CLUSTAL format seed alignment for MF_00274

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1974_KORVE      -------------------MGGFNLNEMMAA---AKQHAEELQ----KK---MAQTVIEA
Y492_ACIC5       -------------------MNPFKMQQMLSQ---AKEMQEQMQ----EK---LAATVVEA
Y3777_ANAD2      ----------------------MDIQYLMRQ---AKKLEKAMA----DAKEKLAEIAVEA
Y3694_ANASK      ----------------------MDIQYLMRQ---AKKLEKAMA----DAKEKLAEIAVEA
Y3636_ANADE      ----------------------MDIQYLMRQ---AKKLEKAMA----DAKEKLAEIAVEA
Y3761_ANADF      ----------------------MDIQYLMRQ---AKKLEKAMA----DAKEQLAELSVEA
Y1931_MYXXD      -------------------MPGVDLNYFIRQ---ANKLTEKIE----ERKQQLAEESVEA
Y1069_THEYD      -------------------MSKKMFGEIMRQ---AQKIQEEIQ----KKQEEVKKMTVEA
Y1113_GEMAT      ----------------------MDLFKMLGQ---FKDMQGRMQ----TMQEEMSQRTFSA
Y1672_METI4      ----------------------MNINKLLKQ---AQKLQEEAK----KIQEQMASLSFEG
Y4780_ALKMQ      ---MAKKG-FPGMG------GAPNMNNMMKQ---VQKMQKDME----KTQAALEEKEVEA
Y2855_ALKOO      ---MAKKGGFPGMG------GV-NMNNMMKQ---VQKMQKQME----ETQAQLEQKVLET
Y032_CLOBH       ---MARGG-FPNMG------GA-NMNNLMKQ---AQKLQQDME----KMQGEMEKKEFSA
Y038_CLOBJ       ---MARGG-FPNMG------GA-NMNNLMKQ---AQKLQQDME----KMQGEMEKKEFSA
Y037_CLOB6       ---MARGG-FPNMG------GA-NMNNLMKQ---AQKLQQDME----KMQGEMEKKEFSA
Y048_CLOBL       ---MARGG-FPNMG------GA-NMNNLMKQ---AQKLQQDME----KMQGEMEKKEFSA
Y3166_CLOBM      ---MARGG-FPNMG------GA-NMNNLMKQ---AQKLQQDME----KMQGEMEKKEFSA
Y043_CLOB1       ---MARGG-FPNMG------GA-NMNNLMKQ---AQKLQQDME----KMQGEMEKKEFSA
Y785_CLOBK       ---MARGG-FPNMG------GA-NMNNLMKQ---AQKLQQDME----KMQGEMEKKEFSA
Y074_CLOTE       ---MARGG-VPNFG------GG-NINNLMKQ---AQKFQQQME----EMQGQLENKKFQA
Y126_CLOAB       ---MAKGG-FPGMG------GG-NMNNLIKQ---AQKFQKQME----DMQKEIENKEFTA
Y3826_CLOK5      ---MARGG-FPNFG------GGGNMNNLMKQ---AQKFQKQME----DMQSELENKEFSA
Y824_CLONN       ---MARGG-FPGMG------GGMNINNLMKQ---AQKMQQQMQ----KVQGELEEKEFVA
Y3225_CLOBA      ---MAKGG-FPGGF------GGGNMNNLMKQ---AQKLQKQME----DMQKDLETKEFET
Y3446_CLOBB      ---MAKGG-FPGGF------GGGNMNNLMKQ---AQKLQKQME----DMQKDLETKEFET
Y243_RUMCH       ---MARGG-FPGGG------FGGNMNNLMKQ---AQKMQKDME----KAQQDLENKTIEV
Y2143_ACET2      ---MAKGG-FPG--------FGGNINNLVKQ---AQKMQRDME----RVQEELKEKTVEA
Y017_CLOD6       ---MAKKGFGGGMMP-----GGGNMNNLLKQ---AQKMQENMQ----KAQQELESKEVEA
Y046_CLOPE       ---MARGG-FPG--------GMGNMNNLMKQ---AQMLQKQMQ----SMQEEIEASEFEG
Y053_CLOP1       ---MARGG-FPG--------GMGNMNNLMKQ---AQMLQKQMQ----SMQEEIEASEFEG
Y056_CLOPS       ---MARGG-FPG--------GMGNMNNLMKQ---AQMLQKQMQ----SMQEEIEASEFEG
Y2017_LACE2      ---MAKRGGFPGG-------MPGNMNNLMKQ---AQRMQRQME----EQQAELENKEFSA
Y329_AGARV       ---MARRGGFPGG-------MPGNMNNLMKQ---AQKMQRQME----EAQKQLEDAEVTA
Y047_LACP7       ---MAKRGGFPGGN------MPGNMNNLMKQ---AQRMQKQME----DKTKEMEEKQWEA
Y1143_CALBD      ---MAKNK-FPGLG------GGFNINQLQKQ---ARKMQEEIE----KLQEELNQREIEV
Y1593_CALS8      ---MAKNR-FPGLG------GGFNINQLQKQ---AKKIQEEIE----KLQEELNQREIEA
Y2199_THEP3      ---MAKGG-FPG---------GFNINNMIKQ---AQQMQEEIK----KMQEELMQKTVEA
Y034_THEPX       ---MAKGG-FPG---------GFNINNMIKQ---AQQMQEEIK----KMQEELMQKTVEA
Y040_CALS4       ---MAKGG-FPG---------GFNINNMIKQ---AQQMQEEIK----KMQEELMQKTVEG
Y043_DESRM       ---MMGG----------------NMNKMMKQ---VQKMQQDMA----KMQEELGNRTVET
Y052_PELTS       ---MMGG----------------NMSKMMKQ---VQKMQQDML----RLQEELGNRTVES
Y028_MOOTA       ---MGMG----------------NMNKMMKQ---MQKMQAQVA----RLQEELGERTVEA
Y2790_SYNFM      ---MVMS----------------RGFNPMQQ---VKALQDKMA----RMQEELALKTVEA
Y020_BACAH       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y020_BACHK       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y020_BACAN       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y027_BACAA       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y027_BACAC       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y027_BACC3       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y027_BACC7       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y024_BACC0       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y021_BACC1       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y027_BACCQ       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y020_BACCZ       --------MMRGGM--------GNMNNMMKQ---MQKMQKEMA----KAQEELGEKTVEG
Y025_BACCR       --------MMRGGM--------GNMNNMMKQ---MQKMQKDMA----KAQEELGEKTVEG
Y025_BACC4       --------MMRGGM--------GNMNNMMKQ---MQKMQKDMA----KAQEELGEKTVEG
Y5293_BACC2      --------MMRGGM--------GNMNNMMKQ---MQKMQKDMA----KAQEELGEKTVEG
Y019_BACMK       --------MMRGGM--------GNMNNMMKQ---MQKMQKDMA----KAQEELGEKTVEG
Y019_BACCN       --------MMRGGM--------GNMNNMMKQ---MQKMQKQMA----KAQEELGEKQVEG
Y018_GEOKA       --------MMRGGM--------GNMQKMLKQ---MQKMQKEMQ----KAQEELAEKTVEG
Y017_GEOTN       --------MMRGGM--------GNMQKMLKQ---MQKMQKEMQ----KAQEELAEKTVEG
Y020_GEOSW       --------MMRGGM--------GNMQKMMKQ---MQKMQKEMQ----KAQEQLAEKTVEG
Y2358_BACLD      ---------MRGGM--------GNMQKMMKQ---MQKMQKDMQ----KAQEELAEKVLEG
YAAK_BACSU       ---------MRGGM--------GNMQKMMKQ---MQKMQKDMA----KAQEELAEKVVEG
Y038_BACSK       -----------MEM--------KNMGNMMKQ---MQKMQKQMM----KAQEELKEKTVEA
Y035_ALKHC       -------------M--------KNMGQMMKQ---MQKMQKQMM----KAQEELKEKTVEA
Y030_OCEIH       ------------MK--------GNMNNMMKQ---MQKMQKKMM----QAQDELHEMTFEA
Y019_EXIS2       ----------MRGM--------GNMNNMMKQ---MQKMQKDMA----KAQEELKDLTVTG
Y1710_EXISA      ----------MRGM--------GNMNNMMKQ---MQKMQKDMA----KAQEELKELSVEG
