMINEFVRTGAFDLIVVDSVAALTPASEIDG
RECA_MYCGE      ALDLAYAKSIGIDLNKLLIAHPRHGENAFALIESLIKTNKISLIVIDSVAALIPKQELEG
RECA_MYCPN      ALDLSYAKAIGIDLGKLLVAHPKHGENAFALMESLIKTNKVALIVVDSVAALIPKQELEG
RECA_UREPA      SFDINYAKSLKVDLTKLIITQPQTGEQAFDMIETLIKTNSIDLIVIDSVAAMLPESEYQA
RECA_MYCPE      SIDSKYLSHLGIDPTKLLVATPEYGEQAFSIIDALIKTNMVDLIVVDSVAALVPKNDIES
                :::  :   : :.   *  : *  ** .: : : :  :  . ::::*****: *  :  .

RECA_MESFL      EMSDQSIGLQARMMSKALRKLNGVISKSKTTVIFINQLREKIGIM-FGNPETTTGGRALK
RECA_MYCMS      EMSDQSIGLQARMMSKALRKLNGLIAKSNTTVIFINQLREKIGVI-FGNPETTTGGKALK
RECA_MYCH2      EMKDQVIGAQARLMSKALRKITASLNKNGTTVIFINQIREKVGVI-FGNPETTPGGRGLK
RECA_MYCMO      EMKDQVMGAQARLMSKALRKITGSLNKSKTTVIFINQIREKIGTF-FGNPETTPGGRALK
RECA_MYCPU      EMKDQSIGLQARLMSKALRKITGSLSKNKTSVIFINQVREKIGVV-FGNPETTPGGRALK
RECA_AQUAE      EMGEAQVGKQARLMSQALRKLKGAVHKSNTALIFINQIREKIGVM-FGNPETTPGGRALK
RECA_THEMA      AMGDMQVGLQARLMSQALRKIAGSVNKSKAVVIFTNQIRMKIGVM-FGSPETTTGGLALK
RECA_THET8      EMGDQHVGLQARLMSQALRKLTAVLAKSNTAAIFINQVREKVGVT-YGNPETTPGGRALK
RECA_DEIRA      DMGDSLPGLQARLMSQALRKLTAILSKTGTAAIFINQVREKIGVM-YGNPETTTGGRALK
RECA_ECOLI      EIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVM-FGNPETTTGGNALK
RECA_CHRVO      EMGDSHVGLQARLMSQALRKLTGNIKRTNTLVIFINQIRMKIGVM-FGNPETTTGGNALK
RECA_FRATT      DMGDSHMGLQARLMSQALRKLTANIKRSNTLVIFINQIRMKIGVM-FGNPETTTGGNALK
RECA_LEPIN      DMGDSHMGLQARLMSQALRKLTGTIAKSKTVVIFINQIRMKIGVM-FGSPETTTGGNALK
RECA_TREDE      EMGDSHMGLQARLMSQALRKLTAIIGKSNCMIIFINQIRMKIGVM-FGSPETTTGGNALK
RECA_TREPA      DMGDAHVGLIARLMSQALRKLTSIINKSKCTLIFINQLRMKIGIM-FGNPETTTGGIALK
RECA_BORGP      EMGDSQIGLQARLMSKSLRKITGILSKSNTCIMFINQIRMRIGIM-FGNPETTAGGNALK
RECA_CHLPN      DIGDVHVGLQARMMSQALRKLTATLSRSQTCAVFINQIREKIGVS-FGNPETTTGGRALK
RECA_CAUVC      EMGDSLPGLQARLMSQALRKLTASINKANTIVIFINQIRHKIGVM-YGSPETTTGGNALK
RECA_RICTY      EMGDAQMASQARLMSQALRKLTASINRTNCITVFINQIRMKIGVM-FGSPETTTGGNALK
RECA_GLUOX      DMGDSHVGLHARLMSQALRKLTGTVSRSNTLVIFLNQIRMKIGVM-FGNPETTTGGNALK
RECA_DESPS      NVGDVHVGLQARLMSQAMRKFAGVLNRSNTVLIFINQIRMKIGVM-FGSPETTTGGNALK
RECA_WOLTR      DMGDQHVGLQARLLSHGLRKLTSAVSKANCILIFINQIRMKIGVV-YGNPETTTGGNALK
RECA_WOLSU      DMGDQHVGLQARLMSQALRKVTGVLHKMNTTVIFINQIRMKIGMMGYGSPETTTGGNALK
RECA_STAHJ      EMGDTHVGLQARLMSQALRKLSGAISKSNTTAIFINQIREKVGVM-FGNPETTPGGRALK
RECA_LACLA      EIGDSSVGLQARMMSQAMRKLAGHINKTKTTAIFINQLREKVGVM-FGSPETTPGGRALK
RECA_CLOTE      EMGDSHVGLQARLMSQALRKLAGSINKSNCVAIFINQLREKVGIM-FGSPETTPGGRALK
RECA_GEOSL      EMGDSHMGLQARLMSQALRKLTGIISKSNCCVIFINQIRMKIGVM-FGNPETTTGGNALK
RECA_RHOBA      EIGDSHVGLQARLMSQSMRKLTGAIAKSKSAVVFINQIREKVGVM-FGSPETTPGGRALK
