CLUSTAL format seed alignment for MF_00270

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS18_NEOSM       ------------------------------------------------------------
RS18_BDEBA       --------------------------------------------------------MKKT
RR18_CYACA       ------------------------------------------------------------
RR18_TUPAK       --------------------------------------------------------MRKY
RR18_OLTVI       ------------------------------------------------------------
RR18_STIHE       -----------------------------MGTSNTQKPQKQVPKRKKYKNLFSLKTKKKR
RR18_GNEPA       ----------------------------------------------MSKQSFDFKRYKPE
RR18_PLETE       ----------------------------------------------------MKQPLKNT
RR18_CHLVU       --------------------------------------------------MAGIQQKRKT
RR18_ZYGCR       ------------------------------------------------MKTFINKKVSLN
RR18_THAPS       ------------------------------------------------------------
RR18_PHATC       ------------------------------------------------------------
RR18_EMIHU       ------------------------------------------------------------
RR18_CRYJA       ------------------------------MKPSFRNTSPSFRNRSKPYFRNRSKPYFRN
RR18_GRATL       ------------------------------------------------------------
RR18_PELHO       -----------------------------MEIEESNLKWLRTEFIATKKPPEPKAPLQPP
RR18_CUSOB       --------------------------------------------------MDKITGPFRK
RR18_PSINU       ---------------------------------------------------------MKK
RR18_ANEMR       ---------------------------------------------------------MNR
RR18_STAPU       -----------------------------------------------------MKKFISR
RR18_ADICA       ---------------------------------------------------------MNK
RR18_CHAVU       ------------------------------------------------------MKKKPI
RR18_CHAGL       -----------------------------------------------------MKDLVNR
RR18_PHYPA       -----------------------------------------------------MKQAINK
RR18_HUPLU       ---------------------------------------------------------MNK
RR18_MAIZE       ----------------------MYISKQPFRKSKQPFRKSKQTFHKSKQPFRKFKQPFRK
RR18_CYCTA       ---------------------------------------------------------MNK
RR18_LOTJA       --------------------------------------------------MDKSKRLFLK
RR18_CUSRE       --------------------------------------------------MDKSKRPFIK
RR18_IPOPU       --------------------------------------------------MDKSKRPFLK
RR18_PINTH       -------------------------------------------MDKPKQSFRRHFKPIRR
RR18_PIPCE       --------------------------------------------------MDKTKRPLRK
RR18_EPIVI       ---------------------------------------------------------MYK
RR18_NEPOL       ------------------------------------------------------------
RR18_CHLAT       ------------------------------------------------------------
RR18_PYRYE       ------------------------------------------------------------
RR18_GUITH       ------------------------------------------------------------
RR18_RHDSA       ------------------------------------------------------------
RR18_OSTTA       ------------------------------------------------------------
RR18_CYAPA       ------------------------------------------------------------
RS18_SYNJA       ------------------------------------------------------------
RS18_TRIEI       ------------------------------------------------------------
RS18_SYNY3       ------------------------------------------------------------
RS18_SYNR3       ------------------------------------------------------------
RS18_THEEB       ------------------------------------------------------------
RS18_GLOVI       -----------------------------------------------------------M
RS18_SYNE7       ------------------------------------------------------------
RS18_MYCGE       ------------------------------MMINKEQDLNQLETNQEQSVEQNQTDEKRK
RS18_MYCPN       -------------------------------MMNNEHDNFQKEVETTTETTFNREEGKRM
RS18_DEIRA       ------------------------------------------------MTQQGNSGERKP
RS18_THET8       ----------------------------------------------------MSTKNAKP
RS18_CHLCH       ------------------------------------------------------MKPRAT
RS18_TROWT       --------------------------------------------------------MGYR
RS18_LEIXX       ---------------------------------------------------MAGKSSGDR
RS181_FRAAA      -------------------------------------------------------MPTRR
RS181_MYCS2      -------------------------------------------------MMAVKKSRKRT
RS181_SACEN      -------------------------------------------------------MRNEQ
RS182_MYCGI      -------------------------------------------------------MKRAR
RS181_MYCVP      -------------------------------------------------------MTARR
RS182_MYCUA      ----------------------------------------------------MKKKPRRT
RS182_MYCTU      -------------------------------------------------------MAAKS
RS182_MYCPA      ----------------------------------------------------MPKKPART
RS181_STRGG      -------------------------------------------------------MARQQ
RS182_MYCVP      -----------------------------------------------------MAKSSTK
RS182_RHOJR      -------------------------------------------------MAVKRAPSKKP
RS18_CORJK       ---------------------------------------------------MKRTNMKKA
RS18_RUBXD       --------------------------------------------------------MAKK
RS181_NOCFA      -------------------------------------------------------MPKAP
RS181_RHOJR      -------------------------------------------------------MPKPP
RS18_NOCSJ       ---------------------------------------------------------MAK
RS182_FRAAA      ------------------------------------------------------------
RS18_ACIC1       ---------------------------------------------------------MTK
RS182_STRAW      -------------------------------------------------------MPRKP
RS182_STRCO      ------------------------------------------------------MPRPRK
RS18_CUTAK       --------------------------------------------------------MAGP
RS18_SALTO       ---------------------------------------------MAPSARNRKPGARSM
RS18_BIFLO       --------------------------------------------------------MSRK
RS18_RENSM       ---------------------------------------------------------MAK
RS18_KINRD       ---------------------------------------------------------MAK
RS18_MYCMO       -----------------------------------------------------MKRIISK
RS18_WOLTR       --------------------------------------------MTKKRNNFNDSYVSVN
RS18_ANAPZ       -----------------------------------MSHGGKRRSGDGGSEGSSYSPLVYL
RS18_EHRRW       ------------------------------------MLKKGKKTGSNSSGGTAYSPLAYL
RS18_ORITB       ----------------------------------MTENIDTANIDAIKNKTLKRTANRAN
RS18_RICBR       -----------------------------------------MSKNNTSETITRKPMERAS
RS18_PELUB       ------------------------------------MPSKKRAGNKKKGSQSNFAKLSIF
RS18_BORBU       -----------------------------------MYKDRDTNQRDSRFENQQDGFKKNS
RS18_VESOH       ----------------------------------------------------MAKQIKRK
RS18_LEGPH       ------------------------------------------------------------
RS18_METPP       ----------------------------------------MPPPRGKGRFGKDKRPKRNT
RS18_COXBR       ------------------------------------------------------------
RS18_XYLFT       ------------------------------------------------------------
RS18_BORA1       ---------------------------------------------MAFFGKRKEKRKFTQ
RS182_CUPPJ      --------------------------------------------MAFIKRSDKKKKPFKK
RS18_POLAQ       ----------------------------------------------MAFGKKPDFKKKPA
RS18_PARXL       ---------------------------------------------MPRPTGKKFDKRRQQ
RS18_RALSO       --------------------------------------------MNKKQRDAKNKKRFQQ
RS18_THIDA       -------------------------------------------MGGKSGGKFAGKRRDSG
RS18_METFK       -----------------------------------------------------------M
RS18_CHRVO       -----------------------------------------------------------M