Y428_STAAB       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y453_STAA3       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y436_STAAS       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y476_STAA1       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y479_STAAM       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y434_STAAW       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y437_STAAN       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y444_STAA8       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y443_STAAE       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y478_STAAT       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y478_STAAR       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y2533_STAHJ      ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y521_STAAC       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERIVG
Y513_STAA2       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQKKLKEERIVG
Y500_STAA9       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQKKLKEERIVG
Y2306_STAES      ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERVAG
Y115_STAEQ       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----QEQEKLKEERVAG
Y2277_STAS1      ---------MRGG---------GNMQQMMKQ---MQKMQKKMG----EEQEKLKEEKVQG
Y120_STACT       ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----EEQEKLKDEKVEG
Y1934_MACCJ      ---------MRGG---------GNMQQMMKQ---MQKMQKKMA----EEQEKLKEERIEG
Y2703_LISMO      ----------MRGM--------GNMQGMMKQ---MQKMQKEMA----KAQADLEAQEFTG
Y2831_LISMH      ----------MRGM--------GNMQGMMKQ---MQKMQKEMA----KAQADLEAQEFTG
Y2677_LISMC      ----------MRGM--------GNMQGMMKQ---MQKMQKEMA----KAQADLEAQEFTG
Y2683_LISMF      ----------MRGM--------GNMQGMMKQ---MQKMQKEMA----KAQADLEAQEFTG
Y2851_LISIN      ----------MRGM--------GNMQGMMKQ---MQKMQKEMA----KAQADLEAQEFTG
Y2654_LISW6      ----------MRGM--------GNMQGMMKQ---MQKMQKEMA----KAQADLEVQEFTG
Y039_LYSSC       ----------MRGM--------GNMQGMMKK---MQKMQKEMM----EAQEALNAEQFEG
Y513_FINM2       -----MGNKFRGGMP-----GMGNMGNMMKQ---MQKMQRQME----ETQKRLEETEVTA
Y378_LACAC       MSRRPNFGGMGMGG--------MNMQQMMKQ---AKKLQAQMA----EEQENITAQEFVG
Y401_LACH4       MSRRPNFGGMGMGG--------MNMQQMMKQ---AKKLQAQMA----QEQENITAQEFTG
Y1634_LACDA      MSKRPAFPGMG--G--------MNMQQMMKQ---AKKLQEQMA----QEQENITTQEFTG
Y1514_LACDB      MSKRPAFPGMG--G--------MNMQQMMKQ---AKKLQEQMA----KEQENITTQEFTG
Y369_LACGA       MSRRPNFGGMGM----------GNMQGLIKQ---AKKMQQQME----AEQANLATQEFVG
Y424_LACJO       MGKRPNFGGMGM----------GNMQGLIKQ---AKKMQQQME----AEQANLATQEFVG
Y2444_LACCB      -------------M--------GNMQGMMKQ---MQKMQKEMQ----AAQRELYATEFEG
Y1227_LACS1      ---------MMMRG--------MNMQSMMKQ---MQKLQKNMK----KDQDELNATVFEG
Y699_LACPL       ---------MMRGM--------GNMQSMMKQ---MKKMQAQMT----AEQAALNEQTFTG
Y1483_PEDPA      ---------MRGGM--------GNMQSMMRQ---MQKMQKKVT----EEQEKLNQTEFTG
Y2780_ENTFA      ---------MMRGM--------GNMQGMMKQ---VQKMQKEMA----KAQEALNEKEFIG
Y128_LACLM       -------------M--------MNMQSMMKQ---AQKLQKQMQ----VSQEEIANTTFVG
Y106_LACLS       -------------M--------MNMQSMMKQ---AQKLQKQMQ----VSQEEIANTTFVG
Y120_LACLA       -------------M--------MNMQSMMKQ---AQKLQKQMQ----VSQEEIANTTFVG
Y1770_STRA1      -------------M--------MNMQNMMRQ---AQKLQKQME----QKQADLAASQFTG
Y1791_STRA3      -------------M--------MNMQNMMRQ---AQKLQKQME----QKQADLAASQFTG
Y1747_STRA5      -------------M--------MNMQNMMRQ---AQKLQKQME----QKQADLAASQFTG
Y368_STRE4       -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMQFTG
Y297_STREM       -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMQFTG
Y1862_STRP1      -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMQFTG
Y1638_STRPF      -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMQFTG
Y1926_STRP8      -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMQFTG
Y1647_STRPD      -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMQFTG
Y1568_STRPM      -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMQFTG
Y1605_STRPB      -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMQFTG
Y1585_STRPC      -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMQFTG
Y1606_STRP3      -------------M--------MNMQNMMRQ---AQKLQKQME----QKQADLAAMQFTG
Y1606_STRPQ      -------------M--------MNMQNMMRQ---AQKLQKQME----QKQADLAAMQFTG
Y270_STRPG       -------------M--------MNMQNMMRQ---AQKLQKQME----QKQADLAAMQFTG
Y1591_STRP6      -------------M--------MNMQNMMRQ---AQKLQKQME----QKQADLAAMQFTG
Y1666_STRS7      -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAATSFSG
Y1611_STRU0      -------------M--------MNMQNMMKQ---AQKLQKQME----QKQADLAAMTFVG
Y394_STRMU       -------------M--------MNMQNMMKQ---AQKLQKQME----KKQSELASMTFVG
Y1102_STRPN      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y1174_STRP7      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y1024_STRPJ      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y1010_STRR6      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y1178_STRPS      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y1195_STRPI      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y1041_STRZJ      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y1108_STRZP      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y1149_STRZT      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y1021_STRP4      -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y987_STRP2       -------------M--------MNMQNMMRQ---AQKLQKQME----QSQAELAAMQFVG
Y326_STRSV       -------------M--------MNMQSMMKQ---AQKLQKQME----KGQAELAATEFTG
Y1598_STRT2      -------------M--------MNMQNMMKQ---AQKLQKQME----KSQAELAATTFTG
Y1560_STRTD      -------------M--------MNMQNMMKQ---AQKLQKQME----KSQAELAATTFTG
Y1598_STRT1      -------------M--------MNMQNMMKQ---AQKLQKQME----KSQAELAATTFTG
Y194_STRSY       -------------M--------MNMQNMMRQ---AQKLQKQME----KSQAELAATQFTG
Y195_STRS2       -------------M--------MNMQNMMRQ---AQKLQKQME----KSQAELAATQFTG
Y558_CHLSY       ----------------------MNQRQLMQM---AQQMQRQMQ----KVQEELAATIVEG
