CLUSTAL format seed alignment for MF_00269

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TPX_ECOLI       -MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTG
TPX_ECO57       -MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTG
TPX_SHIFL       -MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTG
TPX_ECOL6       -MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTG
TPX_SHIDY       -MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTG
TPX_SALTY       -MSQTVHFQGNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTG
TPX_SALTI       -MSQTVHFQDNPVTVANVIPQAGSKAQAFTLVAKDLSDVSLSQYAGKRKVLNIFPSIDTG
TPX_YERPE       -MTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTG
TPX_PSEAE       -MAQ-VTLKGNPVNVDGQLPQKGAQAPAFSLVGGDLADVTLENFAGKRKVLNIFPSVDTP
TPX_HAEIN       ---MTVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFASKRKVLNIFPSIDTG
TPX_PASMU       --MSKITLAGTEIEVSGVFPQVGDVVTDFTTVSAKLEDTTLANFAGKRKILNIFPSIDTG
TPX_RALSO       --MANVTLGGNPIEVGGALPSVGAKAPAFTLVGKDLKDVSLADFAGKRKVLNIVPSLDTP
TPX_MYCBO       --MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTP
TPX_MYCTU       --MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTP
TPX_CORGL       --MAKTHFQGNETATSGELPQVGDNLAEFNLVNTELGEVSSKDFQGRKLVLNIFPSVDTG
TPX_COREF       --MATTHFDGTDTPTSGELPAVGDTLPDFTVVDTNLGEVSLSDLKGKKLVLNIFPSVDTG
TPX_CHLTE       MIMATITLKGNSIHTAGELPAVGSQLPAFTLVKSDLSEVSPADFAGKKLVLNIFPSLDTA
TPX_VIBCH       ---MTVTFQNNPVSISGSFPKVGDRLPSFTLCGADLNDLSNEDFKGKKIVMSIFPSIDTP
TPX_VIBC3       ---MTVTFQNNPVSISGSFPKVGDRLPSFTLCGADLNDLNNEDFKGKKIVMSIFPSIDTP
TPX_LEPIC       --MTKVTLKGNPVQLEGKIPSPGDKAPDFKAIKQDLSEFSLKDYAGKVKILVAVPSLDTS
TPX_LEPIN       --MTKVTLKGNPVQLEGKIPSPGDKAPDFKAIKQDLSEFSLKDYAGKVKILVAVPSLDTS
TPX_LISIN       --MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTS
TPX_LISMO       --MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTS
TPX_LISMF       --MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTS
TPX_BACHD       --MASITFKGNPMTLLGNEVKVGDKAPNFTVLANDLSPVTLDDSKGKVRLISVVPSIDTG
TPX_BACSU       --MAEITFKGGPVTLVGQEVKVGDQAPDFTVLTNSLEEKSLADMKGKVTIISVIPSIDTG
TPX_OCEIH       --MSNVTFKNDPVTLLGAEKKVGDSAPDFTVLANDLSKKHLSDYKGKVKVISVVPSIDTG
TPX_STAAW       --MTEITFKGGPIHLKGQQINEGDFAPDFTVLDNDLNQVTLADYAGKKKLISVVPSIDTG
TPX_STAAC       --MTEITFKGGPIHLKGQQINEGDFAPDFTVLDNDLNQVTLADYAGKKKLISVVPSIDTG
TPX_STAAS       --MTEITFKGGPIHLKGQQINEGDFAPDFTVLDNDLNQVTLADYAGKKKLISVVPSIDTG
TPX_STAAR       --MTEITFKGGPIHLKGQQINEGDFAPDFTVLDNDLNQVTLADYAGKKKLISVVPSIDTG
TPX_STAAM       --MTEITFKGGPIHLKGQQINEGDFAPDFTVLDNDLNQVTLADYAGKKKLISVVPSIDTG
TPX_STAAN       --MTEITFKGGPIHLKGQQINEGDFAPDFTVLDNDLNQVTLADYAGKKKLISVVPSIDTG
TPX_STAHJ       --MTQITFKNNPIHLAGSEVSEGQHAPDFKVLDNDLNEVSLENYKGQKKLISVVPSIDTG