RS18_NITEC       ----------------------------------------------------------MA
RS18_NITMU       ----------------------------------------MARFISKRKDGKDKDKDKKA
RS18_BLOFL       ---------------------------------------------------------MSI
RS18_BLOPB       --------------------------------------------------------MESI
RS18_PSYWF       ------------------------------------------------------------
RS18_DICNV       ------------------------------------------------------------
RS18_FRATO       ------------------------------------------------------------
RS18_WIGBR       ------------------------------------------------------------
RS18_HALHL       ------------------------------------------------------------
RS18_BUCBP       ------------------------------------------------------------
RS18_PSEHT       ------------------------------------------------------------
RS18_ECOLI       ------------------------------------------------------------
RS18_METCA       ------------------------------------------------------------
RS18_SACD2       ------------------------------------------------------------
RS18_HYDCU       ------------------------------------------------------------
RS18_MAGMM       ---------------------------MRWMKIMSEDMKQEQSGEGRGGRGGPARPLASA
RS18_HYPNA       ------------------------------------------------MAQKINITNIPA
RS18_SPHAL       -----------------------------------------------------------M
RS18_JANSC       ----------------------------------------------------------MA
RS18_MARMM       -------------------------------------------------MSSGNISNLPA
RS18_BARBK       ---------------------------------------------------MSDINQNLA
RS18_RHORT       -------------------------------------------------------MMAAP
RS18_ACICJ       --------------------------------------MSDSIETAPVNTPAARRTAVGA
RS18_MYCGA       ----------------------------MSDITKQPANNISSDDKKEVAKASAKSSVEGA
RS18_MYCAP       ------------------------------------------------------MANFKK
RS18_RHOBA       ----------------------------------------------------MSTRSRAR
RS18_MYCPE       MEKKTTKKATASKTTTTKKAAAEKTEIKETKKTTTTKTSTAKKATTASVEKTEVKETKKS
RS18_SALRD       --------------------------------------------------------MADQ
RS18_UREP2       ------------------------------------------------------MAKVTN
RS18_FUSNN       ------------------------------------------------------------
RS18_MYCS5       ------------------------------------------------------MAYNKR
RS18_ARCB4       ------------------------------------------------------------
RS18_SULDN       -----------------------------------------------------------M
RS18_HELHP       ------------------------------------------------------------
RS18_CAMHC       ------------------------------------------------------------
RS18_CAMJ8       ------------------------------------------------------------
RS18_SULNB       ----------------------------------------------------------MA
RS18_NITSB       ------------------------------------------------------------
RS18_THEP1       ----------------------------------------------------------MA
RS18_THEM4       ----------------------------------------------------------MM
RS18_PSELT       -------------------------------------------------------MAQQQ
RS18_LEPIC       ------------------------------------------------------MEGKPQ
RS18_LEPBP       -----------------------------------------MEDDEKGGFRGKDGEGKFG
RS18_AQUAE       ---------------------------------------------------------MVV
RS18_ANADF       MARPDMGGPKSSGGFGGPRSGGGFGGGGYGGGGGGGGGYGGGGGGGFGGRGGDRGDRGDR
RS18_MYXXD       -------------------------MSNGTDSKTASAPPARSGGGFGGGGSRGGDRGDRG
RS18_MYCPU       -----------------------------------------------------MNHNKDK
RS18_MYCHJ       ------------------------------------------------------------
RS18_UNCTG       --------------------------------MTFIRKPAGQAKPQKYSTDAYGRPAGKF
RS18_DESAG       ---------------------------------------------------------MAF
RS18_SYNAS       ------------------------------------------------MAYERRSRPSGP
RS18_DEHM1       ----------------------------------------------MSIQERPNRPARGG
RS18_KORVE       --------------------------------MADETTVSTPAASGTETPSTGGGGAPQG
RS18_SOLUE       -----------------------------------MAESKGRPGSASQRPTGGDKAIAGQ
RS18_SORC5       -------------------------------MNGRNNDMGRNGGADYDDRDFGRTPDLNA
RS18_PELCD       ----------------------------------------------MAERTTSGTPAKRS
RS18_GEOSL       ----------------------------------MSEERTERPERTERPERPQQRGSGPR
RS18_PELPD       -------------------------------------------MANERPTSQQRPAGGPR
RS18_GEOUR       ----------------------------------------------MSDERTPQRSSGPR
RS18_DESPS       -------------------------------------------------------MAPRP
RS18_NATTJ       ------------------------------------------------------------
RS18_CALS8       ------------------------------------------MTNQNQSQTQTTQTVEKV
RS18_CALS4       --------------------------------------------MTTANTNETAAAAAAK
RS182_ROSS1      -----------------------------------------------MTEDQARRSGGVG
RS18_SYNFM       -------------------------------------------------------MAIRR
RS18_CLOD6       ----------------------------------------------------------MM
RS18_HELMI       ------------------------------------------------MQDRGDKPERRS
RS18_LACP7       ----------------------------------------------------------MK
RS18_ALKMQ       ---------------------------------------------------------MVN
RS18_ALKOO       -------------------------------------------------------MMENN
RS18_HUNT2       ---------------------------------------MSTPKKDKNNKEVDKTDVKTP
RS18_MOOTA       ------------------------------------------------------------
RS18_SYMTH       ---------------------------------------------------------MRR
RS18_CARHZ       ---------------------------------------------------------MKK
RS18_PELTS       ---------------------------------------------------------MKR
RS18_DESAP       ----------------------------------------------------------MK
RS18_DESHY       ---------------------------------------------------------MKR
RS18_DESRM       ---------------------------------------------------------MKR
RS18_CLOPS       -------------------------------------------------------MSNVK
RS18_CLOB8       --------------------------------------------------MSREEGNNGR
RS18_CLOAB       ----------------------------------------------MARDNGNKDRDGKR
RS18_CLONN       -------------------------------------------------------MALNK
RS18_CHLPN       -------------------------------------------------------MNKPV
RS18_CHLAA       ------------------------------------------------------MSRSRA
RS18_CYTH3       -----------------------------------------------------MTLQNES
RS18_PORGI       ----------------------------------------------MAANNQGEIRYLTP
RS18_FLAPJ       --------------------------------------MSTLQQSASGKKDGDIRYLTPL
RS18_GRAFK       -------------------------------------MATSIEQQAKGKKDGEIRYLTPL
RS18_TREDE       --------------------------------------------MEANMQENIREGEDKR
RS18_TREPA       ----------------------------------MAEDHPSVDLDTHLSSPRESEESAPK
RS181_ROSS1      ------------------------------------------------------MTYQDG
RS18_PARUW       ------------------------------------------------MLQRKPKYNSDY
RS18_LEUMM       -----------------------------------------MSEQNSRPQNSERPQRSRR
RS18_OENOB       -------------------------------MAEEHSNQRSQTFNGERTNRPSRKPRGDG
RS18_MESFL       ---------------------------------------------------------MAM
RS18_ONYPE       ------------------------------------------------------MKFNNK
RS18_ACHLI       -----------------------------------------------------MQDRKNR
RS18_BACHD       ----------------------------------------------------------MA
RS18_OCEIH       ---------------------------------------------------------MAA
RS18_STAHJ       -------------------------------------------------------MAGGP
                                                                             