Y522_CHLAA       ----------------------MNQRQLMQM---AQQMQRQMQ----KVQEELAATIVEG
Y3200_CHLAD      ----------------------MNQRQLMQM---AQQMQRQMQ----KVQEELAATIVEG
Y2292_ROSCS      ----------------------MNPRQLEQM---ARQMQKEMM----RIQEELANATVEG
Y1534_ROSS1      ----------------------MNPRQLEQM---ARQMQKEMM----RIQEELANTTVEG
Y1235_THET2      ----------------------MNFQKLLKE---AQKAQKKAA----EVQERLERMTVVG
Y1599_THET8      ----------------------MNFQKLLKE---AQKAQKKAA----EVQERLERMTVVG
Y199_DEIRA       ----------------------MDMKKLMKQ---MQQAQVAAG----KIQDELAAQSVEG
Y243_CORGL       ---------MTQP----------DMSQILAQ---AQQMQAQLQ----AAQQEILATTVVG
Y315_CORGB       ---------MTQP----------DMSQILAQ---AQQMQAQLQ----AAQQEILATTVVG
Y210_COREF       ---------MTQP----------DMSQILAQ---AQQMQAQLQ----AAQQEILASSVVG
Y260_CORDI       ---------MTQP----------DMSQILAQ---AQQMQAKLQ----EAQREILATTVTG
Y2011_CORJK      ---------MSQP----------DMNQLMQQ---AQQMQAQLQ----EAQREIAASTVKG
Y1912_CORU7      ---------MSQP----------NMNDIMAQ---AQRMQKQLQ----EAQAEIVASSIVG
Y143_CORK4       ---------MAEP----------DFNEIMAQ---AQQMQEELQ----RVQGEIAQSEISG
Y4137_RHOOB      ---------MQPGG-------QPDMSQLLAQ---AQQMQQQLM----AAQQEMAEAEVTG
Y4210_RHOJR      ---------MQPGG-------QPDMSALLAQ---AQQMQQQLM----AAQQEMAEAEVTG
Y390_RHOE4       ---------MQPGG-------APDMSALLAQ---AQQMQQQLM----AAQQEMAQAEVTG
Y319_MYCA9       ---------MQPGG-------APDMSALLAQ---AQQMQQQLM----AAQAQIAAAEVTG
Y1287_MYCGI      ---------MQPGG-------QPDMSALLAQ---AQQVQQQLM----EAQEALANAEVHG
Y5528_MYCVP      ---------MQPGG-------QPDMSALLAQ---AQQVQQQLM----EAQEALANAEVNG
Y5272_MYCSJ      ---------MQPGG-------QPDMSALLAQ---AQQMQQQLM----EAQESLANSEVHG
Y4993_MYCSK      ---------MQPGG-------QPDMSALLAQ---AQQMQQQLM----EAQESLANSEVHG
Y4904_MYCSS      ---------MQPGG-------QPDMSALLAQ---AQQMQQQLM----EAQESLANSEVHG
Y294_NOCFA       ---------MQPGG-------QFDMQQLLAQ---AQQMQEAVM----QAQAEIAATEVEG
Y3743_MYCBO      ---------MQPG---------GDMSALLAQ---AQQMQQKLL----EAQQQLANSEVHG
Y3776_MYCBP      ---------MQPG---------GDMSALLAQ---AQQMQQKLL----EAQQQLANSEVHG
Y3753_MYCTA      ---------MQPG---------GDMSALLAQ---AQQMQQKLL----EAQQQLANSEVHG
Y3778_MYCBT      ---------MQPG---------GDMSALLAQ---AQQMQQKLL----EAQQQLANSEVHG
Y3716_MYCTU      ---------MQPG---------GDMSALLAQ---AQQMQQKLL----EAQQQLANSEVHG
Y2330_MYCLE      ---------MQPG---------GDMSALLAQ---AQQMQQKLL----ETQQQLANAQVHG
Y2330_MYCLB      ---------MQPG---------GDMSALLAQ---AQQMQQKLL----ETQQQLANAQVHG
Y317_MYCPA       ---------MQPGP-------GGDMSALLAQ---AQQMQQKLM----EAQQQLANAEVHG
Y4556_STRAW      ---------MIPGGG------QPNMQQLLQQ---AQKMQQDLA----NAQEELARTEVEG
Y3378_STRGG      ---------MIPGGG------QPNMQQLLQQ---AQKMQQDLA----AAQEELARTEVDG
Y3619_STRCO      ---------MIPGGG------QPNMQQLLQQ---AQKMQQDLA----KAQEELARTEVDG
Y254_SACEN       ---------MQPGG-------QPNMQQIMEQ---AQKMQQQLM----TAQQELAEAEVSG
Y045_THEFY       ---------MNPGG-------GLDMQAILQQ---AQQMQQQLM----AAQQELDETKVTG
Y205_CUTAK       ---------MTTGGFDLG---GLDIGALLAQ---AQSVQNQLE----AAQNQLAESNFEG
Y318_NOCSJ       ---------MSQNPFEALGGGGFDMNALLQQ---AQQMQEQLQ----SAQERLTETVVDG
Y834_CHLP8       -------------------MAMPNFGDMMKQ---LQEAGAKMQ----DVQKQLEKLVSEG
Y805_CHLTE       -------------------MAMPNFGDMMKQ---LQEAGAKMQ----DLQKQLEKLVSEG
Y1171_CHLPD      -------------------MGMPNLGDMMKQ---IQQAGEKMQ----DVQKQLEKIVAYG
Y1174_PELPB      -------------------MAMPNLGDMMKQ---IQQAGEKMQ----DVQKQLEKIVAHG
Y875_CHLL2       -------------------MGMPNLGDMMKQ---IQKAGEKMQ----DVQNQLEKLVAHG
Y1190_CHLCH      -------------------MAMPNLGDMMKQ---IQQAGEKMQ----EVQKQLERLVAHG
Y1285_CHLL3      -------------------MGMPNFGDMMKQ---IQQAGEKMQ----DVQKQLEKLVTSG
Y1034_CHLPM      -------------------MEMPNLGDMMKQ---IQQAGAKMQ----DVQKQLEKTVTHG
Y1179_CHLPB      -------------------MAMPNFNDMMKQ---LQQAGAKMQ----DVQKQLEKITAVG
Y1157_CHLT3      -------------------MQLGDMSAMLKQ---VQQMSEKMQ----EAQKQLESMTAIG
Y1227_AKKM8      ----------------------MNIMKMMKQ---VQQMQAGLA----AAQEKLASQTVTT
Y1429_DESPS      ----------------------MDISKLMQQ---AKDMQGKMA----AIQEDLAKKIITG
Y3467_GLUDA      ---------------------MKNLAGLMKQ---ATQMQARME----EMQSKLEGMTIEG
Y260_GRABC       ---------------------MKNLAGLMKQ---ASQMQAKMG----EMQAKLETVEAEG
Y1999_ACICJ      ---------------------MKNLAGLMKQ---AQQMQQNMQ----EMQTRLEAMEIRG
Y603_GLUOX       ---------------------MKNLAGLMKQ---ASQMQAKME----AAQSNLASLIVDG
Y4104_MAGSA      ---------------------MKNLGNLMKQ---AQQMQSKMA----EMQATMAEMEVTG
Y2305_RHOCS      ---------------------MKNLGNMMKQ---AQQMQARMQ----EMQSKLAEVEVNG
Y3472_RHORT      ---------------------MKNIGQMLKQ---AQQLQTRMA----EVQEELKAMDVSG
Y268_CAUVC       ---------------------MKDLGGLMKQ---AQAMQQKLA----DAQARLAETTVDG
Y269_CAUVN       ---------------------MKDLGGLMKQ---AQAMQQKLA----DAQARLAETTVDG
Y4574_CAUSK      ---------------------MKDLGGLMKQ---AQAMQQKLA----DAQARLAELTVEG
Y369_PHEZH       ---------------------MKDLNSLMKQ---AQAMQQKLA----DAQGRIAEMEVEG
Y436_MARMM       ---------------------MKDLMGLMKQ---AQAMQQKMT----EAQARLAETEVTG
Y371_HYPNA       ---------------------MKDLAQIMQQ---AQAMQAKMA----EVQQKIENTEADG
Y095_AGRFC       ---------------------MRDIMGMMGK---VKEMQSKME----KVQQEIAALEIEG
Y231_RHIME       ---------------------MRDIMGMMGK---VKEMQAKME----KMQAEIAALEIDG
Y5504_RHILO      ---------------------MKDLLGLMGK---AKEMQAKFQ----AMQDEIATVESVG
Y033_BRUAB       ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y030_BRUA2       ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y033_BRUSU       ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y035_BRUSI       ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y290_BRUA1       ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y034_BRUC2       ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y1909_BRUME      ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y033_BRUO2       ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y033_BRUMB       ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y022_BRUA4       ---------------------MRDMMGMMKQ---AKELQAKMK----AMQDEIATMEASA