RECA_SYNY3      EMGDTSVGSQARLMSKAMRKIAGNIGRSGCLVIFLNQLRQKIGVT-YGSPEVTTGGNALK
RECA_GLOVI      EMGDAHVGLQARLMSQALRKITGNIGKTGCMVIFLNQLRSKIGVM-YGNPETTTGGNALK
RECA_TROW8      DMGDMHVGLQARLMSQALRKITSGLNQTGTTAIFINQLREKVGVF-FGSPETTPGGRALK
RECA_DESVH      SMGDTQVGGQARLMSHALRKLTGTIHKSRTAVIFINQIRMKIGTMGYGSPETTTGGNALK
RECA_CORJK      DMGDSHVGLQARLMSQALRKMTGALYQTGTTAIFINQLREKIGVM-FGSPETTTGGKALK
RECA_BIFLO      EMGDSHVGLQARLMSQALRKMTGALAQAGTTAIFINQLREKIGVF-FGNPETTTGGKALK
RECA_PORGI      EMGDNKVGLHARLMSQALRKMTGAISKSNTTCIFINQLREKIGVL-FGNPETTTGGNALK
RECA_CHLTE      EMGDSVVGLQARLMSQALRKLTGAISKSSSVCLFINQLRDKIGVM-YGSPETTTGGKALK
RECA_FUSNN      EMSDQQMGLQARLMSKGLRKLTGNLNKYKTTMIFINQIREKIGVT-YGPTTTTTGGKALK
RECA_LACLL      VKMP---GQQAKMMSEQLSQLVGKVNQTKTVIIFINQIRSTMSGL-FLNKETTPGGSALK
RECA_MYCGE      TIEEQTIGLHARMMSKGLRRIQSILPDSKTCVLFINQLREKPGVM-FGNNEVTTGGKALR
RECA_MYCPN      NMDDQTIGLHARMMSKGLRRVQSLLPESDTCLLFINQLREKPGVM-FGNGEVTTGGRALK
RECA_UREPA      NMNEALMGAHARLMSKGLRKIQPLINKSKTAIIFINQLREKINTF-FGNPEMTTGGKALK
RECA_MYCPE      SMEDQSMGTHARMMSKGLKILQTSLSKHKTTVIFINQVREKIGVM-FGNNEITTGGRALK
                       .  *:::*. :  .   :       :* **:*   .   :     *.** .*:

RECA_MESFL      FFSTLRIEVRKGES-LIENGI----VVANKVKVKVVKNKVAVPFKQTLITIGYDKGIERI
RECA_MYCMS      FFSSIRLEVRKSEN-ILSNSE----IIGNKIKIKIVKNKTAIPFKTATISLLYNKGIDKI
RECA_MYCH2      FYASIRLDVRKIQQ-ITSGND----ITGHSVKIKVVKNKLAIPFKTALVEIVFAKGISKS
RECA_MYCMO      FYSSIRLDVRKVSS-VSTGEV----ISGNNIKIKVVKNKLSAPFKEAFTEIVFSKGISKI
RECA_MYCPU      FYASIRLDVRKSTN-IMLNND----ISGNQIRVKVVKNKLAPPFKIAETEIIFSKGINKF
RECA_AQUAE      FFSDMRLEVRRLGD-VKEGGE----KKGYRVKVRVVKNKLAPPFQEAEFDIIYGEGICKL
RECA_THEMA      FYATMRMEVRRGEP-IKEGKD----VIGNVISVKIVKNKVAPPFKTAQTYIIYGKGIDRE
RECA_THET8      FYASVRLDVRKSGQPIKVGNE----AVGVKVRVKVVKNKLAPPFREAELEIYFGRGLDPV
RECA_DEIRA      FYASVRLDVRKIGQPTKVGND----AVANTVKIKTVKNKVAAPFKEVELALVYGKGFDQL
RECA_ECOLI      FYASVRLDIRRIGA-VKEG----ENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFY
RECA_CHRVO      FYASVRLDIRRTGG-IKKG----DEVIGNDTRVKVVKNKVSPPFRQADFEILYGEGISRQ
RECA_FRATT      FYSSVRLEVKKGGS-IKDG----IDVSGNEIKVKVVKNKVAPPFKQADFELIYGEGISLE
RECA_LEPIN      FYCSVRLDIRKIET-IKEK----EESVGNRVRVKVVKNKCAPPFKQAEFDIIFNAGISRE
RECA_TREDE      FYASVRLDVRKIET-LGKD---DDEAWGNKIRVKVVKNKVAPPFRKVEMEILFGKGVCPY
RECA_TREPA      FYSSVRIEVRKVET-LSRG---DEEAWGNKVRIRIVKNKMAPPFRKVETEILFGKGFSAF
RECA_BORGP      FYSSLRLEVRKIEQ-ITRSGS-SDDVIGNKIRVKIVKNKVAPPFRKVELVIYFGKGISRE
RECA_CHLPN      FYSSIRLDIRRIGS-IKGS---DNSDIGNRIKVKVAKNKLAPPFRIAEFDILFNEGISSA
RECA_CAUVC      FYASVRLDIRRTGS-VKAR----DEIVGNNVRVKVVKNKVAPPFREVEFDIMYGEGISKL