RS18_NEOSM       ----------------------MAPVDV---ESQV--------------ELDLKI-----
RS18_BDEBA       T---------------------RSKYRQ---------------------EFSGDH---V-
RR18_CYACA       -------------------------MNK---KIKI--------------PKDSKA-----
RR18_TUPAK       N---------------------PRKIKN---KVNI--------------PIVLHK--AN-
RR18_OLTVI       ----------------------MKNIKN---SPKL--------------QLKSTGTPFQ-
RR18_STIHE       G---------------------KKFSKR---KKGGTLTLPVIPPKSIFILL---K--SR-
RR18_GNEPA       A---------------------PSGSRKRPLKKFKK-------------PIRIKS---E-
RR18_PLETE       K---------------------RSNYKRKKRERVIALIPTKTNLTSPDKSLTPLP---K-
RR18_CHLVU       I---------------------KSFKTR---RKVV--------------PVLIPK--KG-
RR18_ZYGCR       K---------------------RITFRR---RRRK--------------PVQPGE---R-
RR18_THAPS       ----------------------MLAQKQ---------------------KLAPIG--IN-
RR18_PHATC       -----------------------MVSKK---QKLS--------------PISLNQ-----
RR18_EMIHU       ------------------------MYKN---PIKA--------------NLGEEV---N-
RR18_CRYJA       R---------------------SKPSFRNTSKRFSPNQQSFRK------RLSTIR--PG-
RR18_GRATL       ----------------------MIFYKQ----RNA--------------HLKPNE---T-
RR18_PELHO       L---------------------PPSKRKGKPPKSP--------------RRRSSRIKPG-
RR18_CUSOB       S---------------------KKSFRK---------------------PLPPIQ--SG-
RR18_PSINU       S---------------------ERSSRK---RLSA--------------TVTSDL-----
RR18_ANEMR       S---------------------KKNSRK---------------------RLPAIR--SG-
RR18_STAPU       P---------------------KRSSRR---RKKT--------------PIKPGE-----
RR18_ADICA       S---------------------RHSSRR---RSPS--------------IRSDET-----
RR18_CHAVU       Q---------------------KQRSRR---------------------RLPPIK--SG-
RR18_CHAGL       S---------------------KRMSRR----RLA--------------PI---R--AG-
RR18_PHYPA       S---------------------KRSSRR----RLP--------------PI---R--SG-
RR18_HUPLU       S---------------------KRSFRR---------------------RLPPIR--SG-
RR18_MAIZE       S---------------------KQPFRK---SKQP--------------FRRRSRIGPG-
RR18_CYCTA       S---------------------KRSFRR---------------------RLPPIG--SR-
RR18_LOTJA       S---------------------KRFFRR---------------------RLPPIQ--SG-
RR18_CUSRE       S---------------------KRSFRR---------------------RLPPIK--SG-
RR18_IPOPU       S---------------------KRSFRR---------------------RLPPIQ--SG-
RR18_PINTH       R---------------------FKPIRRYLKPIRR--------------HLSPIR--SG-
RR18_PIPCE       S---------------------KRSFRR----RLP--------------PPIGSG-----
RR18_EPIVI       F---------------------KRSFRR---------------------RLSPIG--SG-
RR18_NEPOL       ----------------------MIKFSR---RRLA--------------KLANAQ--ID-
RR18_CHLAT       ----------------------MNLSRR---------------------RVSPIK--PG-
RR18_PYRYE       ----------------------MAIYRN---------------------RISPIK--PT-
RR18_GUITH       ----------------------MAIFRR----KNS--------------PIKKDD---F-
RR18_RHDSA       ----------------------MAIYRR---------------------KASPIK--IG-
RR18_OSTTA       -----------------------MNFTR---QRTS--------------PIHAGE---I-
RR18_CYAPA       ----------------------MSVYRR----RLS--------------PLKPNQ---V-
RS18_SYNJA       ----------------------MVYARR---------------------RLSPIK--PG-
RS18_TRIEI       ----------------------MANYYR---KRVS--------------PIKPGD-----
RS18_SYNY3       ----------------------MNYYRK----RLS--------------PLPPNQ---P-
RS18_SYNR3       ---------------------MPPSFFK---KRLS--------------PIKPGD---P-
RS18_THEEB       ----------------------MAFYRR----RIS--------------PIPPGQ---P-
RS18_GLOVI       T---------------------SFGYRG---KRVS--------------PIPPKD-----
RS18_SYNE7       ----------------------MSYFRR---------------------RLSPIK--PS-
RS18_MYCGE       P---------------------KPNFKR--AKKYC--------------RFCAIGQLRI-
RS18_MYCPN       V---------------------RPLFKR--SKKYC--------------RFCAIGQLRI-
RS18_DEIRA       R---------------------GKGPKRPRKPKVD--------------PFSIGE---L-
RS18_THET8       K---------------------KEAQRRPSRKAKV--------------KATLGE---F-
RS18_CHLCH       S---------------------SHGYKAQGNKALNGALTSKK-------KVSKNQ---V-
RS18_TROWT       A---------------------KGRRQP---KADS--------------VVAPPKRVSI-
RS18_LEIXX       R---------------------KPIRKGKDGKNAA--------------PAKSVR---V-
RS181_FRAAA      T---------------------PKPGQR---KKPN--------------ILRERG---I-
RS181_MYCS2      A---------------------ATELKK---PRRN--------------QLEALG---V-
RS181_SACEN      R---------------------RGGQRR---GKPN--------------LLQRAG---V-
RS182_MYCGI      R---------------------AAPLPK---KRRN--------------MFAQLG---I-
RS181_MYCVP      R---------------------EAAPAK---KRRN--------------LLKSLG---I-
RS182_MYCUA      R---------------------RPIAAPATPAKKN--------------LLDSLG---V-
RS182_MYCTU      A---------------------RKGPTK---AKKN--------------LLDSLG---V-
RS182_MYCPA      R---------------------RPAPLAGRARKKN--------------LLDSLG---L-
RS181_STRGG      E---------------------PRKPFK---SRPN--------------PLDAAE---I-
RS182_MYCVP      R---------------------RPAPEKPVKTRKC--------------VFCSKK-GKN-
RS182_RHOJR      R---------------------PVEGRK---PKKN--------------PLFAAK---I-
RS18_CORJK       R---------------------MEQSRR---PKKN--------------PLKAEG---I-
RS18_RUBXD       K---------------------GGATTRSGKKKVC--------------VFCKEN---I-
RS181_NOCFA      A---------------------REKVLK---KKAC--------------TFCKESKSGN-
RS181_RHOJR      L---------------------RDKVMK---KKIC--------------IFCKEK---N-
RS18_NOCSJ       A---------------------VIRKPK---KKVC--------------QFCKEK---A-
RS182_FRAAA      ----------------------MRKPKK----KVC--------------VFCKDK---V-
RS18_ACIC1       A---------------------PARKPK---KKVC--------------VFCKEG---I-
RS182_STRAW      V---------------------RKVAST---PRPN--------------PLDQNG---I-
RS182_STRCO      A---------------------DRTPAR---QRPN--------------PLDRDG---V-
RS18_CUTAK       Q---------------------RKSVNK---KKVV--------------PIKTVH---I-
RS18_SALTO       A---------------------KAAALRKPKKKVN--------------PLDKDG---I-
RS18_BIFLO       R---------------------PQPPVKPFKKKPN--------------PLKAAK---V-
RS18_RENSM       A---------------------EIRKPK---PKSN--------------PLKAAD---I-
RS18_KINRD       V---------------------PVRKPK---KKQN--------------PLKAAK---I-
RS18_MYCMO       K---------------------SNRIFK---PKPC--------------FFHVEK---I-
RS18_WOLTR       N---------------------RTGFKR---SKVC--------------PLATSQ---D-
RS18_ANAPZ       K---------------------RPYFRK---SRSC--------------PLAQCP---D-
RS18_EHRRW       K---------------------RPYFRR---SKAC--------------PLEQCA---N-
RS18_ORITB       K---------------------EVFFRR---RKGC--------------PLSAPD-GTA-
RS18_RICBR       K---------------------KVFFRR---RKGC--------------PLSVPN---A-
RS18_PELUB       Q---------------------PNKYKF---KKTC--------------PLSAKG---A-
RS18_BORBU       N---------------------FRFFKR---KS-C--------------KFCDSG-----
RS18_VESOH       R---------------------RPQIKI---NTFC--------------RFTAAG---V-
RS18_LEGPH       M---------------------SAYFRR---KKMC--------------RFSAEG---G-
RS18_METPP       Q---------------------SLLFRR---KRFC--------------RFTVTG---V-
RS18_COXBR       -----------------------MSFRR---KKFC--------------AFDAKN---L-
RS18_XYLFT       ---------------------MSKFFRR---RKFC--------------KFTAEG---I-
RS18_BORA1       Q---------------------NPLFKR---RKFC--------------RFTAAG---V-
RS182_CUPPJ      E---------------------SSLFKR---KRYC--------------RFTVAG---V-
RS18_POLAQ       Q---------------------NPLFKR---KRYC--------------RFTVAG---V-
RS18_PARXL       Q---------------------NPLFKR---KKFC--------------RFTAAG---V-
RS18_RALSO       Q---------------------NPLFKR---KKFC--------------RFTVAG---V-
RS18_THIDA       N---------------------RGLFKR---RKFC--------------RFTAEK---V-
RS18_METFK       A---------------------RDMFKR---RRYC--------------RFSAEG---I-
RS18_CHRVO       A---------------------RQLFKR---KKFC--------------RFTAEG---I-
RS18_NITEC       N---------------------RPLFKR---KKFC--------------RFTAEG---I-
RS18_NITMU       N---------------------RPLFKR---RKFC--------------RFTAEG---I-