Y231_BARHE       ---------------------MRDMMNMMKK---AKEMQEKMQ----KIQEEMANLQVTG
Y219_BARQU       ---------------------MRDMMSMMKK---AKEIQEKMQ----QIQEEMTNLQMIG
Y257_BART1       ---------------------MREMMSMMKK---AKEMQERMQ----KIQEEMANLQATG
Y1239_BARBK      ---------------------MNDMTNIMKK---AKEMQQKMQ----QIQDEMVNLKVTG
Y7345_BRASB      ---------------------MADFLGMMKQ---AAQLQSKMQ----AMQEELGSLEVEG
Y764_BRASO       ---------------------MADFLGMMKQ---AAQLQSKMQ----EMQAELGNVEVEG
YUD3_BRADU       ---------------------MADFLGMMKQ---AAQLQSKMQ----EMQDALGNVEVEG
Y463_NITHX       ---------------------MADFLGMMKQ---AAQLQSKMK----AMQDELDHVEVEG
Y368_NITWN       ---------------------MADFLGMMKQ---AAQFQSKMK----AMQDELDQIEVDG
Y616_RHOPA       ---------------------MADFLGMMKQ---AAQLQSKMK----AMQAELDQIEVEG
Y620_RHOPT       ---------------------MADFLGMMKQ---AAQLQSKMK----AMQAELDQIEVEG
Y086_RHOPS       ---------------------MADFLGMMKQ---AAQLQSKMK----AMQAELDQIEVEG
Y667_RHOP2       ---------------------MADFLGMMKQ---AAQLQSKMK----AMQAELDQIEVEG
Y4812_RHOP5      ---------------------MADFLGMMKQ---AAQLQSKMK----EMQSELDRIEVEG
Y4847_RHOPB      ---------------------MADFLGMMKQ---AAQLQSKMK----AMQEELEHIEVEG
Y7544_AFIC5      ---------------------MADFLGMMKQ---AAQLQSKMK----EMQEQLDQVEVEG
Y1981_DICT6      ---------------------MKNPFEAMKQ---LKKLQEKMA----KIEEELEQTLVEG
Y258_DICTD       ---------------------MKNPFEAMKQ---LKKLQEKMA----KIEEELEQTLVEG
Y255_BEII9       ---------------------MKDMMGLLKQ---AQAMQAKVQ----DMQAALEQITVEG
Y275_METSB       ---------------------MRDMLGLMKQ---AQAMQEKIQ----QMQAEIERLEVEG
Y1224_RICAE      ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMANARYTG
Y1337_RICCN      ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMANARYTG
Y7555_RICPU      ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMANARYTG
Y1562_RICRO      ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMANARYTG
Y7310_RICRS      ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMANARYTG
Y1365_RICFE      ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMANARYTG
Y866_RICPR       ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMANTRYTG
Y857_RICTY       ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMANTRYTG
Y6705_RICAH      ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMANARYTG
Y5550_RICCK      ---------------------MVNFNQFLKQ---AQSMQKKMQ----EAQEQMVNARYTG
Y660_RICB8       ---------------------MVNFNQFLKQ---AQTMQKKMQ----EAQEQMANTRYTG
Y048_RICBR       ---------------------MVNFNQFLKQ---AQTMQKKMQ----EAQEQMANTRYTG
YBAB_SALHS       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALNS       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALG2       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALEP       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALDC       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALCH       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALAR       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALA4       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SHISS       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SHIF8       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SHIFL       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SHIDS       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SHIBS       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SHIB3       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALTY       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALTI       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALSV       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALPC       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALPB       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECO81       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOHS       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOL5       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECO7I       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECO45       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOL6       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOSE       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOSM       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECODH       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOLI       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOLC       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOBW       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECO55       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ESCF3       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECO27       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOK1       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECOLU       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECO5E       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECO57       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECO8A       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_ECO24       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVIG
Y2800_CROS8      -----------------MFGGKGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
Y951_ENT38       -----------------MFGGKGGLGGLMKQ---AQQMQEKMQ----KAQEEIAQLEVTG
Y4227_KLEP3      -----------------MFGGKGGLGNLMKQ---AQQMQDKMQ----KMQEEIAQLEVTG
Y444_KLEP7       -----------------MFGGKGGLGNLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
YBAB_SALPA       -----------------MFG-KGGLGNLMKQ---AQQMQKKMQ----KMQEEIAQLEVTG