RECA_RICTY      FYASVRIDIRRIGS-IKDK----EEVIGSQTKVKVVKNKVSPPFKTADFDIMYGSGISKE
RECA_GLUOX      FYSSIRLDIRRIGS-IKDK----DEVVGNQTRVKVVKNKMAPPFRQVEFDIMYGEGISKM
RECA_DESPS      FYCSERLDIRRIGA-IKDG----QEITGNRTRVKVVKNKVAPPFKIAEFDIIYGEGISKI
RECA_WOLTR      FYTSVRLDIRKVGA-IKDK----ESIKGNETRVKVVKNKVAPPFREAKFDIMYNEGVSKL
RECA_WOLSU      FYASVRIDVRRIAS-LKQG----EQHIGNRVKAKVVKNKVAPPFREAEFDIMFGEGISQE
RECA_STAHJ      FYSSVRLEVRRAEQ-LKQG----QEIVGNRTKIKVVKNKVAPPFRVAEVDIMYGQGISKE
RECA_LACLA      FYASVRLDVRGSTK-IEEGSGDNKTQIGKITKIKVVKNKVAPPFKVALVDIMFGEGISRT
RECA_CLOTE      FYSSVRLDVRRIDT-IKQG----DEFLGNRTRVKVTKNKVAPPFKNAEFDIMYNEGISRT
RECA_GEOSL      FYASVRLDIRKIAS-LKQGQD----VIGSRTKVKVVKNKVAPPFKEVEFDIYYGEGISRE
RECA_RHOBA      FYCSCRIDVRRIGS-LKDGEE----QVGQRVKAKIVKNKVAPPFRIAEFDMMHSNGISFE
RECA_SYNY3      FYASVRLDIRRIQT-LKKGTEG---EYGIRAKVKVAKNKVAPPFRIAEFDIIFGQGISRM
RECA_GLOVI      FYASVRLDIRKAET-LKKGQD----EYGNRVRVKVVKNKVAPPFRKAEFDIIFGKGISSL
RECA_TROW8      FYASVRLDIRRVET-IKQGTE----AVGNRTRVKVVKNKVAPPFKQAEFDVLYGVGISRE
RECA_DESVH      FYSSVRMDIRKIQT-LKDKEE----VYGSRTRVKIVKNKVAPPFREALFDILYGTGISRT
RECA_CORJK      FYASVRCDIRRIQA-LKDGQD----VVGNRTRLKVVKNKVSPPFKIAEFDILYGEGISRE
RECA_BIFLO      FYASVRLDIRRIQT-LKNGDE----AVGNRTRVKVVKNKMAPPFKSAEFDMLYGEGISRE
RECA_PORGI      FYASIRIDIRKSTP-IKDGEE----IMGHLTKVKVLKNKVAPPFRKAEFDIVFGEGISRS
RECA_CHLTE      FYSSVRLDIRKIAQ-IKDGEE----LVGNRTKVKVVKNKVAPPFKTAEFDILYGEGISVL
RECA_FUSNN      FYSSVRMEVKKMGT-VKQGDD----PIGSEVIVKVTKNKVAPPFKEAAFEILYGKGISKV
RECA_LACLL      FYSSVRIEVKSGEK-IKDGID----TIGKKTTLHTVKNKVSSPYKKPTVINIFGDGFSQE
RECA_MYCGE      FYSSLRMEAKRVEL-LKDKFNNY---VGIKTKVMVSKNKIAKPFGVAILEIMFNRGFVHE
RECA_MYCPN      FYASMRMEAKRSEL-LKDRFGNY---VGIKSKLTVSKNKVARPFGVAFLEIMFNRGIVYE
RECA_UREPA      FYASLRIETKKADL-IKEGINK----IGIKTKVTTVKNKLAPPLQTCFIDIFFGSGFDYN
RECA_MYCPE      FFSTLRLDVRRSEL-IKSGTDV----IGIRSKITVTKNKVAPPFKNCFVDIFFNKGFDPT
                *:   * : :                 .        *** : *         .  *.   

RECA_MESFL      NEIIELATLYNILDKSGVWYSYEKEK-----IGQGKNAVKEWLNKNPDKLSKIEFELKEF
RECA_MYCMS      GELVDLLVSYEIVEKSGVWYSYQNEK-----IGQGKTSVIQWLNADEKRTNELIQQVKKI
RECA_MYCH2      AEIAQLGEELGILVRKGSWFAYKGEN-----IAQGKVNLKLLLENNTKLFNEIKDQIIEK
RECA_MYCMO      SEAVEFAENLKIITRKGAWFYYNDQN-----IAQGKSNLKDLLEKNEALYSEILTKVISA
RECA_MYCPU      GEVADLALVHDVLQKKGAWFSYNGNN-----IAQGRQKLIAQLESNNELFEEIFQKIVE-
RECA_AQUAE      CDLIEVATNLGIFTKSGSWYSYGDKR-----LGQGKEQVKKYLQEHPELIDEIDQKVREA
RECA_THEMA      YELFNIAVNEGIVDRKGSWYYYTTLKGEEVSLGQGSSNAVQFLKDNPEIAGEIERRIREK
RECA_THET8      ADLVNVAVAAGVIEKAGSWFSYGELR-----LGQGKEKAAEALRERPELLEEIRAKVLER
RECA_DEIRA      SDLVGLAADMDIIKKAGSFYSYGDER-----IGQGKEKTIAYIAERPEMEQEIRDRVMAA