RS18_BLOFL       L---------------------PRYIRH---RKFC--------------RFTADK---C-
RS18_BLOPB       M---------------------ARFVRH---RKFC--------------RFTAEK---C-
RS18_PSYWF       ---------------------MARFYRR---RKFC--------------RFTAEG---I-
RS18_DICNV       ------------------------MARR---KRIC--------------RFTAEG---V-
RS18_FRATO       -------------------------MSR---RKVC--------------RFTVEG---V-
RS18_WIGBR       ---------------------MIRNFRR---RKFC--------------RFTLEK---I-
RS18_HALHL       ---------------------MGRFFRR---RKYC--------------KFTAEG---V-
RS18_BUCBP       ---------------------MVRYFRR---RKFC--------------RFTVEK---I-
RS18_PSEHT       ---------------------MARYFRR---RKFC--------------RFKAEG---V-
RS18_ECOLI       ---------------------MARYFRR---RKFC--------------RFTAEG---V-
RS18_METCA       ---------------------MVRQFKR---RRYC--------------RFTAED---V-
RS18_SACD2       ---------------------MARFFRR---RKFC--------------RFTAEG---V-
RS18_HYDCU       ---------------------MARGFGR---KKFC--------------RFTVEG---V-
RS18_MAGMM       R---------------------RPFFRR---RKVC--------------PFCADK---G-
RS18_HYPNA       R---------------------RPFGRR---RKVD--------------PFTGQH---A-
RS18_SPHAL       A---------------------RPFFRR---RKTC--------------PFSAKD---A-
RS18_JANSC       A---------------------KPFFRR---RKTD--------------PFEGEN---A-
RS18_MARMM       R---------------------RPFMRR---RKVC--------------PFSGEN---A-
RS18_BARBK       R---------------------RPFNRR---RKTC--------------PFSGTN---V-
RS18_RHORT       R---------------------RPFFRR---RKTC--------------PFSGAG---A-
RS18_ACICJ       R---------------------RPFYRR---RKAC--------------PFSGPN---A-
RS18_MYCGA       K---------------------RKTFYKSRSRKLC--------------HFCAKG---I-
RS18_MYCAP       V---------------------KKGRNL---RRKC--------------ELCETN---I-
RS18_RHOBA       K---------------------RSRVRSRTRRKDP--------------IFVDGHRPRP-
RS18_MYCPE       SDNKKEFNPQDRPFAKYNRGYPNKQGRR---KKFC--------------KLCAKG---Q-
RS18_SALRD       N---------------------DVDYEH------------------------------L-
RS18_UREP2       N---------------------RNRKPR---KKVC--------------ILSAKG---I-
RS18_FUSNN       -----------------------MAEFR---RRRA--------------KLRVKA-----
RS18_MYCS5       K---------------------KGYHNK---KRTC--------------HFCDNK---L-
RS18_ARCB4       ----------------------MAERRK-YGKKYC--------------KYTEMK---V-
RS18_SULDN       A---------------------ERRKYK---KRYC--------------KYCEAK---V-
RS18_HELHP       ---------------------MEKKKYS---KRYC--------------RYTEAK---L-
RS18_CAMHC       ----------------------MADKRK-YTRKYC--------------KFTEAK---I-
RS18_CAMJ8       ----------------------MAEKRK-YSRKYC--------------KYTEAK---V-
RS18_SULNB       E---------------------RRKFKK----RFC--------------KYCEQK---V-
RS18_NITSB       ----------------------MAEKRR-FKKRTC--------------KYCEQK---V-
RS18_THEP1       Y---------------------KRKRKK---VKKC--------------RLCEME---L-
RS18_THEM4       K---------------------YRRKKK---PKVC--------------KLCQSK---I-
RS18_PSELT       K---------------------KRRKRK---VKKC--------------KLCEMK----V
RS18_LEPIC       R---------------------KQNKYK---KKVC--------------RFTADP-ELA-
RS18_LEPBP       R---------------------KNAKYK---KKVC--------------KFCADK-ALL-
RS18_AQUAE       R------------------------APK---KKVC--------------MYCEQK-----
RS18_ANADF       D-------------DRGGEEGGRRGFGR---RKVC--------------RFCADK---T-
RS18_MYXXD       DRGGDRGDRGGGLGGDDDKRGGGRGFGR---KKVC--------------RFCAEK---N-
RS18_MYCPU       L---------------------KKKNKR---KRVS--------------FLDEQG---I-
RS18_MYCHJ       ---------------------MNKKYAKKFKKKPC--------------QFCEAK---L-
RS18_UNCTG       R---------------------RNGPIR---KKVC--------------RFCADK-----
RS18_DESAG       K---------------------KRFTPR---RKFC--------------RFCADK---D-
RS18_SYNAS       R---------------------KKFFHR---RKYC--------------KFCSDS---T-
RS18_DEHM1       R---------------------GRYTPK---RKIC--------------SFCAEK---V-
RS18_KORVE       RPQGGPRGDRGPRPGGSGRDGGRKFFRR---KKVC--------------KFCVEK---I-
RS18_SOLUE       K---------------------KQYFRR---KKVC--------------RFCVEK---I-
RS18_SORC5       D---------------------APGRRRTGRKRVC--------------RYCADK---A-
RS18_PELCD       V---------------------RRRFSR---RKGC--------------RFCADN---T-
RS18_GEOSL       K---------------------RRPFQR---RKVC--------------RFCADK---T-
RS18_PELPD       K---------------------RRPFQR---RKVC--------------RFCAEK---N-
RS18_GEOUR       K---------------------KRPFQR---RKVC--------------RFCADK---Q-
RS18_DESPS       Q---------------------KKLFTR---KKVC--------------RFCADK---E-
RS18_NATTJ       ---------------------MARRRRR---NKVC--------------SFCAEK---T-
RS18_CALS8       S---------------------SRQKKK---KRVC--------------SFCVER---I-
RS18_CALS4       N---------------------RRNKKK---KRVC--------------AFCADN---I-
RS182_ROSS1      R---------------------RRFGAR---RKVC--------------MFCADQ---I-
RS18_SYNFM       R---------------------RRTFHR---RKVC--------------RFCVDS---E-
RS18_CLOD6       N---------------------KKRRKK---KRVC--------------QFCADK---N-
RS18_HELMI       R---------------------KGRRPR---RRIC--------------FFCVDK---I-
RS18_LACP7       R---------------------RMTRRR---KKVC--------------AFCADK--NH-
RS18_ALKMQ       R---------------------RRKKMK---KKVC--------------TFCADK---S-
RS18_ALKOO       K---------------------RKRKAR---KKIC--------------VFCADK---S-
RS18_HUNT2       V---------------------KVRRAK---KKIC--------------AFCVDK---V-
RS18_MOOTA       ----------------------MRRDKKRSRKRVC--------------SFCVDK---I-
RS18_SYMTH       E---------------------RGRRAR---RRVC--------------SFCVDK---I-
RS18_CARHZ       E---------------------KGSRRK---KRVC--------------AFCVDK---I-
RS18_PELTS       E---------------------KGRRGK---KRIC--------------NFCVDK---A-
RS18_DESAP       R---------------------DRGRRK---KKIC--------------SFCVDK---I-
RS18_DESHY       E---------------------RGRRPR---KRVC--------------SFCVDK---V-
RS18_DESRM       E---------------------RGRRGR---KRVC--------------SFCVDK---A-
RS18_CLOPS       R---------------------GGKFRR-ARKKVC--------------IFCVDK---A-
RS18_CLOB8       R---------------------PGGKMRRSRKKVC--------------AFCVDK---A-
RS18_CLOAB       P---------------------NGGRNRKMKRKIC--------------SFCMEK---S-
RS18_CLONN       K---------------------GAKRRR---KKVC--------------AFCADK---S-
RS18_CHLPN       H---------------------NNEHRRKRFNKKC--------------PFVSAG---W-
RS18_CHLAA       S---------------------GRPRSR---RREC--------------EFTKLG---I-
RS18_CYTH3       I---------------------NRVENR---KKYC--------------RFKKMG---I-
RS18_PORGI       L---------------------SVDTKK---KKYC--------------RFKKSG---I-
RS18_FLAPJ       N---------------------IDTNKT---KKYC--------------RFKKSG---I-
RS18_GRAFK       N---------------------IETTKA---KKYC--------------RFKRSG---I-
RS18_TREDE       K---------------------GRSFYR---KKVC--------------RFCAQK-----
RS18_TREPA       K---------------------NRQFYR---KKVC--------------RFCTQK-----
RS181_ROSS1      S---------------------RRMRGRGGRKKVC--------------EFSRLG---I-
RS18_PARUW       S---------------------DARSKK---RKRC--------------PFTAAG---I-
RS18_LEUMM       P---------------------QGGPRR---RRKV--------------DFIAAN--HI-
RS18_OENOB       E---------------------RRGRRQGGRRRVD--------------YLAVNH---I-
RS18_MESFL       K---------------------KFVKKR---KKVN--------------FFAKNK---I-
RS18_ONYPE       K---------------------NTFKKR---RKVC--------------FFTENK---V-
RS18_ACHLI       A---------------------GGFRKR---KKVC--------------FFTQNK---F-
RS18_BACHD       R---------------------RGRPKR---RKVC--------------YFTVNK---I-
RS18_OCEIH       R---------------------RGRAKR---RKVC--------------YFTANG---I-
RS18_STAHJ       R---------------------RGGRRR---KKVC--------------YFTANG---I-
                                                                             

RS18_NEOSM       ED-------------FDYKNVALIKRFMTPVGRVLSRRATGLSAKKQRKMAKEVRKMKFL
RS18_BDEBA       ---------------FDYKDPASLTRFIGDGGKITPSRISKLSVAQQKRVAAAVKKSRNL