TPX_STAS1       --MAQITFKQEPITLLGSQVKTGETAPEFTLLDNDLNEVNLSTYDGQKKLISVVPSIDTG
TPX_STAES       --MTQITFKNNPIKLSGSEVNEGDIAPNFTVLDNSLNQITLDDYKNKKKLISVIPSIDTG
TPX_STAEQ       --MTQITFKNNPIKLSGSEVNEGDIAPNFTVLDNSLNQITLDDYKNKKKLISVIPSIDTG
TPX_STRSA       ----MTTFLGNPVTFTGKQLQVGDTAHDFSLTATDLSKKTLADFAGKKKVLSIIPSIDTG
TPX_STRGN       ----MTTFLGNPVTFTGKQLQVGDTAHDFSLTATDLSKKTLADFAGKKKVLSIIPSIDTG
TPX_STRPA       ----MATFLGNPVTFTGSQLQVGEIAHDFSLITPALEKKSLADFAGKKKVLSIIPSIDTG
TPX_STRR6       ----MVTFLGNPVSFTGKQLQVGDKALDFSLTTTDLSKKSLADFDGKKKVLSVVPSIDTG
TPX_STRPN       ----MVTFLGNPVSFTGKQLQVGDKALDFSLTTTDLSKKSLADFDGKKKVLSVVPSIDTG
TPX_STRP2       ----MVTFLGNPVSFTGKQLQVGDKALDFSLTTTDLSKKSLADFDGKKKVLSVVPSIDTG
TPX_STRA5       ----MTTFLGNPVTFTGKQLQVGDIAKDFLLIATDLSQKSLKDFEGKKKVISVVPSIDTG
TPX_STRA3       ----MTTFLGNSVTFTGKQLQVGDIAKDFLLIATDLSQKSLKDFEGKKKVISVVPSIDTG
TPX_STRMU       ----MTTFNGNTVTLAGKKLQVGDTAPDFSLTDTDLSKKTLADFAGQKKVISVVPSIDTG
TPX_CLOAB       ---MKVKFKGKEVTLEGTEIKVGDTFPDFVAVNSSLEPVMLKN-TNRVRVFLAVPSVDTP
TPX_HELPJ       --MQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGS
TPX_HELPY       --MQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGS
TPX_AQUAE       -MARTVNLKGNPVTLVGPELKVGDRAPEAVVVTKDLQEKIVGGAKDVVQVIITVPSLDTP
TPX_CAMJE       --MSIVNFKGNPVKLKGNSVEVGADAPKVNLKAKDLSVIEIGAAGKT-QIILSVPSLDTP
                       :        .     *            *             :.  .**:   

TPX_ECOLI       VCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLN--NVITLSTFRNAEFLQA
TPX_ECO57       VCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLN--NVITLSTFRNAEFLQA
TPX_SHIFL       VCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLN--NVITLSTFRNAEFLQA
TPX_ECOL6       VCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLN--NVITLSTFRNAEFLQA
TPX_SHIDY       VCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLN--NVITLSTFRNAEFLQA
TPX_SALTY       VCAASVRKFNQLATEVENTVVLCVSADLPFAQSRFCGAEGLS--NVITLSTLRNNEFLKN
TPX_SALTI       VCAASVRKFNQLATEVENTVVLCVSADLPFAQSRFCGAEGLS--NVITLSTLRNNEFLKN
TPX_YERPE       VCAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLS--NVITLSTLRGADFKQA
TPX_PSEAE       TCATSVRKFNVEAGKLANTVVLCISADLPFAQKRFCGAEGLE--NVVNLSTLRGREFLEN
TPX_HAEIN       VCATSVRKFNQQAAKLSNTIVLCISADLPFAQARFCGAEGIE--NAKTVSTFRNHALHSQ
TPX_PASMU       ICATSVRKFNEQAAKLANTAVLCLSTDLPFAQARFCGAEGLE--NVFTVSTFRNKDVHKQ
TPX_RALSO       VCATSTRKFNEAVSKLENTVVFSISADLPFAAGRFCTTEGLD--NVVPLSTFRDAGFKQA
TPX_MYCBO       VCATSVRTFDERAAA-SGATVLCVSKDLPFAQKRFCGAEGTE--NVMPASAFRDS-FGED
TPX_MYCTU       VCATSVRTFDERAAA-SGATVLCVSKDLPFAQKRFCGAEGTE--NVMPASAFRDS-FGED
TPX_CORGL       VCATSVRKFNEAAASLENTTVLCISKDLPFALGRFCSAEGIE--NVTPVSAFRST-FGED
TPX_COREF       LCAESVRRFNAEAAGLDNTTVLCVSKDLPFALGRFCGAEGLD--NVTAASAFRST-FGED
TPX_CHLTE       VCAASVRRFNKEAGERGDAVVLCISADLPFAQGRFCTTEGLD--NVVPLSVYRSPEFGLD