RECA_ECOLI      GELVDLGVKEKLIEKAGAWYSYKGEK-----IGQGKANATAWLKDNPETAKEIEKKVREL
RECA_CHRVO      GEIIELGVKHGFIDKSGAWYAYNGQK-----IGQGKDNTREWLKANPAIADEIERKIREA
RECA_FRATT      AELIDLGAKYNIIEKSGAWYSYKGKK-----IGQGKEKSKEYLKENTAERDEIERAILEL
RECA_LEPIN      GSLVDLGVKHDIIHKAGAWYSYNTEK-----IGQGKEAAKEYLKNNPEIALTIENMVRDL
RECA_TREDE      GSLLDSAVKQEIIGKSGSWYSYGDDK-----IGQGRPNAVKFLEENIDIAQKIEKELREK
RECA_TREPA      SCLLDAAVKQEIIEKKGAWYAYREEK-----IGQGRDNAVGFLQQNMDITLEIERAVRTK
RECA_BORGP      AGILDAALKHNLIQKTGSWYSLGNNK-----LGQGRESVVEYLNKEVELANDLDKRLRKI
RECA_CHLPN      GCILDLAVEYNIIEKKGSWFNYQEKK-----LGQGREFVREELKRNRKLFEEIEKRIYDV
RECA_CAUVC      GEVIDLGVKAGIIDKAGSWFSYGSQR-----IGQGRDNVREFLKNNPDVAADIEKAVRKS
RECA_RICTY      GEIIDLGVKLEIIEKSGSWFAYNKVR-----IGQGRENVKQYLKEHPQIANEIEKIIREK
RECA_GLUOX      GELLDLGVKGNIVEKSGAWFSFDSQR-----IGQGRENAKQFLREHPEMASEIERRIRAE
RECA_DESPS      GDMFDLAVGLDIIDKSGSWYSYKNER-----IGQGRENSKQFLMDTPAICHEIEEKVRSA
RECA_WOLTR      GEIIDIGAKLGVLEKAGAYYSYNNTR-----LGQGRENVKNYFKANKEVANEVEAKIRDL
RECA_WOLSU      GELIDYGVKLDIVDKSGSWLSYGDKK-----LGQGKENAKAFLKENKEIANEIQAKIIGA
RECA_STAHJ      GEVIDLGVENDIVDKSGAWYSYNGDR-----MGQGKENVKTYLKENPQVKEEIDRKLREK
RECA_LACLA      GELLNIAVDEGIIKKSGAWFAYNDEK-----IGQGAEKAKNYLKEHQEIFDEIDHKVRTA
RECA_CLOTE      GDVLDLGVKEEIVQKSGSWFSYNDVR-----LGQGRENAKQFLKDNPELLYEIENTIREK
RECA_GEOSL      GDILDLAVEKGIVDKSGAWFSYGGDR-----IGQGRENSRLFLKERPELVNEIEGKVYDV
RECA_RHOBA      GDLLDLGTENKVVNRSGSWFKYGDTY-----LGQGKEKARNFLIENPDVSDEIKQKVLAA
RECA_SYNY3      GCTIDLAEKCEVITRKGAWYSYNGEN-----IAQGRDNAMKYLEENPEIAATIDQQVREK
RECA_GLOVI      GCILDLAVEMEIVERKGAWYSYGSER-----LGQGRENVLALLEENAAQAQEIEIKVREK
RECA_TROW8      SGLIDFAVDRGIIKKSGSWYVYGDDQ-----LGQGKENARRFLLENKSVADEIENKIISL
RECA_DESVH      GEIIDLGSDAGIIDKSGSWFAFGSER-----LGQGKENVRALLEENAPLREAIEAKLIEH
RECA_CORJK      GSIIDLGVETGLIKKSGSWFTYDGDQ-----LGQGKEKAREFLKNNRDLSAELEDRIARE
RECA_BIFLO      GSVIDMAQQVGVVKKSGSWFTYEGDQ-----LGQGREKVRQFLKDNPAITEEIENKVKAE
RECA_PORGI      GEIIDLGVELDIIKKSGSWFSYGDTK-----LGQGREAAKEMIRDNEELAEELTEKIREA
RECA_CHLTE      GELIDLAVEFGIIKKSGAWFSYGTEK-----LGQGRENVKKLLKEDETLRNTIRQQVRDM
RECA_FUSNN      GEIIDAAVAKDVIVKAGSWFSFRDQS-----IGQGKEKVRAELEINPELLAQVEKDLKEA
RECA_LACLL      IDVVTTALQLGVVKKLGEWYSFNGQK-----LGRGIFGVKEYLSHHPSVFNALDNLTREA
RECA_MYCGE      HEVIDLALKFNVVVRAGNSYSFNNES-----IAVGKEKLLNVLSEKPALFEQIKELTVQQ
RECA_MYCPN      HEVIELALKHNVVVRSDNAYSFKSQN-----IAIGKEKLFSVLAEKPELFEQIKQLTIKQ
RECA_UREPA      NEIIDFAIQYGVLKKNGSWFYFNDNK-----IGQGREQLKNTLSKNNELFIQISEKTLEF
RECA_MYCPE      KEIIDFAIEYEIIKKSGSWFYYNETK-----LAQGRNNLDSYLKENNEIYDEIKKLVFDE