RR18_CYACA       ---------------INYKTTDLIREFISDRGKIIPQRITKSTRKKHKLIEKAIKQARLI
RR18_TUPAK       ST------IPFVQGTVDYKNVALLRKYISAEGKILSRRLTRLTSKQQRHISTAIKTARIA
RR18_OLTVI       GT-------------VDYKNIALLRKYISTEGKILPRRITGLTAKQQRAVAKAIKNARMV
RR18_STIHE       NK------KIYDRKIIDYKNRSLLQEYIYFTGKIIPKRKTGITTKQQRYLTKAIKTARIL
RR18_GNEPA       DQ-------------INYKNVSLINGFISQRAKILSRKVTKLTWKQQRLMSVAIKRARIL
RR18_PLETE       EI-------------IDYKNVILLRNGITAEGKIFPRRFTKLNAKQQRYMSKAIKNARMV
RR18_CHLVU       QAVISNTGEPASRYIIDYKNTQLLVKFISPQGKILSRRATGLTAKQQRIMANAIKRARMG
RR18_ZYGCR       ---------------IDYKNLRLLCRFVSKQAKILSRRVSRLTSKQQRTVARYIKSARVL
RR18_THAPS       QK-------------IDYKDIDLLKLFITEQGKILPRRATGVTVQQQRQLAKAIKRARIL
RR18_PHATC       -N-------------IDYKDIDLLTLFVTEQGKILPRRATGVTVQQQRRLAKAIKRARVL
RR18_EMIHU       NS-------------LNYKDVSILSNFVNEQGKILPRRLTGLKSKQQKKVTKLIKQARIA
RR18_CRYJA       EQ-------------IDYKNISLINRFISEQGKILSRRTNRLALKQQRLIARAVKQARIL
RR18_GRATL       ---------------INYKDIDLLRKFITDQSKIVSRRSNGLTVKQQKQLAKSIKKARIL
RR18_PELHO       DL-------------IDYRNISLIGRFISQQGKILSRRVNRVTLKQQRRLTIAIKQARIL
RR18_CUSOB       DR-------------IDYQNIDVLRRFISQQGKILSRRVNRLTLKQQRLLNLAIKQARIL
RR18_PSINU       ---------------IDYKNIDLLRRFISERGKILSRRMTKLTSKQQRSVTVSIKRARIL
RR18_ANEMR       EF-------------IDYRNISLLRRFVSEQGRILSRRTNRLTSKQQRVLTAAIKQARIL
RR18_STAPU       -N-------------IDYKNVGLLRKFISEQGKILSKRITRLTSKQQRAMTKAIKSARIL
RR18_ADICA       ---------------IDYKNTSLLRRFVSEQGKILSRRMNRLTSKQQRLIATAIKRARIL
RR18_CHAVU       EK-------------IDYKNLDLLRRFLSEQGKILSKRVNRLTSKQQRTMTIAIKRARIL
RR18_CHAGL       ES-------------IDYKNVGLLRRFISEQGKILSRRVNRLTAKQQRNMTKAIKRARIL
RR18_PHYPA       EI-------------IDYKNINLLRRFISEQGKILSRRMNRLTSKQQRLMTIAIKRARVL
RR18_HUPLU       ET-------------INYRNISLLRRFISEQGKILSRRMNRLTSKQQRLITVAIKRARIS
RR18_MAIZE       DR-------------IDYRNMSLINRFISEQGKILSRRINRLTLKQQRLITLAIKQARIL
RR18_CYCTA       DQ-------------IDHKNMSSISQFISERGKILSGRVSRLTPKQQRLMTIAIKRARIP
RR18_LOTJA       DR-------------IDYKNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARIL
RR18_CUSRE       DR-------------IDYRNISLISRFLSEQGKILSKRVHRFTLKQQRLITLAIKQARIL
RR18_IPOPU       DR-------------IDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITLAIKQARIL
RR18_PINTH       DR-------------IDYKNMSLISRFISEQGKILSGRVNRLTSKQQRLMTNAIKRARIL
RR18_PIPCE       DR-------------IDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARIL
RR18_EPIVI       NL-------------IYYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARIL
RR18_NEPOL       DR-------------IDYKNVDLLRQFLTEEGKILPRRVTGLTAKQQRGMTRAIKQARIM
RR18_CHLAT       ET-------------IDYKNIDLLSQFITEQGKILPRRVNGISAKQQRAITKAIKQARFL
RR18_PYRYE       DA-------------VDYKDIDLLRKFITEQGKILPKRSTGLTSKQQKKLTKAIKQARIL
RR18_GUITH       ---------------IDYKDVELLSKFLTEQGKILPRRITGLTMKQQSRLTKAVKRARIL
RR18_RHDSA       DA-------------IDYKDVELLSNFLTEQGKILPKRLTGLTNKQQNKVTKAIKRARML
RR18_OSTTA       ---------------ISYKNVDLLRRFITEQGKILPRRLTGVTAKEQRQLAKAIKQARIL
RR18_CYAPA       ---------------IDYQDVELLRTFITDQGKILPRRVTGLTAKQQRAVTKAIKQARVL
RS18_SYNJA       EP-------------IKYTDVELLKKFVTERGKILPRRITGLTAKQQRQVSKAIKQARIL
RS18_TRIEI       -P-------------IDYKDVELLKKYITERGKIMPRRITGLTSKQQRDLTKSIKRARLV
RS18_SYNY3       ---------------IDYKDTELLRKFITERGKILPRRITGLTAKQQRDLTTAVKRSRLV
RS18_SYNR3       ---------------IDYKDTDLLKKFITERGKLLPRRMTGLTARQQRDLTNSVKRARIV
RS18_THEEB       ---------------IDYKDVDLLRRFITERGKILPRRVTGLTAKQQRQLAVAIKRARIM
RS18_GLOVI       -K-------------IDYKEVDLLRKFITERGKILPRRITGLTAKQQRDLTVAIKRARLL
RS18_SYNE7       DP-------------IDYKDVDLLRKFITERGKILPRRITGLTARQQRDLAVAIKRARIL
RS18_MYCGE       DF-------------ID--DLEAIKRFLSPYAKINPRRITGNCNMHQRHVANALKRARYL
RS18_MYCPN       DL-------------ID--DLEALKRFLSPYAKINPRRITGNCQMHQRHVAKALKRARYL
RS18_DEIRA       EI-------------TDYKDVKMLRRFVSDTGKILPRRRTGLSAKHQRRIAQTIKVARQL
RS18_THET8       DL-------------RDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARIL
RS18_CHLCH       VF-------------FDYRDERKLKRFINDQGKIIPRRITGLSAKEQNLLTHSVKWARFL
RS18_TROWT       KG-------------LDYKDLASLKRFLSDRGKIRARRVTGASIQQQRQIAKAIKNAREM
RS18_LEIXX       GV-------------IDYKDVATLRKFISERGKIRALRITGVSVQEQRLIARAVKNAREM
RS181_FRAAA      TY-------------VDYKDVALLRQFISDRGKIRARRITGLTPRQHREVTRAIKNAREM
RS181_MYCS2      TT-------------IDYKDVAVLRTFLSERGKIRSRHVTGLTPQQQRQVATAIKNAREM
RS181_SACEN      VQ-------------VDWKDTDLLRRFISDRGKIRSRRVTGLTMQEQREVATAIKNAREM
RS182_MYCGI      ER-------------VDYKDTSTLRQFLSERGKIRSRTVTGLTVQQQRQVTIAVKNAREM
RS181_MYCVP      ER-------------VDYKDTSTLRQFISERGKIRSRSVTGLTVQQQRQVTTAVKTAREM
RS182_MYCUA      SE-------------VDYKDISRLRTFISDRGKIRSRRVTGLTVQQQRQIATAIKNAREM
RS182_MYCTU      ES-------------VDYKDTATLRVFISDRGKIRSRGVTGLTVQQQRQVAQAIKNAREM
RS182_MYCPA      RT-------------VDYKDTATLRVFISERGKIRSRQVTGLSVQQQRQVATAIKNAREM
RS181_STRGG      TY-------------IDYKDTDLLRRFVSDRGKIRGRRVTRISARQQRQVAAAIKNAREM
RS182_MYCVP      QD-------------IDYKDTQLLRTYISERGKIRARRVTGNCVQHQRDIAIAVKNAREV
RS182_RHOJR      EH-------------VDYKDINLLRTFISDRGKIRSRRVTGLTPQQQRQVAVAVKNAREM
RS18_CORJK       ET-------------VDYKNYDLLRKFISERGKIRSRRVTGLTPQQQRQVATAVKNAREM
RS18_RUBXD       EY-------------VDYKDYNMLRRFTSERGKIRARRVTGLCPQHQRETARAIKRAREM
RS181_NOCFA      VS-------------IDYKDTTLLRKYVSDRGKIRARRVTGNCVQHQRDIAVAVKNSREV
RS181_RHOJR      TQ-------------INYKDTTLLRKYVSDRGKIRARRVTGNCVQHQRDVAIAVKNSREV
RS18_NOCSJ       TG-------------VDYKDTALLRKFISDRGKIRARRVTGNCVQHQRDVAIAVKNAREV
RS182_FRAAA      EY-------------IDFKDTSLLRKYISDRGKIRARRVSGNCSQHQRDVATAVKNSREM
RS18_ACIC1       TY-------------VDYKDTNLLRKFISDRGKIRARRVTGNCAQHQRDVATAIKNSREM
RS182_STRAW      TY-------------IDYKDTDLLRKFLSDRGKIRSRRVTRVTAQQQRLLARAVKNAREM
RS182_STRCO      TY-------------VDYKDTELLRKFVSDRGKIRSRRVTRVTSQQQRQLARAIKNAREM
RS18_CUTAK       GA-------------VDYKDTALLRKFISERGKIRARRVTGLSVQDQRKVAIAIKNAREL
RS18_SALTO       TY-------------IDYKDTALLRKFISDRGKIRARRVTGVTSQQQRQIARAVKNAREM
RS18_BIFLO       TE-------------IDYKDVALLRKFISDRGKIRSRRITGVTVQEQRELSKAIKNAREM
RS18_RENSM       TV-------------IDYKDVALLRKFISDRGKIRARRVTGVTVQEQRKIAQAIKNAREV
RS18_KINRD       EA-------------VDYKDTALLRKFISDRGKIRARRVTGVSVQEQRQIAKAIKNAREM
RS18_MYCMO       KY-------------IDYKDVELVSKYINNHGKILSSKITGNCAKHQRLISNVIKRARIM
RS18_WOLTR       ED-------------IDYKNTDLLSRFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFL
RS18_ANAPZ       ED-------------IDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLLARAIKRARYL
RS18_EHRRW       ED-------------IDYKNKALLSKFTSEYGRILPSRITSVSSRKQRLLSTAIKRARYL
RS18_ORITB       PI-------------ITYKDPDLLSKFISECGRVLPARVTNVCRSKQRELTKAIKIAREL
RS18_RICBR       PV-------------IDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARIL
RS18_PELUB       PE-------------VDYKNIRLLKKYMSENGKILPSRITNVSQKKQRELSLSIKRARNL
RS18_BORBU       KH-------------PDYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYM
RS18_VESOH       TK-------------IDYKDIDILLKNIDESGKITPSRMTGTSAKFQRKLTTAIKRARFL
RS18_LEGPH       NE-------------IDYKDINLLKNYITETGKIVPSRITGTQTRFQRQLAKAIKHARFI
RS18_METPP       TE-------------IDYKDVDTLRDFIAENGKITPARLTGTRAFFQRQLSTCIKRARFL
RS18_COXBR       QE-------------IDYKDVNTLKDYIMESGRVVPSRITGTCAKHQRQISRAIKLARYL
RS18_XYLFT       KE-------------IDYKDLNTLRQYLTENGRIVPSRVTGTKSKYQRQLTTAVKLARFL
RS18_BORA1       EE-------------IDYKDLDTLRDFVQENGKIIPARLTGTRAIYQRQLDSAIKRARFL
RS182_CUPPJ      EQ-------------IDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLNTAIKRARFL
RS18_POLAQ       EQ-------------IDYKDVDTLKDFIGENAKITPARLTGTKAKYQRQLDTAIKRARYL
RS18_PARXL       DH-------------IDYKDLETLKDFIGENGKITPARLTGTKSHYQRQLDTAIKRARFL
RS18_RALSO       EQ-------------IDYKDLDTLKDFIGENGKITPARLTGTRSHYQRQLDTAIKRARFL
RS18_THIDA       VE-------------VDYKDVDVLKEFIAENGRIIPARITGTKAHYQRQLGTAIKRARFL
RS18_METFK       KQ-------------VDYKDVDLLKDFINENGKIIPARITGTKAKYQRQLTTAVKRARFL
RS18_CHRVO       KE-------------IDYKSVDLLKDFIAENGKIIPARITGTKARYQRQLTTAIKRARFL
RS18_NITEC       KK-------------IDYKDVDLLKDFISENGRIIPARITGTRSYYQRQLNLAIERARFL