TPX_VIBCH       VCSKSVKVLQNALMTRNDTVLLCVSADLPFAMSRFCTEHAVA--NVTNASFFREPAFTER
TPX_VIBC3       VCSKSVKVLQNALMTRSDTVLLCVSADLPFAMSRFCTEHAVA--NVTNASFFREPAFTER
TPX_LEPIC       VCALETKAFNEKAAGISGVTTLVISGDLPFAMGRFCSTEGINSPNLVTGSQYRDFSFSKA
TPX_LEPIN       VCALETKAFNEKAAGISGVTTLVISGDLPFAMGRFCSTEGINSPNLVTGSQYRDFSFSKA
TPX_LISIN       VCSTQTRKFNEEASNLDNTVVLTISVDLPFAQKKWCAAEGLP--NAITLSDHRDLSFGEA
TPX_LISMO       VCSTQTRKFNEEASNLDNTVVLTISVDLPFAQKKWCAAEGLP--NAITLSDHRDLSFGEA
TPX_LISMF       VCSTQTRKFNEEASNLDNTVVLTISVDLPFAQKKWCAAEGLP--NAITLSDHRDLSFGEA
TPX_BACHD       VCDAQTRKFNEEAANLDGVEVLTVSVDLPFAQKRWCATAGLE--QAKTLSDHRDLSFGKA
TPX_BACSU       VCDAQTRRFNEEAAKLGDVNVYTISADLPFAQARWCGANGID--KVETLSDHRDMSFGEA
TPX_OCEIH       VCSEQTRRFNQEATNLENVQILTISMDLPFAQKRWCAANGID--RVDTLSDHREADFGQK
TPX_STAAW       VCDQQTRKFNSDASKEEGI-VLTISADLPFAQKRWCASAGLD--NVITLSDHRDLSFGEN
TPX_STAAC       VCDQQTRKFNSDASKEEGI-VLTISADLPFAQKRWCASAGLD--NVITLSDHRDLSFGEN
TPX_STAAS       VCDQQTRKFNSDASKEEGI-VLTISADLPFAQKRWCASAGLD--NVITLSDHRDLSFGEN
TPX_STAAR       VCDQQTRKFNSEASKEEGI-VLTISADLPFAQKRWCASAGLD--NVITLSDHRDLSFGEN
TPX_STAAM       VCDQQTRKFNSEASKEEGI-VLTISADLPFAQKRWCASAGLD--NVITLSDHRDLSFGEN
TPX_STAAN       VCDQQTRKFNSEASKEEGI-VLTISADLPFAQKRWCASAGLD--NVITLSDHRDLSFGEN
TPX_STAHJ       VCDQQTRKFNEEAAQEDGV-VLTISADLPFAQKRWCASNGLD--NVITLSDHKDLSFGQQ
TPX_STAS1       VCDQQTRKFNEEASQEDGV-VLTVSVDLPFAQKRWCASNGLD--NVITLSDHKDLSFGKN
TPX_STAES       VCDSQTRKFNEEASAEDGV-VLTISVDLPFAQKRWCASSGLD--NVITLSDHKDLSFGRN
TPX_STAEQ       VCDSQTRKFNEEASAEDGV-VLTISVDLPFAQKRWCASSGLD--NVITLSDHKDLSFGRN
TPX_STRSA       VCSTQTRRFNQELSDLDNTVVITVSVDLPFAQGKWCAAEGIE--NAVMLSDYFDHSFGRD
TPX_STRGN       VCSTQTRRFNQELSDLDNTVVITVSVDLPFAQGKWCAAEGIE--NAVMLSDYFDHSFGRD
TPX_STRPA       ICSMQTRHFNKTLSDLEDTVVLTVSVDLPFAQGKWCAAEGLD--NAIMLSDYYDHSFGKA
TPX_STRR6       ICSTQTRRFNEELAGLDNTVVLTVSMDLPFAQKRWCGAEGLD--NAIMLSDYFDHSFGRD
TPX_STRPN       ICSTQTRRFNEELAGLDNTVVLTVSMDLPFAQKRWCGAEGLD--NAIMLSDYFDHSFGRD
TPX_STRP2       ICSTQTRRFNEELAGLDNTVVLTVSMDLPFAQKRWCGAEGLD--NAIMLSDYFDHSFGRD
TPX_STRA5       ICSKQTRTFNEELSELDNTVVITVSMDLPFAQKRWCSAEGLD--NVILLSDFYDHSFGQE
TPX_STRA3       ICSKQTRTFNEELSELDNTVVITVSMDLPFAQKRWCSAEGLD--NVILLSDFYDHSFGQD
TPX_STRMU       VCDAQTRRFNQELSDADNTVVITVSVDLPFAQARWCGAAGLN--DAITLSDYYDYSFGKA
TPX_CLOAB       VCDLEVKTFNARASEIDGVSIYTISMDLPFAQSRWCGAEGIK--NVTTLSDYRDRAFGKN
TPX_HELPJ       VCLLQAKHFNEQAGKLPSVSFSVISMDLPFSQGQICGAEGIK--DLRILSDFRYKAFGEN
TPX_HELPY       VCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIK--DLRILSDFRYKAFGEN
TPX_AQUAE       VCETETKKFNEIMAGMEGVDVTVVSMDLPFAQKRFCESFNIQ--NVTVASDFRYRDM-EK
TPX_CAMJE       VCATEAREFNKKVASYNGAEVIVVSMDLPFAMGRFCSTEGIE--NLSVASDFVAKEFGEK
                 *  ..: ::       .     :* ****:  : *             *      .   