                           .. : .              :. *       :         :       

RECA_MESFL      IEKS--------------------------------------------------------
RECA_MYCMS      IEQKE-------------------------------------------------------
RECA_MYCH2      LKENQQQSQTL-------------------------------------------------
RECA_MYCMO      LSKENVNSIL--------------------------------------------------
RECA_MYCPU      -KENQKLS----------------------------------------------------
RECA_AQUAE      AGLAGSNIEE--------------------------------------------------
RECA_THEMA      YGLLSVEKEEQR------------------------------------------------
RECA_THET8      ------SDQVVL-----------------------------------------------A
RECA_DEIRA      IRAGNAGEAPAL-----------------------------------------------A
RECA_ECOLI      LLSN-----------------------------------------------------PNS
RECA_CHRVO      VGVK-----------------------------------------------------IEI
RECA_FRATT      LLPN-----------------------------------------------------KYS
RECA_LEPIN      NSLP-----------------------------------------------------LLV
RECA_TREDE      LFPGRPFVSSFV--------------------------------------------EKTK
RECA_TREPA      LFPKQAFISSFQ--------------------------------------------EHRP
RECA_BORGP      IFNN--------------------------------------------------------
RECA_CHLPN      IAAN-----------------------------------------------------KTP
RECA_CAUVC      SQKIEEELLVGG------------------------------------------------
RECA_RICTY      SSAITNINLDQT------------------------------------------------
RECA_GLUOX      AGVLSDALMTDP------------------------------------------------
RECA_DESPS      YGLPDREETKRE------------------------------------------------
RECA_WOLTR      LGNSDNSITME-------------------------------------------------
RECA_WOLSU      IGSSDEITTFGD------------------------------------------------
RECA_STAHJ      LGIFD-GDVDEK------------------------------------------------
RECA_LACLA      HGLLDEAEVAET------------------------------------------------
RECA_CLOTE      YDLPIVKNNIKA------------------------------------------------
RECA_GEOSL      AGIPRKGAKE--------------------------------------------------
RECA_RHOBA      GGFVAPLEVD--------------------------------------------------
RECA_SYNY3      LSLVNAVFPV------------------------------------------------ET
RECA_GLOVI      IASGAAVPAA------------------------------------------------AV
RECA_TROW8      LGFRSNEFGDLPDHDAAVRTSPDTNSRKVSGTGAVHTTSGSPSAGKGTASGAVNNSRDST
RECA_DESVH      LGMTPTKFAS--------------------------------------------------
RECA_CORJK      LKIGPYAKMK-------------------------------------------DEQTEEA