RS18_NITMU       KT-------------VDYKDIELLKDFINENGKIIPARITGTKSRYQRQLSTAVERARFL
RS18_BLOFL       IY-------------VDYKDLSKIQHSIIENAKIIPSRITGTRSKYQRQLARAIKIARFL
RS18_BLOPB       IN-------------IDYKDLVTIQHSIIESGKIIPSRITGTRARYQRQLARAIKRARYL
RS18_PSYWF       TH-------------IDYKDVELLKQYISDNGKIVPSRITGTSNKYQRQLATAIKQARYL
RS18_DICNV       KE-------------IDYKDLETLKAYITEVGKIVPARITGTNVFYQRQLATAVKRARFL
RS18_FRATO       KE-------------IDYKDVNKLKAYINETGKIVPSRVTGTSAKYQRQLATAIKRARFL
RS18_WIGBR       NN-------------IDYKDIILLKNYITENGKIVPSRITGTRARYQRQLSRAVKRARYL
RS18_HALHL       KE-------------IDYKDLNTLKNYITDTGKIVPSRITGTSARYQRQLARAIKRARYL
RS18_BUCBP       KE-------------IDYKDLSMLKNYITESGKIVPSRITGTSARYQRQLARAIKRARYL
RS18_PSEHT       QQ-------------IDYKDLATLRNYVTESGKIVPSRITGTSAKYQRQLATAIKRARYL
RS18_ECOLI       QE-------------IDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYL
RS18_METCA       KE-------------IDYKDLDTLREYVSETGKIVPSRITGTSAKYQRQLATAIKRARFL
RS18_SACD2       KS-------------IDYKDLDTLKAYVSETGKIVPSRITGTKAKYQRQLATAIKRARFI
RS18_HYDCU       KE-------------IDYKDLDTLKSYITETGKIVPSRITGTSAKYQRQLSTAIKRARYL
RS18_MAGMM       LK-------------IDYKDPKMLSRYITERGKMVPSRITGVCAPHQRKLSVAIKRARNI
RS18_HYPNA       QE-------------IDYKDVKMLQRYISEKGKIVPSRITAVNLKNQRKLAQAIKRARML
RS18_SPHAL       PV-------------IDYKDVRLLQGYLSERGKIVPSRITAVSTKKQRELAKAIKRARHI
RS18_JANSC       PK-------------IDYKDTRLLQRYISERGKIVPSRITAVGAKNQRALAKAIKRARFL
RS18_MARMM       PA-------------IDFKDPKLLLRYMSERGKIVPSRITAVSAKKQRELARAIKRARQL
RS18_BARBK       AK-------------IDYKDIKLLQRYISERGKIVPSRITAVSQKKQRELANAIKRARFL
RS18_RHORT       PK-------------IDYKDIKLLLRFVSERGKIVPSRITAVSAKKQRELARAIKRARFL
RS18_ACICJ       PK-------------IDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELARAIKRARFL
RS18_MYCGA       LK-------------VDYKDVNTLRKNLNSYAKIVSRRQSGNCNLHQRHVSNAIKKARIM
RS18_MYCAP       EY-------------VDYKNVEFITKFISGIGQIKPHVSTGTCARHQRKVANAIKRARFM
RS18_RHOBA       MY-------------VDYKDLELLSKMVNRQGRIMGRRKSGCTAASQHAVTAAIKRARFM
RS18_MYCPE       EH-------------VDYKDVELLYKYLTPNLKIASRKITFACSKHQTRVSNAIKRARIV
RS18_SALRD       EY-------------VDYKDTEFLEQFINNQGKILPRRVTGVPARVQRQITKAIKRARHL
RS18_UREP2       EH-------------VDYKDVELLQRFINNNNKIASRRVTGASARMQRRIANAIKRARFV
RS18_FUSNN       EE-------------IDYKNVELLKRFVSDKGKINPSRLTGANAKLQRKIAKAVKRARNI
RS18_MYCS5       TY-------------VDYKNVEDLKKFVNAVGSIKPKVATGNCAKHQRKVTLAVKRARLM
RS18_ARCB4       DF-------------IDYKNTELLKLSMSERGKIMPRRLTGNSKNAQEMVEKAIKRARHM
RS18_SULDN       DF-------------MDYKDVGALRFSLSERYKIMPRRLTGNCKRHQDMIATVIKRARAA
RS18_HELHP       EY-------------IDYKDVEMLKHSLSERYKIMPRRLTGNTKRWQERVEVAIKRARHM
RS18_CAMHC       EF-------------IDYKDTALLKYCLSERFKIMPRRLTGTSKKYQEMVEKAIKRARQA
RS18_CAMJ8       EF-------------IDYKDTAMLKHALSERFKIMPRRLTGTSKKYQEMVEVAIKRARHV
RS18_SULNB       DF-------------IDYKDLNSLKFSLSERFKIMPRRLTGNCKRHQEMVTVAIKRARQT
RS18_NITSB       TF-------------IDYKDIELIKHSLSERYKIMPRRLTGNCKKHQVMVEEAIKRARHA
RS18_THEP1       DY-------------VDYKDTRLLSEFLTDKGKIIPKRLTGNCSKHQRMVKVAIKRARQM
RS18_THEM4       DY-------------VDYKDVKLLREFLTEKEKIIPRRVTGNCAKHQRMVKIAIKRARQM
RS18_PSELT       EY-------------VDYKDLRLLNEFLTDKAKIIPKRVTGNCAKHQRMIKIAIKRARHM
RS18_LEPIC       KQ-------------INYKNIELLERFITNRGKIIPRRITGTSARYQRVLAREIRKARSI
RS18_LEPBP       AG-------------LDYKRVDILERFVTNRGKIIPRRITGTCGKHQRALAREIRKSRSI
RS18_AQUAE       RE-------------PDYKNYEELRNFLTERGRIKDRKQTGLCAKHQRRLAVQIKRARQL
RS18_ANADF       LK-------------VDYKDQSQMKYFLTERGKIIPRRISGNCAKHQREVATAVKRGRML
RS18_MYXXD       AS-------------VDFKDQATLKYFVTERGKIIPRRISGNCAKHQREVAVAIKRARGI
RS18_MYCPU       NY-------------IDYKDVELLSKFINSHGKILPSKITDVSAKRQRMLTRAIKRARNM
RS18_MYCHJ       FY-------------IDYKDIEVLQRFINTFGKIQPSRITGNCAKHQRKLALAVKRARFV
RS18_UNCTG       VE-------------IDYKNLSLLHTFVTEKGKILSGRMTGTCAKHQRELDTAIKRARMI
RS18_DESAG       LP-------------INYKRPDILRDFVTERGKIIARRITGTCAHHQRLLTTEIKRARQM
RS18_SYNAS       IK-------------IDYKRPDILHDYITERGKIMPRRITGSCSKHQRELTQAIKRARSI
RS18_DEHM1       SR-------------IDYKDSAKLARYISDRGKIEPRRRTGTCARHQRALANAIKRARFI
RS18_KORVE       DA-------------IDYKDVRLLGQFVAESGKIVPRRLTGVCTPHQRRLSDAIKQARNI
RS18_SOLUE       DD-------------INYKDVKMLHAFVAERGKIVPRRISGVCAPHQRRLTDAIKKARNI
RS18_SORC5       LV-------------IDYKDPQALKYFISERGKVVPRRISGNCARHQRKVTLSIKRARNI
RS18_PELCD       LK-------------IDYKEIRNLRYFITERGKIVPRRISGNCAEHQRKIREAIKRARNI
RS18_GEOSL       LV-------------IDYKDPRVLRSFITERGKIVPRRISGNCSAHQREITEAIKRARNI
RS18_PELPD       LT-------------IDYKEPRTLRYFITERGKIVPRRISGNCSAHQREITEAIKRARNL
RS18_GEOUR       VS-------------IDYKDPRTLRYFISERGKIIPRRISGNCAKHQREITEAIKRARNI
RS18_DESPS       LV-------------IDYKDVKVLRNFVSERGKIIPRRIVGTCASHQRQLCEAVKRARQI
RS18_NATTJ       TT-------------VSYKDLDRLKKYITERGKILPRRINGNCAKHQRQLTTAIKKARQL
RS18_CALS8       YD-------------IDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKRARIL
RS18_CALS4       DR-------------IDYKDVARLRKYITERGKILPRRITGNCARHQRQLTKAIKRARQI
RS182_ROSS1      RV-------------VDYKDVKRLQRCMSERGKILPRRRTGVCARHQRSLTVAIKRARHM
RS18_SYNFM       LK-------------IDYKDSKTLRYFVTERGKIVPRRISGNCAKHQRELTLAVKRARQI
RS18_CLOD6       AK-------------IDYKSTQRLQKYITERGKILPRRISGTCAKHQRELTVAIKRARNI
RS18_HELMI       ET-------------VDYKEVGKLRKYITERGKILPRRVSGCCAKHQRQLTNAIKRARHV
RS18_LACP7       KE-------------IDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAVKRARHI
RS18_ALKMQ       SK-------------IDYKEVHKLKKYVTERGKILPRRISGNCAIHQRDITQAIKRSRHI
RS18_ALKOO       KN-------------IDYKDVHKLKKYITERGKILPRRISGNCAIHQRELTQAIKRSRHI
RS18_HUNT2       ER-------------IDYKDVAKLKKYISERGKILPRRISGNCAKHQRQLTVAIKRARHI
RS18_MOOTA       EQ-------------VDYKDVNRLRRYISERGKILPRRISGNCAHHQRQLTRAIKRARAL
RS18_SYMTH       EH-------------VDYKDAARLKRYITERGKILPRRISGNCARHQRQLTVAIKRARIM
RS18_CARHZ       VD-------------VDYKDVNRLKKYITERGKILPRRISGNCARHQRRLTTAIKRARIM
RS18_PELTS       EV-------------VDYKDVQRLKKYITERGKILPRRISGNCAKHQRLLTTAIKRARNI
RS18_DESAP       AV-------------IDYKDTPRLKKYITERGKILPRRITGNCAHHQRMLTVSIKRSRHM
RS18_DESHY       ES-------------IDYKDTHKIRKYITERGKILPRRISGNCAKHQRQVTVAIKRARHI
RS18_DESRM       TS-------------IDYKETSKLRKYVTERGKILPRRISGNCAHHQRMLTTAIKRSRNI
RS18_CLOPS       ES-------------IDYKDVAKLKKYITERGKILPRRISGTCAKHQRQLTDAIKRSRNI
RS18_CLOB8       EF-------------IDYKDINKLRKYVTERGKILPRRISGTCAKHQRELTSSIKRARNI
RS18_CLOAB       ES-------------IDYKDINKLRKYVTERGKILPRRISGNCAKHQRELTIAIKRARNI
RS18_CLONN       SS-------------IDYKDVNKLRKYVTERGKILPRRISGNCAKHQRELTLAIKRARNV
RS18_CHLPN       KT-------------IDYKDVETLKKFITERGKVLPRRITGVSSRFQGVLSQAIKRARHL
RS18_CHLAA       VP--------------DYKDVKRLQKYLTAQGKILPRRRTGVSAKMQRRLAVAIKRARHL
RS18_CYTH3       FY-------------IDYKDPNFLLKFVNEQGKILPRRLTGTSLKYQRKVSQAVKRARLI
RS18_PORGI       RY-------------IDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHL
RS18_FLAPJ       KY-------------IDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARHL
RS18_GRAFK       KY-------------IDYKDPDFLMGFVNEQGKLLPRRLTGTSLKFQRKVATAVKRARHL
RS18_TREDE       VK-------------IDYKEPDALRRFITERGKILPRRITGTCAKHQRKLAVEIKRARAV
RS18_TREPA       LL-------------ADYKDPDTLRRFITERGKILPRRITGTCAKHQRRVALEVKRSRAV
RS181_ROSS1      LP--------------DYKDPERLKRFLGPTGKILPRRRTGLSAKMQRKLTIAIKRARHM
RS18_PARUW       RE-------------IDYKDIDTLTKFITERGKILPRRITGVSAYHQKKLTAAIKRARHV
RS18_LEUMM       EY-------------IDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARIM
RS18_OENOB       DY-------------VDYKDTELLQRFIADNGKILPRRITGTSSKNQRKIATAIKRARIM
RS18_MESFL       NY-------------IDYKDVELLKKFISGNGQILPRRITGTSPKHQRQLAVAIKRARQM
RS18_ONYPE       TK-------------IDFKDIELLQRFITDRGRILSRRVTNTSAKWQRQLAIAIKRARHM
RS18_ACHLI       TH-------------IDFKDTELLKRFITERGKILPRRVTGTSAKWQRPLAVAIKRARHM
RS18_BACHD       EK-------------IDYKDVDLLKKFVSERGKILPRRVTGTSAKYQRQLTTAIKRARQI
RS18_OCEIH       TH-------------IDYKDVDLLRRFISERGKILPRRVTGTSAKYQRKLTIAIKRARTM
RS18_STAHJ       TH-------------IDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHM
                                        :         :            :      :   .  