YBAB_SALPK       -----------------MFG-KGGLGNLMKQ---AQQMQKKMQ----KMQEEIAQLEVTG
Y2678_CITK8      -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----QMQEEIAKLEVTG
Y1109_EDWI9      -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----KMQEEIALVEVTG
Y3840_PHOLL      -----------------MFG-KGGLGNLMKQ---AQQMQDKMQ----KMQEEIASLEVTG
Y1177_PECAS      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVANLEVTG
Y1077_PECCP      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVANLEVTG
Y3121_YERPE      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y2758_YERPP      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y3197_YERPY      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y2890_YERPG      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y2615_YERPA      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y967_YERPN       -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y993_YERPS       -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y1036_YERPB      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y3058_YERP3      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y3092_YERE8      -----------------MFG-KGGIGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y1136_SERP5      -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----QMQEEVAKLEVTG
Y140_PROMH       -----------------MFG-KGGLGNLMKQ---AQQMQEKMQ----QMQEEIANLEVTG
Y690_SODGM       -----------------MFG-KGGMGNLMKQ---AQQMQEKMQ----RMQEEIAQLEVTG
Y075_ACTPJ       -----------------MFG-KGGLGGLMKQ---AQQMQERMQ----KMQEEIAQLEVTG
Y075_ACTP2       -----------------MFG-KGGLGGLMKQ---AQQMQERMQ----KMQEEIAQLEVTG
Y075_ACTP7       -----------------MFG-KGGLGGLMKQ---AQQMQERMQ----KMQEEIAQLEVTG
Y1040_HAEPS      -----------------MFG-KGGLGGLMKQ---AQQMQERMQ----KMQEEIAQLEVTG
Y780_HAEIE       -----------------MFG-KGGLGGLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
Y5435_HAEIG      -----------------MFG-KGGLGGLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
Y442_HAEIN       -----------------MFG-KGGLGGLMKQ---AQQMQEKMQ----KMQEEIAQLEVTG
Y1309_HAES1      -----------------MFG-KGGLGNLMKQ---AQQMQERMQ----KMQEEIAQLEVTG
Y308_HISS2       -----------------MFG-KGGLGNLMKQ---AQQMQERMQ----KMQEEIAQLEVTG
Y997_ACTSZ       -----------------MFG-KGGLGGLMKQ---AQQMQERMQ----KMQDEIAQLEVTG
Y326_HAEDU       -----------------MFG-KGGLGNLMKQ---AQQMQERMQ----KMQEEIAQLEVTG
Y1507_MANSM      -----------------MFG-KGGLGNLMKQ---AQQMQERMQ----KMQEEIAQLEVTG
Y205_PASMU       -----------------MFG-KGGLGNLMKQ---AQQMQDRMQ----KMQEEIAQLEVTG
Y426_BUCBP       -----------------MFS-KDGLNNLMQH---AQKIQEQMK----KIQQEVSEIEVTG
YGG0_WIGBR       ------------------------MNKLMKQ---AQKIQEKMK----LIQEEISKLEAIG
Y116_BAUCH       -----------------MFS-KSGMSDLMKH---AQRMQEQMQ----QMQGEIAKLEVNG
Y482_BUCAI       -----------------MFT-KGGLGNLMKQ---AQQMQEKMA----KIQEEIAQMEVTG
Y475_BUCA5       -----------------MFT-KGGLGNLMKQ---AQQMQEKMA----KIQEEIAQMEVTG
Y476_BUCAT       -----------------MFT-KGGLGNLMKQ---AQQMQEKMA----KIQEEIAQMEVTG
Y467_BUCAP       -----------------MFT-KGGLGNLMKQ---AQQMQEKMA----KVQEEIAKMEVTG
Y2473_ERWT9      -----------------MFG-KAGLGNLMKQ---AQQMQEKMA----QVQEEIAEMEVTG
Y1686_ALIF1      -----------------MFGGKGGMGNLMKQ---AQQMQDRMQ----KMQEEIANMEVTG
Y1810_ALIFM      -----------------MFGGKGGMGNLMKQ---AQQMQDRMQ----KMQEEIANMEVTG
Y1086_ALISL      -----------------MFGGKGGMGNLMKQ---AQQMQDRMQ----KMQEEIGNMEITG
Y2004_VIBVU      -----------------MFG-KGGMGNLMKQ---AQQMQERMQ----KLQEEIAXMEVVG
Y2410_VIBVY      -----------------MFG-KGGMGNLMKQ---AQQMQERMQ----KLQEEIANMEVVG
Y1055_VIBCH      -----------------MFG-KGGMGNLMKQ---AQQMQERMQ----KLQEEIANMEVTG
Y2178_VIBPA      -----------------MFG-KGGMGNLMKQ---AQQMQERMQ----KLQEEIANMEVTG
Y917_VIBA3       -----------------MFG-KGGMGNMMKQ---AQQMQERMQ----KLQEEIANMEVTG
Y3086_VIBCB      -----------------MFG-KGGMGNLMKQ---AQQMQDRMQ----KLQEEIANMEVTG
Y2216_TOLAT      -----------------MFG-KGGMGNLMKQ---AQMMQERMQ----KMQEEVAKMEVTG
Y2301_SHEPC      -----------------MFG-KGGMGNLMKQ---AQMMQEKMA----KMQEEIARMEMVG
Y1707_SHESW      -----------------MFG-KGGMGNLMKQ---AQMMQEKMA----KMQEEIARMEMVG
Y2014_SHEON      -----------------MFG-KGGMGNLMKQ---AQMMQERMA----KMQEEIARMEMVG
Y1770_SHEB2      -----------------MFG-KGGMGNLMKQ---AQMMQEKMA----KVQEEIARMEMVG
Y2380_SHEDO      -----------------MFGGKGGMGNLMKQ---AQMMQDKMA----KMQEEIARMEITG
Y2406_SHEFN      -----------------MFGGKGGMGNLMKQ---AQMMQDKMA----KVQEEIARTEMTG
Y1591_SHEHH      -----------------MFG-KGGMGNLMKQ---AQQMQDKMA----KVQEEIARMEVTG
Y1509_SHEPA      -----------------MFG-KGGMGNLMKQ---AQMMQDKMA----KVQEEIARMEVTG
Y1717_SHEPW      -----------------MFG-KGGMGNLMKQ---AQQMQDKMA----KVQEEIARMEVTG
Y1794_SHEWM      -----------------MFG-KGGMGNLMKQ---AQQMQDKMA----KVQEEIARMEVTG
Y2851_SHESH      -----------------MFG-KGGMGNLMKQ---AQQMQDKMA----KVQEEIARMEVTG
Y2234_SHELP      -----------------MFG-KGGMGNLMKQ---AQMMQDKMA----KVQEEIARMEVTG
Y1311_SHEAM      -----------------MFG-KGGMGNLMKQ---AQMMQEKMA----KMQEEIARMEVTG
Y1612_MARHV      -----------------MMN-N--MGDLMKK---AQQMQEQMQ----KAQEEIAKAEVTG
Y2276_PSYIN      -----------------MFS-KEGMGDLMKK---AQEMQENMK----KAQAEIANTEVTG
Y2212_AERHH      -----------------MFG-KGGMGNLMKQ---AQQMQERMQ----KMQEQLAQMEVVG
Y2087_AERS4      -----------------MFG-KGGMGNLMKQ---AQQMQERMQ----KMQEQLAEMEVVG
Y3743_COLP3      -----------------MM--KGGMGNLMKQ---AQQMQAKMA----KAQEELAQMEVVG
Y1098_ALTMD      -----------------MF--KGGMGNIMKQ---AQQMQERMQ----KVQDDLANLEVTG
Y1202_PSET1      -----------------MF--KGGMGNMMKQ---AQQMQDRMQ----KAQDEIATLEVVG
Y1848_IDILO      -----------------MF--KGGMGNMMKQ---AQQMQERMQ----QAQEEVANMEVTG
Y2533_MARMS      -----------------MF--KGGMGNMMRQ---AQQMQENMQ----KAQEEIANMEVEG
Y1459_CHRSD      -----------------MM--KGGMGNLMKQ---AQEMQEKMQ----KIQEEIAETEVTG