RECA_BIFLO      FGLIGSADQF-------------------------------------------AEDGEAA
RECA_PORGI      IRNKHS------------------------------------------------------
RECA_CHLTE      LTGAPTA-----------------------------------------------------
RECA_FUSNN      IAKGPVDKKKKK----------------------------------------------SK
RECA_LACLL      LQFS--------------------------------------------------------
RECA_MYCGE      LANKNSFQQTAS------------------------------------------------
RECA_MYCPN      IHSP---PPPAS------------------------------------------------
RECA_UREPA      VNNE---KSNWQ------------------------------------------------
RECA_MYCPE      IDKN---NK---------------------------------------------------
                                                                            

RECA_MESFL      ------------------------------------------------------------
RECA_MYCMS      ------------------------------------------------------------
RECA_MYCH2      ------------------------------------------------------------
RECA_MYCMO      ------------------------------------------------------------
RECA_MYCPU      ------------------------------------------------------------
RECA_AQUAE      ----STGEEGK-------------------------------------------------
RECA_THEMA      KEKKSSGEEAS-------------------------------------------------
RECA_THET8      AGEDEGE-----------------------------------------------------
RECA_DEIRA      PAPAAPEAAEA-------------------------------------------------
RECA_ECOLI      TPDFSVDDSEG--------VAETNEDF---------------------------------
RECA_CHRVO      NEN---QGDEE--------FADDAFDA---------------------------------
RECA_FRATT      NKDSNDSPKEGSKIKTKVNPAVTQDELI--------------------------------
RECA_LEPIN      QENNKKSRKEE--------KLEQAAG----------------------------------
RECA_TREDE      EQK-EAQEKAV--------EALKKEEGSKEDALTGNKDETDDSAQKNSAASKAKRAEVVG
RECA_TREPA      ALSLEASPEES--------DAKTLRRXASRGAGASSSRVQEGSAANDHFQDESTTAKLL-
RECA_BORGP      -----FDQEDV--------NFIKLKED---------------------------------
RECA_CHLPN      SVHANETPQEV--------PAQTVEA----------------------------------
RECA_CAUVC      PEEGEED-----------------------------------------------------
RECA_RICTY      EE----------------------------------------------------------
RECA_GLUOX      EPDADGTPED--------------------------------------------------
RECA_DESPS      ETAQIPDTEKT--------KDV--------------------------------------
RECA_WOLTR      -EESRQLLEEA--------VF---------------------------------------
RECA_WOLSU      DEDESENLES--------------------------------------------------