RS18_NEOSM       ALVPYCDRHK--------------------------------------------------
RS18_BDEBA       ALLPSGSDSYDTFHRAEAISPVPFEI----------------------------------
RR18_CYACA       GLMPFKQKNW--------------------------------------------------
RR18_TUPAK       GLLPFINQ----------------------------------------------------
RR18_OLTVI       GLLPFINLEGY-------------------------------------------------
RR18_STIHE       GLLPFVKKEKGFFR----------------------------------------------
RR18_GNEPA       SLLPFIVKTKFKKLY---------------------------------------------
RR18_PLETE       GLLPFVKKSK--------------------------------------------------
RR18_CHLVU       GLVPFVNYELGSKK----------------------------------------------
RR18_ZYGCR       AFMPFVNNET--------------------------------------------------
RR18_THAPS       SLLPFVASNEL-------------------------------------------------
RR18_PHATC       SLFPFVASNSI-------------------------------------------------
RR18_EMIHU       ALLPFVIGKN--------------------------------------------------
RR18_CRYJA       CLIPFLSLK---------------------------------------------------
RR18_GRATL       ALLPFVNKD---------------------------------------------------
RR18_PELHO       SSLPFHATDQLFKIKRKIKRRESTARKKRKKGFRKRPKK---------------------
RR18_CUSOB       SFLPFTNTESLEKMKARIREARLKAEEVRLKNKEARLKKAKDARLKAKEARNQKKTTLRK
RR18_PSINU       ALLPFINRDS--------------------------------------------------
RR18_ANEMR       ASLPFPNSEN--------------------------------------------------
RR18_STAPU       ALLPFINNEN--------------------------------------------------
RR18_ADICA       ALLPFSNNES--------------------------------------------------
RR18_CHAVU       ALIPFLNNEN--------------------------------------------------
RR18_CHAGL       ALLPFLNNEN--------------------------------------------------
RR18_PHYPA       ALLPFLNNEN--------------------------------------------------
RR18_HUPLU       APSPFLNNESRSSTNY--------------------------------------------
RR18_MAIZE       SFLPFRNYENEKQFQAQAISIITGPRHRKNRHIPQLTQKFNSNRNLRNSNQNLRNNNRNL
RR18_CYCTA       SSSPFLNNDN--------------------------------------------------
RR18_LOTJA       SSLPFINNEKKQFEKSELTATRTTTVFKTKKR----------------------------
RR18_CUSRE       SLLPFTKRKGFERSESTPRTNALKPRNKNKQNNQTQF-----------------------
RR18_IPOPU       SLLPFKRKGFQISESTARTNALKARTQNKDQKKEKFQINKKKK-----------------
RR18_PINTH       SLLPFLYNEN--------------------------------------------------
RR18_PIPCE       SSLPFLNNEKQFERPESIPKTAGPSIRNK-------------------------------
RR18_EPIVI       SLLPFINNEKQFERIESITRVKGFIKK---------------------------------
RR18_NEPOL       ALLEFIHR----------------------------------------------------
RR18_CHLAT       ALLPFLNQDI--------------------------------------------------
RR18_PYRYE       SLLPFLNKD---------------------------------------------------
RR18_GUITH       SLLPFINRDMIL------------------------------------------------
RR18_RHDSA       SLLPFVNREGSL------------------------------------------------
RR18_OSTTA       GFLQFLYKE---------------------------------------------------
RR18_CYAPA       ALLPFVNRES--------------------------------------------------
RS18_SYNJA       GLLYFVNKEG--------------------------------------------------
RS18_TRIEI       ALLPYVNKES--------------------------------------------------
RS18_SYNY3       ALLPFVNKEI--------------------------------------------------
RS18_SYNR3       ALLPFVNPEG--------------------------------------------------
RS18_THEEB       ALLPFLNLEG--------------------------------------------------
RS18_GLOVI       ALLPFVNQEG--------------------------------------------------
RS18_SYNE7       ALLPFLNQEG--------------------------------------------------
RS18_MYCGE       ALVPFIKD----------------------------------------------------
RS18_MYCPN       ALVPFVKD----------------------------------------------------
RS18_DEIRA       ALLPYTEKLVRK------------------------------------------------
RS18_THET8       GLLPFTEKLVRK------------------------------------------------
RS18_CHLCH       AVIPYVVDEYK-------------------------------------------------
RS18_TROWT       GVIPFKSGVSR-------------------------------------------------
RS18_LEIXX       ALLPYAGSGR--------------------------------------------------
RS181_FRAAA      ALLPYPGPAAARGR----------------------------------------------
RS181_MYCS2      ALLPMAGPR---------------------------------------------------
RS181_SACEN      ALLPYPAAAKR-------------------------------------------------
RS182_MYCGI      ALLPYPGQG---------------------------------------------------
RS181_MYCVP      ALLPYPGQNPTGR-----------------------------------------------
RS182_MYCUA      ALLPYPASRPQ-------------------------------------------------
RS182_MYCTU      ALLPYPGQDRQRRAALCP------------------------------------------
RS182_MYCPA      ALLPYPGQGIKP------------------------------------------------
RS181_STRGG      ALLPYTGSPAGT------------------------------------------------
RS182_MYCVP      ALLPFSSSTR--------------------------------------------------
RS182_RHOJR      ALLPFTSR----------------------------------------------------
RS18_CORJK       ALLPFHSR----------------------------------------------------
RS18_RUBXD       ALLPYIAGR---------------------------------------------------
RS181_NOCFA      ALLPYVSTAR--------------------------------------------------
RS181_RHOJR      ALLPYATVAR--------------------------------------------------
RS18_NOCSJ       ALLPYTSTGR--------------------------------------------------
RS182_FRAAA      ALLPYTASAR--------------------------------------------------
RS18_ACIC1       ALLPYTNAAR--------------------------------------------------
RS182_STRAW      ALLPYSSR----------------------------------------------------
RS182_STRCO      ALLPYGTR----------------------------------------------------
RS18_CUTAK       ALLPYASTAR--------------------------------------------------
RS18_SALTO       ALLPYTATAR--------------------------------------------------
RS18_BIFLO       ALLPYATSGR--------------------------------------------------
RS18_RENSM       ALLPYSGAGRG-------------------------------------------------
RS18_KINRD       ALLPYSSSAR--------------------------------------------------
RS18_MYCMO       ALIPFISERIRK------------------------------------------------
RS18_WOLTR       ALVPYCTKKV--------------------------------------------------
RS18_ANAPZ       ALLPYC------------------------------------------------------
RS18_EHRRW       ALLPYC------------------------------------------------------
RS18_ORITB       ALLPFVYHQ---------------------------------------------------
RS18_RICBR       ALLPFVFQAK--------------------------------------------------
RS18_PELUB       ALI---------------------------------------------------------
RS18_BORBU       ALLPFVKK----------------------------------------------------
RS18_VESOH       ALIPYTDKHKK-------------------------------------------------
RS18_LEGPH       GLLPYCDSHR--------------------------------------------------
RS18_METPP       ALLPYSDQHKS-------------------------------------------------
RS18_COXBR       ALLPYCDTHQ--------------------------------------------------
RS18_XYLFT       ALIPYTDNHDI-------------------------------------------------
RS18_BORA1       ALLPYTDNHN--------------------------------------------------
RS182_CUPPJ      ALLPYTDLHKH-------------------------------------------------
RS18_POLAQ       ALLPFSDQHKK-------------------------------------------------
RS18_PARXL       ALVPYTDQHKA-------------------------------------------------
RS18_RALSO       ALMPYTDQHKH-------------------------------------------------
RS18_THIDA       ALMPYTDLH---------------------------------------------------
RS18_METFK       ALLPYTDKH---------------------------------------------------
RS18_CHRVO       AFLPYTDQH---------------------------------------------------
RS18_NITEC       ALLPYTDQH---------------------------------------------------
RS18_NITMU       ALLPYTDLH---------------------------------------------------
RS18_BLOFL       SLLPYIDQNR--------------------------------------------------
RS18_BLOPB       SLLPYTDHHQ--------------------------------------------------
RS18_PSYWF       ALLPYTDNHQ--------------------------------------------------
RS18_DICNV       ALLPYTDQH---------------------------------------------------
RS18_FRATO       ALLPYCDRHFN-------------------------------------------------
RS18_WIGBR       SLLPYTDHHR--------------------------------------------------
RS18_HALHL       ALLPYTDRH---------------------------------------------------
RS18_BUCBP       SLLPYTDQHQ--------------------------------------------------
RS18_PSEHT       ALLPYTDLHK--------------------------------------------------
RS18_ECOLI       SLLPYTDRHQ--------------------------------------------------
RS18_METCA       ALLPFCDAHEQ-------------------------------------------------
RS18_SACD2       ALLPYTDSHE--------------------------------------------------
RS18_HYDCU       ALLPYTDQHK--------------------------------------------------
RS18_MAGMM       ALLPFIVK----------------------------------------------------
RS18_HYPNA       ALIPFEVK----------------------------------------------------
RS18_SPHAL       GLLPYIVK----------------------------------------------------
RS18_JANSC       ALLPYAVK----------------------------------------------------
RS18_MARMM       ALLPYVVD----------------------------------------------------
RS18_BARBK       GLLPYVVK----------------------------------------------------
RS18_RHORT       SLLPYVLK----------------------------------------------------
RS18_ACICJ       ALLPYVVD----------------------------------------------------
RS18_MYCGA       ALLPFVKD----------------------------------------------------
RS18_MYCAP       ALIPYTKDKIRVLAPAASANTAQAPAEKAKKEAVAA------------------------
RS18_RHOBA       ALLPYVGE----------------------------------------------------
RS18_MYCPE       ALIPFVRD----------------------------------------------------
RS18_SALRD       ALMPYVSESVR-------------------------------------------------
RS18_UREP2       GLLPYVKE----------------------------------------------------
RS18_FUSNN       ALIPYTRTEK--------------------------------------------------
RS18_MYCS5       ALLPFAVARIRVHRSLVSAPASQNTKKVAEKVEKEKAPAA--------------------
RS18_ARCB4       ALVPYIVDTKNITDSAYARSFY--------------------------------------
RS18_SULDN       ALVPYTVTRNTVVTAPFENLR---------------------------------------
RS18_HELHP       ALIPYIVDRKKVVENPFKI-----------------------------------------
RS18_CAMHC       ALIPYIVDRDNVVVNPFEILG---------------------------------------
RS18_CAMJ8       ALIPYIVDRKEVINNPFEGL----------------------------------------
RS18_SULNB       ALIPYIVDRKNVVENPFELIK---------------------------------------
RS18_NITSB       ALVPYIVDRKRVIPNPFEELQPIYK-----------------------------------
RS18_THEP1       GLLPYLKI----------------------------------------------------
RS18_THEM4       ALLPYVKY----------------------------------------------------
RS18_PSELT       ALLPFIKL----------------------------------------------------
RS18_LEPIC       GLLPYKVN----------------------------------------------------
RS18_LEPBP       GLLPFKVL----------------------------------------------------
RS18_AQUAE       GLLPYVVY----------------------------------------------------
RS18_ANADF       AILPYTVGGM--------------------------------------------------