Y1509_ALKEH      --------------------MRGGIGNMMKQ---AQKLQEELK----KAQEEIAKMEVTG
Y231_HALHL       --------------------MKGGLGNIMKQ---AQKMQEDMQ----KAQEEIAAMEVSG
Y1920_ACIF2      --------------------MKGGLGNIMKQ---AQQLQERLQ----KTQEELAQVEVQG
Y1592_ACIF5      --------------------MKGGLGNIMKQ---AQQLQERLQ----KTQEELAQVEVQG
Y2594_NITOC      --------------------MKGGLGNLMKQ---AQQLQSNME----KAQEELANMEVTG
Y639_AROAE       -------------------MMKGGIAGLMKQ---AQQMQENMK----KMQDQLASVEVEG
Y807_DECAR       -------------------MMKGGLAGLMKQ---AQAMQENMK----KAQEQLAQVEVEG
Y1611_CHRVO      ------------------MFGKAGIAGLMKQ---AQQMQENMK----KAQEELAKVEVEG
Y434_NITEU       --------------------MKANLGNLMKQ---AQQMQENMK----AMQEKLAAIEVEG
Y591_NITEC       --------------------MKANLGNLMKQ---AQQMQENMK----AMQEKLATIEVEG
Y1439_BORBR      -------------------MMKGQLAGLMRQ---AQQMQENMK----KAQDALAEIQVEG
Y1222_BORPA      -------------------MMKGQLAGLMRQ---AQQMQENMK----KAQDALAEIQVEG
Y1550_BORPE      -------------------MMKGQLAGLMRQ---AQQMQENMK----KAQDALAEIQVEG
Y915_BORA1       -------------------MMKGQLAGLMRQ---AQQMQENMK----KAQDALADILVEG
Y3552_BORPD      -------------------MMKGQLAGLMRQ---AQQMQENMK----KAQDALAEIIVEG
Y1764_BURCM      -------------------MLKGNLAGLMKQ---AQQMQENMK----KMQEQLAQIEVEG
Y1737_BURA4      -------------------MLKGNLAGLMKQ---AQQMQENMK----KMQEQLAQIEVEG
Y1753_BURVG      -------------------MLKGNLAGLMKQ---AQQMQENMK----KMQEQLAQIEVEG
Y6253_BURCA      -------------------MLKGNLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y5127_BURL3      -------------------MLKGNLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y1861_BURCJ      -------------------MLKGNLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y1826_BURCH      -------------------MLKGNLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y1850_BURCC      -------------------MLKGNLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y1796_BURM1      -------------------MLKGNLAGLMKQ---AQQMQENMR----KMQEQLAQIEVEG
Y1499_BURPS      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y2243_BURP0      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y2372_BURP1      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y2205_BURP6      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y1360_BURMA      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y2346_BURM9      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y3622_BURM7      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y3650_BURMS      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y2220_BURTA      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y1827_PARPJ      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y2072_PARXL      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLALIEVEG
Y952_PARP8       -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLAQIEVEG
Y1036_RALPJ      -------------------MMKGQIAGLMKQ---AQQMQENMK----KAQEQLALIEVEG
Y1192_RALSO      -------------------MMKGQIAGLMKQ---AQQMQENMK----KMQEQLSQIEVEG
Y1934_CUPTR      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLAQIEVEG
Y2111_CUPPJ      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLAQIEVEG
Y2128_CUPMC      -------------------MMKGQLAGLMKQ---AQQMQENMK----KMQEQLAQIEVEG
Y1046_HERAR      -------------------MMKNQLAGLMKQ---AQAMQDNMK----KMQEQLALIEVEG
Y2329_JANMA      -------------------MMKNQLAGLMKQ---AQAMQDNMK----KMQDQLASIEVEG
Y1975_LEPCP      -------------------MIKGQLAGLMKQ---AQAMQDNLK----KAQDELANVEVEG
Y2533_METPP      -------------------MLKGQLAGLMKQ---AQAMQDNLK----KAQDELALIEVEG
Y1533_PSEAE      -------------------MMKGGMAGLMKQ---AQQMQEKMQ----KMQEELANAEVTG
Y3795_PSEA8      -------------------MMKGGMAGLMKQ---AQQMQEKMQ----KMQEELANAEVTG
Y4462_PSEAB      -------------------MMKGGMAGLMKQ---AQQMQEKMQ----KMQEELANAEVTG
Y1786_PSE14      -------------------MMKGGMAGLMKQ---AQQMQEKMA----KMQEELANAEVTG
Y1826_PSEU2      -------------------MMKGGMAGLMKQ---AQQMQEKMA----KMQEELANAEVTG
Y3645_PSESM      -------------------MMKGGMAGLMKQ---AQQMQEKMA----KMQEELANAEVTG
Y2646_PSEMY      -------------------MMKGGMAGLMKQ---AQQMQEKMQ----KMQEELANAEVTG
Y1984_AZOVD      -------------------MMKGGMAGLMKQ---AQLMQEKMQ----KLQEEIANAEVTG
Y1600_PSEP1      -------------------MMKGGMAGLMKQ---AQQMQEKMQ----KMQEELANAEVTG
Y3833_PSEPG      -------------------MMKGGMAGLMKQ---AQQMQEKMQ----KMQEELANAEVTG
Y4268_PSEPK      -------------------MMKGGMAGLMKQ---AQQMQEKMQ----KMQEELANAEVTG
Y3586_PSEPW      -------------------MMKGGMAGLMKQ---AQQMQEKMA----KMQEELANAEVTG
Y1789_PSEE4      -------------------MMKGGMAGLMKQ---AQQMQEKMQ----KMQEELANAEVTG
Y1905_PSEF5      --------------------MKGGMAGLMKQ---AQQMQEKMA----KMQEELANAEVTG
Y4577_PSEFS      -------------------MMKGGMAGLMKQ---AQQMQEKMA----KMQEELANAEVTG
Y1806_PSEPF      -------------------MMKGGMAGLMKQ---AQQMQEKMA----KMQEELANAEVTG
Y645_POLNS       -------------------MMKGGLAGLMKQ---AQQMQEKMK----TTQAELAALEVTG
Y701_POLAQ       -------------------MMKGGLAGLMKQ---AQQMQEKMK----TAQAELAALEVNG
Y1015_STRMK      --------------------MRGNIAQLMQQ---AQKMQENLQ----KAQEEIAKIEVTG
Y858_STRM5       --------------------MRGNIAQLMQQ---AQKMQENLQ----KAQEEIAKIEVTG
Y1065_XANOR      --------------------MRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y965_XANOM       --------------------MRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y1110_XANAC      --------------------MRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y1128_XANC5      --------------------MRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y1002_XANCP      --------------------MRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y3243_XANC8      --------------------MRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y3358_XANCB      --------------------MRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y1216_XYLFM      -------------------MMRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y1122_XYLF2      -------------------MMRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y1058_XYLFT      --------------------MRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y1808_XYLFA      -------------------MMRGNIAQLMQQ---AQKMQENLQ----RAQEELAKLEVTG