RECA_STAHJ      EEDAPQTLFVE--------E----------------------------------------
RECA_LACLA      TEDTSTKAKAT--------KAKKEEKVVETEEIELELED---------------------
RECA_CLOTE      EVEDKKEKKAE--------EV---------------------------------------
RECA_GEOSL      AA----------------------------------------------------------
RECA_RHOBA      ADESEEAVEDG--------EAVANS-----------------------------------
RECA_SYNY3      EDGAEEQGEDG--------DF---------------------------------------
RECA_GLOVI      AAPDEGDDDLG--------DEEV-------------------------------------
RECA_TROW8      GGDTPAGQGPL--------NLSVNRDVSTDTVSSKISDATHNQKPAGNGKSVKRKG----
RECA_DESVH      SGEEPANDEEN--------DL---------------------------------------
RECA_CORJK      AGDQMDEDKPI--------DLSPNFDDDDAN-----------------------------
RECA_BIFLO      AAAAVSEAAAA--------DVAKDSKAAAAPAAKTTRAKAGTAKA---------------
RECA_PORGI      ------------------------------------------------------------
RECA_CHLTE      ------------------------------------------------------------
RECA_FUSNN      KEASSDDTDDE--------NLEIDDAIDENND----------------------------
RECA_LACLL      ------------------------------------------------------------
RECA_MYCGE      ------------------------------------------------------------
RECA_MYCPN      ------------------------------------------------------------
RECA_UREPA      ------------------------------------------------------------
RECA_MYCPE      ------------------------------------------------------------
                                                                            

RECA_MESFL      --------
RECA_MYCMS      --------
RECA_MYCH2      --------
RECA_MYCMO      --------
RECA_MYCPU      --------
RECA_AQUAE      --------
RECA_THEMA      --------
RECA_THET8      --------
RECA_DEIRA      --------
RECA_ECOLI      --------
RECA_CHRVO      --------
RECA_FRATT      --------
RECA_LEPIN      --------
RECA_TREDE      LPADDSLF
RECA_TREPA      --------
RECA_BORGP      --------
RECA_CHLPN      --------
RECA_CAUVC      --------
RECA_RICTY      --------
RECA_GLUOX      --------
RECA_DESPS      --------
RECA_WOLTR      --------
RECA_WOLSU      --------
RECA_STAHJ      --------
RECA_LACLA      --------
RECA_CLOTE      --------
RECA_GEOSL      --------
RECA_RHOBA      --------
RECA_SYNY3      --------
RECA_GLOVI      --------
RECA_TROW8      --------
RECA_DESVH      --------
RECA_CORJK      --------
RECA_BIFLO      --------
RECA_PORGI      --------
RECA_CHLTE      --------
RECA_FUSNN      --------
RECA_LACLL      --------
RECA_MYCGE      --------
RECA_MYCPN      --------
RECA_UREPA      --------
RECA_MYCPE      --------