RS18_MYXXD       ALLPYNAVVG--------------------------------------------------
RS18_MYCPU       ALLPFTQERVRTQKPLIVTSNSPKEKEAKPSAQ---------------------------
RS18_MYCHJ       ALLPFIGDRIRGNYDKTRV-----------------------------------------
RS18_UNCTG       ALLPFTVN----------------------------------------------------
RS18_DESAG       ALLFYTSTHSSDVLKKSSL-----------------------------------------
RS18_SYNAS       ALLPFVVTEGR-------------------------------------------------
RS18_DEHM1       ALMPFVSEHVRRQGNVATFSPMRELRPEPKVAEPKVEPKVEAKAEAAVPEVKAEVAPAAE
RS18_KORVE       ALLPFASAR---------------------------------------------------
RS18_SOLUE       ALLPFAASF---------------------------------------------------
RS18_SORC5       ALLPFTVTA---------------------------------------------------
RS18_PELCD       ALLPFTAGHSLD------------------------------------------------
RS18_GEOSL       ALIPIASTHVIA------------------------------------------------
RS18_PELPD       ALLPIASNHTLP------------------------------------------------
RS18_GEOUR       ALLPIAGSHASQ------------------------------------------------
RS18_DESPS       ALLPYSGSAQN-------------------------------------------------
RS18_NATTJ       ALLPYTVEN---------------------------------------------------
RS18_CALS8       ALLPFIVE----------------------------------------------------
RS18_CALS4       ALLPYTVE----------------------------------------------------
RS182_ROSS1      ALLPFVAAHIRS------------------------------------------------
RS18_SYNFM       ALLPHTTIHNV-------------------------------------------------
RS18_CLOD6       ALLPYTLD----------------------------------------------------
RS18_HELMI       ALLPFTVNE---------------------------------------------------
RS18_LACP7       ALMPYTLD----------------------------------------------------
RS18_ALKMQ       ALLPYTID----------------------------------------------------
RS18_ALKOO       ALLPYTMD----------------------------------------------------
RS18_HUNT2       ALLPYTAD----------------------------------------------------
RS18_MOOTA       ALLPYTAE----------------------------------------------------
RS18_SYMTH       ALLPFTVE----------------------------------------------------
RS18_CARHZ       ALLPFTVE----------------------------------------------------
RS18_PELTS       ALLPFTAE----------------------------------------------------
RS18_DESAP       ALLPFSTD----------------------------------------------------
RS18_DESHY       ALLPYIVE----------------------------------------------------
RS18_DESRM       ALLPFSTEA---------------------------------------------------
RS18_CLOPS       ALLPFTTE----------------------------------------------------
RS18_CLOB8       ALLPFTTE----------------------------------------------------
RS18_CLOAB       ALLPFTTE----------------------------------------------------
RS18_CLONN       ALLPFTTD----------------------------------------------------
RS18_CHLPN       GLLPFVGED---------------------------------------------------
RS18_CHLAA       ALLPVAPSHTR-------------------------------------------------
RS18_CYTH3       GLLPYVTDSLK-------------------------------------------------
RS18_PORGI       ALLPYVTDMMK-------------------------------------------------
RS18_FLAPJ       AFMPYVADLLK-------------------------------------------------
RS18_GRAFK       ALMPYVGDLLK-------------------------------------------------
RS18_TREDE       ALLPFVMNE---------------------------------------------------
RS18_TREPA       ALLPFVLTE---------------------------------------------------
RS181_ROSS1      ALLPFVERSITDRRR---------------------------------------------
RS18_PARUW       ALLPFVAEV---------------------------------------------------
RS18_LEUMM       ALLPFVTED---------------------------------------------------
RS18_OENOB       ALLPFVANN---------------------------------------------------
RS18_MESFL       ALLPYVID----------------------------------------------------
RS18_ONYPE       ALIPFIQQ----------------------------------------------------
RS18_ACHLI       ALLPFVKE----------------------------------------------------
RS18_BACHD       ALLPYVTDNN--------------------------------------------------
RS18_OCEIH       ALLPYVAD----------------------------------------------------
RS18_STAHJ       ALLPYVKDEN--------------------------------------------------
                                                                             

RS18_NEOSM       -----------------
RS18_BDEBA       -----------------
RR18_CYACA       -----------------
RR18_TUPAK       -----------------
RR18_OLTVI       -----------------
RR18_STIHE       -----------------
RR18_GNEPA       -----------------
RR18_PLETE       -----------------
RR18_CHLVU       -----------------
RR18_ZYGCR       -----------------
RR18_THAPS       -----------------
RR18_PHATC       -----------------
RR18_EMIHU       -----------------
RR18_CRYJA       -----------------
RR18_GRATL       -----------------
RR18_PELHO       -----------------
RR18_CUSOB       IFINPKTSKLNTETSQT
RR18_PSINU       -----------------
RR18_ANEMR       -----------------
RR18_STAPU       -----------------
RR18_ADICA       -----------------
RR18_CHAVU       -----------------
RR18_CHAGL       -----------------
RR18_PHYPA       -----------------
RR18_HUPLU       -----------------
RR18_MAIZE       SSDC-------------
RR18_CYCTA       -----------------
RR18_LOTJA       -----------------
RR18_CUSRE       -----------------
RR18_IPOPU       -----------------
RR18_PINTH       -----------------
RR18_PIPCE       -----------------
RR18_EPIVI       -----------------
RR18_NEPOL       -----------------
RR18_CHLAT       -----------------
RR18_PYRYE       -----------------
RR18_GUITH       -----------------
RR18_RHDSA       -----------------
RR18_OSTTA       -----------------
RR18_CYAPA       -----------------
RS18_SYNJA       -----------------
RS18_TRIEI       -----------------
RS18_SYNY3       -----------------
RS18_SYNR3       -----------------
RS18_THEEB       -----------------
RS18_GLOVI       -----------------
RS18_SYNE7       -----------------
RS18_MYCGE       -----------------
RS18_MYCPN       -----------------
RS18_DEIRA       -----------------
RS18_THET8       -----------------
RS18_CHLCH       -----------------
RS18_TROWT       -----------------
RS18_LEIXX       -----------------
RS181_FRAAA      -----------------
RS181_MYCS2      -----------------
RS181_SACEN      -----------------
RS182_MYCGI      -----------------
RS181_MYCVP      -----------------
RS182_MYCUA      -----------------
RS182_MYCTU      -----------------
RS182_MYCPA      -----------------
RS181_STRGG      -----------------
RS182_MYCVP      -----------------
RS182_RHOJR      -----------------
RS18_CORJK       -----------------
RS18_RUBXD       -----------------
RS181_NOCFA      -----------------
RS181_RHOJR      -----------------
RS18_NOCSJ       -----------------
RS182_FRAAA      -----------------
RS18_ACIC1       -----------------
RS182_STRAW      -----------------
RS182_STRCO      -----------------
RS18_CUTAK       -----------------
RS18_SALTO       -----------------
RS18_BIFLO       -----------------
RS18_RENSM       -----------------
RS18_KINRD       -----------------
RS18_MYCMO       -----------------
RS18_WOLTR       -----------------
RS18_ANAPZ       -----------------
RS18_EHRRW       -----------------
RS18_ORITB       -----------------
RS18_RICBR       -----------------
RS18_PELUB       -----------------
RS18_BORBU       -----------------
RS18_VESOH       -----------------
RS18_LEGPH       -----------------
RS18_METPP       -----------------
RS18_COXBR       -----------------
RS18_XYLFT       -----------------
RS18_BORA1       -----------------
RS182_CUPPJ      -----------------
RS18_POLAQ       -----------------
RS18_PARXL       -----------------
RS18_RALSO       -----------------
RS18_THIDA       -----------------
RS18_METFK       -----------------
RS18_CHRVO       -----------------
RS18_NITEC       -----------------
RS18_NITMU       -----------------
RS18_BLOFL       -----------------
RS18_BLOPB       -----------------
RS18_PSYWF       -----------------
RS18_DICNV       -----------------
RS18_FRATO       -----------------
RS18_WIGBR       -----------------
RS18_HALHL       -----------------
RS18_BUCBP       -----------------
RS18_PSEHT       -----------------
RS18_ECOLI       -----------------
RS18_METCA       -----------------
RS18_SACD2       -----------------
RS18_HYDCU       -----------------
RS18_MAGMM       -----------------
RS18_HYPNA       -----------------
RS18_SPHAL       -----------------
RS18_JANSC       -----------------
RS18_MARMM       -----------------
RS18_BARBK       -----------------
RS18_RHORT       -----------------
RS18_ACICJ       -----------------
RS18_MYCGA       -----------------
RS18_MYCAP       -----------------
RS18_RHOBA       -----------------
RS18_MYCPE       -----------------
RS18_SALRD       -----------------
RS18_UREP2       -----------------
RS18_FUSNN       -----------------
RS18_MYCS5       -----------------
RS18_ARCB4       -----------------
RS18_SULDN       -----------------
RS18_HELHP       -----------------
RS18_CAMHC       -----------------
RS18_CAMJ8       -----------------
RS18_SULNB       -----------------
RS18_NITSB       -----------------
RS18_THEP1       -----------------
RS18_THEM4       -----------------
RS18_PSELT       -----------------
RS18_LEPIC       -----------------
RS18_LEPBP       -----------------
RS18_AQUAE       -----------------
RS18_ANADF       -----------------
RS18_MYXXD       -----------------
RS18_MYCPU       -----------------
RS18_MYCHJ       -----------------
RS18_UNCTG       -----------------
RS18_DESAG       -----------------
RS18_SYNAS       -----------------
RS18_DEHM1       TSESAESA---------
RS18_KORVE       -----------------
RS18_SOLUE       -----------------
RS18_SORC5       -----------------
RS18_PELCD       -----------------
RS18_GEOSL       -----------------
RS18_PELPD       -----------------
RS18_GEOUR       -----------------
RS18_DESPS       -----------------
RS18_NATTJ       -----------------
RS18_CALS8       -----------------
RS18_CALS4       -----------------
RS182_ROSS1      -----------------
RS18_SYNFM       -----------------
RS18_CLOD6       -----------------
RS18_HELMI       -----------------
RS18_LACP7       -----------------
RS18_ALKMQ       -----------------
RS18_ALKOO       -----------------
RS18_HUNT2       -----------------
RS18_MOOTA       -----------------
RS18_SYMTH       -----------------
RS18_CARHZ       -----------------
RS18_PELTS       -----------------
RS18_DESAP       -----------------
RS18_DESHY       -----------------
RS18_DESRM       -----------------
RS18_CLOPS       -----------------
RS18_CLOB8       -----------------
RS18_CLOAB       -----------------
RS18_CLONN       -----------------
RS18_CHLPN       -----------------
RS18_CHLAA       -----------------
RS18_CYTH3       -----------------
RS18_PORGI       -----------------
RS18_FLAPJ       -----------------
RS18_GRAFK       -----------------
RS18_TREDE       -----------------
RS18_TREPA       -----------------
RS181_ROSS1      -----------------
RS18_PARUW       -----------------
RS18_LEUMM       -----------------
RS18_OENOB       -----------------
RS18_MESFL       -----------------
RS18_ONYPE       -----------------
RS18_ACHLI       -----------------
RS18_BACHD       -----------------
RS18_OCEIH       -----------------
RS18_STAHJ       -----------------