TPX_ECOLI       YGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA---------
TPX_ECO57       YGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA---------
TPX_SHIFL       YGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA---------
TPX_ECOL6       YGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA---------
TPX_SHIDY       YGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA---------
TPX_SALTY       YGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYDAALNVLKA---------
TPX_SALTI       YGVEIVDGPLKGLAARAVIVLDENDNVIFSQLVDEITHEPDYDAALNVLKA---------
TPX_YERPE       YGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALAALK----------
TPX_PSEAE       YGVAIASGPLAGLAARAVVVLDEQNKVLHSELVGEIADEPNYAAALAAL-----------
TPX_HAEIN       LGVDIQTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAALAVLA----------
TPX_PASMU       LGVDIVEGPLAGLTARAVIVLDENNRVLHSELVPEIKQEPNYDAALAVL-----------
TPX_RALSO       YGVDIKTGPLAGLTARAVVVLDANDNVLHAQLVPEIKEEPNYDAALAALK----------
TPX_MYCBO       YGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGA---------
TPX_MYCTU       YGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGA---------
TPX_CORGL       NGIVLEGSPLKGLLARSVIVVDENGKVAYTQLVDEISTEPDYDAALAALN----------
TPX_COREF       YGVVLEGSPLKGLLARSVIVADEDGKVIYTQLVDEIKTEPDYASAIKALG----------
TPX_CHLTE       YGLTITDGPLKGLLSRAVIVTDASGKVLYAEQVPEIVQEPDYDKALAALA----------
TPX_VIBCH       FGVNLNEGALRGLAARAVIVADEFGVITHSELVNEITNEPDYDRILMSL-----------
TPX_VIBC3       FGVNLNEGALRGLAARAVIVADEFGVITHSELVNEITNEPDYDRILMSL-----------
TPX_LEPIC       YGTHIADGPLKGLSARAVFVLDKSDTVRYVEIVPEITTEPNYTAAIAAANAAL-------
TPX_LEPIN       YGTHIADGPLKGLSARAVFVLDKSDTVRYVEIVPEITTEPNYTAAIAAANAAL-------
TPX_LISIN       YGVIMKE---LRLLARSVFVVNAKGEIVYTEVVPEGSDHPNYEAAIEAAKKA--------
TPX_LISMO       YGVIMKE---LRLLARSVFVVNAVGEIVYTEVVPEGSDHPNYEAAIEAAKKA--------
TPX_LISMF       YGVVMKE---LRLLARSVFVVNAAGEIVYTEVVPEGSDHPNYEAAIEAAKKA--------
TPX_BACHD       YGVAIEE---LRLLARAVFVINANDEVTYVEYVSEATNHPDYEKAIEAAKAAL-------
TPX_BACSU       FGVYIKE---LRLLARSVFVLDENGKVVYAEYVSEATNHPNYEKPIEAAKALVK------
TPX_OCEIH       YGVIIEE---LRLLSRAVFVVDENDKITYVEYLSEVSNHPDYEAVLSHLNK---------
TPX_STAAW       YGVVMEE---LRLLARAVFVLDADNKVVYKEIVSEGTDFPDFDAALAAYKNI--------
TPX_STAAC       YGVVMEE---LRLLARAVFVLDADNKVVYKEIVSEGTDFPDFDAALAAYKNI--------
TPX_STAAS       YGVVMEE---LRLLARAVFVLDADNKVVYKEIVSEGTDFPDFDAALAAYKNI--------
TPX_STAAR       YGVVMEE---LRLLARAVFVLDADNKVVYKEIVSEGTDFPDFDAALAAYKNI--------
TPX_STAAM       YGVVMEE---LRLLARAVFVLDVDNKVVYKEIVSEGTDFPDFDAALAAYKNI--------