Y1499_FRATF      --------------------MNFDMSKLMQQ---AQKMQEQMK----KAQQERENMEVIG
Y1411_FRATH      --------------------MNFDMSKLMQQ---AQKMQEQMK----KAQQERENMEVIG
Y1374_FRATO      --------------------MNFDMSKLMQQ---AQKMQEQMK----KAQQERENMEVIG
Y810_FRATT       --------------------MNFDMSKLMQQ---AQKMQEQMK----KAQQERENMEVIG
Y810_FRAT1       --------------------MNFDMSKLMQQ---AQKMQEQMK----KAQQERENMEVIG
Y1023_FRATM      --------------------MNFDMSKLVQQ---AQKMQEQMK----KAQQERENMEVIG
Y607_FRATW       --------------------MNFDMSKLMQQ---AQKMQEQMK----KAQQERENMEVIG
Y1196_FRATN      --------------------MNFDMSKLMQQ---AQKMQEQMK----KAQQERENMEVIG
Y120_FRAP2       --------------------MNFDMSKLMQQ---AQKMQEQMK----KAQQERENMEVIG
Y1774_ALCBS      --------------------MDFDINNLMQQ---AQAMQEKMK----KMQDEAANAEVVG
Y3038_LEGPC      ------------------MDINQNLGNLMKE---AQKMQQRMQ----EAQQQLSQLVVSG
Y2672_LEGPL      ------------------MDINQNLGNLMKE---AQKMQQRMQ----EAQQQLSQLVVSG
Y2803_LEGPA      ------------------MDINQNLGNLMKE---AQKMQQRMQ----EAQQQLSQLVVSG
Y2755_LEGPH      ------------------MDINQNLGNLMKE---AQKMQQRMQ----EAQQQLSQLVVSG
Y2614_HAHCH      -------------------MIKGNMGDLMKQ---AQKIQEQMQ----KAQEELANAEVSG
Y1327_METCA      --------------------MKNPLANLMQQ---AQRFQETFQ----KTQEEIAATEIQA
Y742_NEIG1       -----------------MFG-KAGLGGLMKQ---AQQMQENMK----KAQAKLAETEIEG
Y1136_NEIG2      -----------------MFG-KAGLGGLMKQ---AQQMQENMK----KAQAKLAETEIEG
Y1444_NEIMB      -----------------MFG-KAGLGGLMKQ---AQQMQENMK----KAQAKLAETEIEG
Y1380_NEIMF      -----------------MFG-KAGLGGLMKQ---AQQMQENMK----KAQAKLAETEIEG
Y1657_NEIMA      -----------------MFG-KAGLGGLMKQ---AQQMQENMK----KAQAKLAETEIEG
Y1355_NEIM0      -----------------MFG-KAGLGGLMKQ---AQQMQENMK----KAQAKLAETEIEG
Y1909_ACIB5      ----------------------MNINMLMQQ---AQRMQKDMESNIKKAKEELAQTEVHA
Y1813_ACIB3      ----------------------MNINMLMQQ---AQRMQKDMESNIKKAKEELAQTEVHA
Y1718_ACIBC      ----------------------MNINMLMQQ---AQRMQKDMESNIKKAKEELAQTEVHA
Y1684_ACIBT      ----------------------MNINMLMQQ---AQRMQKDMESNIKKAKEELAQTEVHA
Y1967_ACIBY      ----------------------MNINMLMQQ---AQRMQKDMESNIKKAKEELAQTEVHA
Y1914_ACIBS      ----------------------MNINMLMQQ---AQRMQKDMESNIKKAKEELAQTEVHA
Y793_PSYA2       ----------------------MNIQALMQQ---AQTMQKKVEANVENAKKDLANKEVHA
Y799_PSYCK       ----------------------MNIQALMQQ---AQTMQKKVEANVENAKKELGNKEVHA
Y1729_PSYWF      ----------------------MNIQALMQQ---AQAMQKQVEANVEKAKKELADKEVQA
Y656_COXBU       -----------------MIGGKFNLGSLMKN---AKKIQEMMQ----KAQDELAKIRVTG
Y1351_COXB2      -----------------MIGGKFNLGSLMKN---AKKIQEMMQ----KAQDELAKIRVTG
Y772_COXBR       -----------------MIGGKFNLGSLMKN---AKKIQEMMQ----KAQDELAKIRVTG
Y1603_COXB1      -----------------MIGGKFNLGSLMKN---AKKIQEMMQ----KAQDELAKIRVTG
Y666_COXBN       -----------------MIGGKFNLGSLMKN---AKKIQEMMQ----KAQDELAKIRVTG
Y701_BUCCC       ------------------MYTKEKINELMEK---AQVMKKEME----KIQKDIKMTKIKG
Y5067_NOSS1      -------MTGKGQGFGFGLGKMKELAEAFKK---AQQVQEGAK----RLQEELEQMEIQG
Y2322_TRIV2      -------MTGKGQGFGFGLGKMKELAEAFKK---AQQVQEGAK----RLQEELEQMEILG
Y448_NOSP7       -------MTGKGQGFGFGLGKMKELADAFKK---AQQVQEGAK----RLQEELEQMEILG
Y899_CYAP4       -------MTQ-GQGFGFGLGKMKELAAAIQK---AQQVQEGAK----KLQEDLEKMEIEG
Y723_THEEB       -------MAQ-GQGFGFGLGKMKELAAAIQK---AQQVQEGAK----KLQEDLERMDIEG
Y464_SYNE7       ---------MAGKGFGFSLGKMKELADAFKK---AQQVQEGAK----QVQEDLNNMEIEG
Y1054_SYNP6      ---------MAGKGFGFSLGKMKELADAFKK---AQQVQEGAK----QVQEDLNNMEIEG
Y2224_GLOC7      -------MAQ-GKGFGFGLGKIKELQEAFQK---AQQVQEGAK----QLQDELEQMSIEG
Y1847_SYNY3      -------MAQ-GKGFGFGLGKIKELQEAFQK---AQQVQEGAK----VLQEELERMEIPG
Y2554_RIPO1      -------MTK-GQGFGFGLGKIKELQEAFAK---AQQVQAGAQ----QLQQELEQMEIEG
Y2391_MICAN      -------MAQ-GQGFGFGLGKIKELQDAFQK---AQQVQQGAK----VLQEELENMEIPG
Y020_PROMA       -------------MAGFGLPNFGQITEAFKK---AQQIQQDAQ----KLQEELDDMELEG
Y020_PROM4       -------------MAAFGLPNFGQLTEAFKK---AQQIQQDAQ----KLQEELDAMELEG
Y024_PROM3       -------------MAGFGLPNFGQLTEAFRK---AQQIQQNAQ----KLQEELDAMEIEG
Y025_PROMM       -------------MAGFGLPNFGQLTEAFRK---AQQIQQNAQ----KLQEELDAMEIEG
Y026_SYNS3       -------------MAGFGLPNFGQLTEAFRK---AQQIQQDAQ----KLQEELDAMEIEG
Y026_SYNPW       -------------MAGFGLPNFGQLTEAFRK---AQQIQQDAQ----KLQEELDAMEIEG
Y027_SYNSC       -------------MAGFGLPNFGQLTEAFKK---AQEIQQNAQ----ALQDELDGMEIEG
Y027_SYNPX       -------------MAGFGLPNFGQLTEAFKK---AQEIQQNAQ----ALQDELDGMEIEG
Y023_SYNS9       -------------MAGFGLPNFGQLTEAFRK---AQQIQQDAQ----ALQEELDGMEIEG
Y025_SYNR3       -------------MAGFGLPNFGQLTEAFKK---AQQIQQDAQ----KLQEELDAMEIEG
Y019_PROM1       -------------MAGFGLPNFGQLTEAFKK---AQQIQQNAQ----KLQEELEVMEIEG
Y1347_PROMT      -------------MAGFGLPNFGQLTEAFKK---AQQIQQNAQ----KLQEELEVMEIEG
Y019_PROMS       -------------MAGFGLPNFGQLTEAFKK---AKQIQQDAQ----KLQDELENMEIEG
Y019_PROM2       -------------MAGFGLPNFGQLTEAFKK---AKQIQQDAQ----KLQDELENMEIEG
Y019_PROM0       -------------MAGFGLPNFGQLTEAFKK---AKQIQQDAQ----KLQDELENMEIEG
Y020_PROM9       -------------MAGFGLPNFGQLTEAFKK---AKQIQQDAQ----KLQDELENMEIEG
Y019_PROM5       -------------MAGFGLPNFGQLTEAFKK---AKEIQQNAQ----KLQDELESMEIEG
Y020_PROMP       -------------MAGFGLPNFGQLTEAFKK---AKEIQQNAQ----KLQDELESMEIEG
Y2894_SYNJB      --------------MTRGFGPFGKIQEALKK---AQEVRDGAQ----RLQKELEEMEIVG
Y1369_SYNJA      --------------MTRGFGPFGKIQEALKK---AQEVRDGAQ----RLQKELEEMEIVG
Y3498_GLOVI      --------------MSKGFGPMGQFQEALKR---VKQIQEGSA----KLQDELAALSIEG