TPX_STAAN       YGVVMEE---LRLLARAVFVLDVDNKVVYKEIVSEGTDFPDFDAALAAYKNI--------
TPX_STAHJ       YGVVMEE---LRLLARSVFVLDSNDKVVYKELVSEGTDFPNFDAALEAYRNI--------
TPX_STAS1       YGVVMEE---LRLLARSVFVLDKNNKVVYSEIVSEGTDFPDFESALEAYRNI--------
TPX_STAES       YGLVMDE---LRLLARSVFVLNENNKVVYKEIVSEGTNYPDFEAALKAYRNI--------
TPX_STAEQ       YGLVMDE---LRLLARSVFVLNENNKVVYKEIVSEGTNYPDFEAALKAYRNI--------
TPX_STRSA       YAVLINE---WHLLARAVLVLDENNTVTYAEYVDNINTEPDYDAAIAAVKSL--------
TPX_STRGN       YAVLINE---WHLLARAVLVLDENNTVTYAEYVDNINTEPDYDAAIAAVKNL--------
TPX_STRPA       YGLLINE---WHLLARAVLVLDADNKITYVEYLDNINSEPNYDAAIEAVKVLG-------
TPX_STRR6       YALLINE---WHLLARAVFVLDTDNTIRYVEYVDNINSEPNFEAAIAAAKAL--------
TPX_STRPN       YALLINE---WHLLARAVFVLDTDNTIRYVEYVDNINSEPNFEAAIAAAKAL--------
TPX_STRP2       YALLINE---WHLLARAVFVLDTDNTIRYVEYVDNINSEPNFEAAIAAAKAL--------
TPX_STRA5       YALLMNE---WHLLTRAVLILDEHNKVTYTEYVDNVNSDVDYEAAINAAKILP-------
TPX_STRA3       YALLMNE---WHLLTRAVLILDEHNKVTYTEYVDNVNSDVDYEAAINAAKILP-------
TPX_STRMU       YGLLINE---LHLLGRAVFVLDEDNKITYLEYLDEMTNHPNYDAALAAVK----------
TPX_CLOAB       TGTYIKE---LGLLARAVFVVDSSNKVTYANYLEEVSGYPNYDEVLQAAQAAK-------
TPX_HELPJ       YGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK----------
TPX_HELPY       YGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK----------
TPX_AQUAE       YGVLIGEGALKGILARAVFIIDKEGKVAYVQLVPEITEEPNYDEVVNKVKELI-------
TPX_CAMJE       YGVLINEGALEGLLARAVFVI-KEGKVAYKELVNEITEMPDIAKLDAFFGGSSCCGGCGC
                 .  :       :  *::.:    . : . : : :     :                   

TPX_ECOLI       -
TPX_ECO57       -
TPX_SHIFL       -
TPX_ECOL6       -
TPX_SHIDY       -
TPX_SALTY       -
TPX_SALTI       -
TPX_YERPE       -
TPX_PSEAE       -
TPX_HAEIN       -
TPX_PASMU       -
TPX_RALSO       -
TPX_MYCBO       -
TPX_MYCTU       -
TPX_CORGL       -
TPX_COREF       -
TPX_CHLTE       -
TPX_VIBCH       -
TPX_VIBC3       -
TPX_LEPIC       -
TPX_LEPIN       -
TPX_LISIN       -
TPX_LISMO       -
TPX_LISMF       -
TPX_BACHD       -
TPX_BACSU       -
TPX_OCEIH       -
TPX_STAAW       -
TPX_STAAC       -
TPX_STAAS       -
TPX_STAAR       -
TPX_STAAM       -
TPX_STAAN       -
TPX_STAHJ       -
TPX_STAS1       -
TPX_STAES       -
TPX_STAEQ       -
TPX_STRSA       -
TPX_STRGN       -
TPX_STRPA       -
TPX_STRR6       -
TPX_STRPN       -
TPX_STRP2       -
TPX_STRA5       -
TPX_STRA3       -
TPX_STRMU       -
TPX_CLOAB       -
TPX_HELPJ       -
TPX_HELPY       -
TPX_AQUAE       -
TPX_CAMJE       H