Y533_PERMH       ------------------MFNLGNLGEMMKM---MKSMQENIE----KAKEELRKEEIVV
Y1366_SULSY      ------------------MFNFGNLAELMKQ---AQSIKENVE----KAKEELKNEKIVV
EBFC_BORBU       --------------------MAVNPLDFLKN---MSSVKNNID----NIKKEISKITVCG
EBFC_BORBZ       --------------------MAVNPLDFLKN---MSSVKNNID----NIKKEISKITVCG
EBFC_BORAP       --------------------MAVNPLDFLKN---MSSVKSNID----NIKKEMSKITVCG
EBFC_BORDL       --------------------MAVNPLDFLKN---MSNFKDNID----NIKKEISQIVVCG
EBFC_BORRA       --------------------MAVNPLDFLKN---MSNFKDNID----NIKKEISQIVVCG
EBFC_BORHD       --------------------MAVNPLDFLKN---MTSFKDNID----NLKKEMSQIVVCG
EBFC_BORT9       --------------------MAVNPLDFLKN---MSGFKDNID----NFKKEISQIVVCG
Y3002_LEPBJ      -----------------MLDKIKNLSELLSN---MGALREKME----DVKKRIASIRVVG
Y065_LEPBL       -----------------MLDKIKNLSELLSN---MGALREKME----DVKKRIASIRVVG
Y4332_LEPIN      -----------------MFDKIKNFSEILSN---MGSFREKME----EVKKRIASIRVVG
Y3475_LEPIC      -----------------MFDKIKNFSEILSN---MGSFREKME----EVKKRIASIRVVG
Y335_CHLTR       --------------------MGSGYAKKKKE---AKLMERQFM----EMEASLEQKRFSG
Y363_CHLTA       --------------------MGSGYAKKKKE---AKLMERQFM----EMEASLEQKRFSG
Y589_CHLT2       --------------------MGSGYAKKKKE---AKLMERQFM----EMEASLEQKRFSG
Y586_CHLTB       --------------------MGSGYAKKKKE---AKLMERQFM----EMEASLEQKRFSG
Y612_CHLMU       --------------------MGSGYAKKKKE---AKLMERQFM----EMEASLEQKRFSG
Y330_CHLCV       --------------------MGSGYAKKKKE---AKIMEQQFL----EMEASLEQKRYEG
Y672_CHLFF       --------------------MGSGYAKKKKE---AKIMEQQFL----EMEASLEKKRYEG
Y326_CHLAB       --------------------MGSGYAKKKKE---AKMMEQQFL----EMEASLEKKHYEG
Y039_CHLPN       --------------------MGSGYAKKKKE---AKIMEQQFL----EMEASLLEKRYEG
Y477_PARUW       --------------------MGTGFSKKKKE---ARLIQQQMS----LVQNELQNLEVVG
Y429_ARCB4       ------------------MFDGLDLKNLNLG-DMLNQFQDMAK----NAQNENASRIFTS
Y200_CAMHC       ------------------MFEGFDLSKMN---EMLGDLQKKAQ----QMENENANREFSV
Y1848_CAMC1      ------------------MFEGFDFSKMGQM---LEDVQKQAK----QMEEESKNKEFGA
Y1819_CAMC5      ------------------MFEGFDFSKMGEV---LEKAKEQAA----ALEAESLNKEFGA
Y066_CAMFF       ------------------MFKDFDFSKMGEM---LSEAQKKAA----EFENEIAAKEFVA
Y1642_CAMJE      ----------------------MDFSKMGEL---LNQVQEKAK----NIELELANREFSA
Y113_CAMLR       ------------------MFENMDFSKMGEL---LTKAQEKAN----ELEQEALKKEFSA
Y1681_WOLSU      ---------------------MFDPSKLSEM---LTQFQDKAK----EMEEKSHNTSFTA
Y2278_SULNB      ------------------MFEGMDLGKMGKM---MEQMQEKAK----ELQEQAKNVEFTA
Y256_NITSB       ------------------MFDKMNLGDLGKV---FEEIQERAK----KLQEEQESKSFIA
Y035_HELPY       ----------------------MDFSQLGGL---LDGMKKEFS----QLEEKNKDTIHTS
Y033_HELPH       ----------------------MDFSQLGGL---LDGMKKEFS----QLEEKNKDTIHTS
Y031_HELP2       ----------------------MDFSQLGGL---LDGMKKEFS----QLEEKNKDTIHTS
Y175_HELPS       ----------------------MDFSQLGGL---LDGMKKEFS----QLEEKNKDTIHTS
Y048_HELAH       ----------------------MDFSQLSGL---LDGVKKEFS----QLEEKNKDTIYTS
Y032_HELPG       ----------------------MDFSQLGGLSGLLDGMKKEFS----QLEEKNKDTIHTS
Y031_HELPJ       ----------------------MDFSQLGGLSGLLDGVKKEFS----QLEEKNKDTIHTS
Y332_HELHP       ---------------------MFDAKQLGAM---LGSMQDTIK----DLQERNEQTILSA
Y2555_FLAJ1      ----------------------MDLMGMMGK---LKETQQKIE----DTKKRLDTVLIDE
Y1796_GRAFK      --------------------MFGDMMGMMNK---LKEAQEKVE----ATKKRLDTVLVDE
Y1374_THEAB      ----MKKLKSFGGKNLSG----KSMNQLQKL---QEEMQKKLQ----EVEEGFSNVEVEV
Y542_THEM4       ----MKKLKSFGGKNLGG----KSMNQLQKL---QEEMQKKLQ----EVEEGFSNVEVDV
Y687_THEMA       ----MKKIKSFGGKSLGGGKQEKILKDFARM---QEELQKKIQ----ELEESFSQIEVEA
Y244_THEP1       ----MKKIKSFGGKNLGGGKQEKLLKDFAKM---QEELQKKIQ----ELEESFSQIEVEA
Y1899_THENN      ----MKKIKSFGGKSLGGGKQEKLLKDFMKM---QEELQKKMQ----EMEESFSEMEVEA
Y999_PSELT       ----MKKIKGFGGKSYGK---IDKSSGFEQI---QQKMRDEIE----KLENSFENIEVSS
Y159_MYCA5       ----------------------MNINEMLKK---AKRLQAEME----VEEKEIAKKEFVV
Y050_MYCPU       -------------------MNNMNINEMLKQ---AKKMQSEIE----LKEKELYKKEFTI
Y740_MYCMO       ----------------------MDMKAMLKQ---AQKMQADLE----KKQSELAKKEFNI
Y600_MYCGA       ----------------------MNFQNLANQ---MKKMQREME----KKLAEFEEKEYQY
Y807_MYCPE       ----------------------MNMQKMLQQ---AKALQSKME----KKIKEFEQEEFEF
Y088_UREPA       ----------------------MDFQKLAQE---LKKMQNTLS----KKQKEFEEKVFDF
Y088_UREP2       ----------------------MDFQKLAQE---LKKMQNTLS----KKQKEFEEKVFDF
Y100_UREU1       ----------------------MDFQKLAQE---LKKMQNTLS----KKQKEFEEKVFDF
                                                                             

Y1974_KORVE      TAGGGSVTVKMNGQKQLLSIKIDPEVVKS----------GDVEMLQDLVTAAVNEGSRRV
Y492_ACIC5       SSGGGAVSVKMNGKKELLKLTIDPAAVLSLSGAN-----PDVEMLEDLITAAINEAGRRA
Y3777_ANAD2      ESGGGLVKVAMNGKCEITRLTVDPKAVDP----------NDKALLEDLVTAAVNAAVEKA
Y3694_ANASK      ESGGGLVKVAMNGKCEITRLTVDPKAIDP----------NDKALLEDLVTAAVNAAVEKA
Y3636_ANADE      ESGGGLVKVAMNGKCEVTRLTVDPKAIDP----------NDKAMLEDLITAAVNAAVEKA
Y3761_ANADF      ESGGGLVKVTMNGKCEVTRLLVDPKAVDP----------ADKAMLEDLVTAAVNAAVEKA
Y1931_MYXXD      KAGDGRVTVVANGIQEIRSIKIDKEAIDP----------NDTSMLEDLITAAVNAALASS
Y1069_THEYD      TSGGGMVTVQANGAGEIVSIKIDREVVNP----------DDIEMLEDLVLAAVNEAIKRA
Y1113_GEMAT      LAGGGLVTADVDGKMQLKRIKLDASVVNP----------GDIEMLEDLIVVAVAEAQKKA
Y1672_METI4      ESGGGKVKATVNGEGFLLKMHVDPTLLEA----------KDNEMIEDLIVVAVQAAQEKA
Y4780_ALKMQ      SAGGGAITVKVSGKKEVISIEIKPEVVD------PED----VEMLQDLIMAAVNEAMRGA
Y2855_ALKOO      SAGGGAVSIKITGKKEIVGISIKPEVVD------PDD----VEMLEDLIMAAMNEAIRAA
Y032_CLOBH       TVGGGAVTAVANGKKQIVDIKIEPEVVD------EDD----IEMLEDLIMSACNEALKKA
Y038_CLOBJ       TVGGGAVTAVANGKKQIVDIKIEPEVVD------EDD----IEMLEDLIMSACNEALKKA
Y037_CLOB6       TVGGGAVTAVANGKKQIVDIKIEPEVVD------EDD----IEMLEDLIMSACNEALKKA
Y048_CLOBL       TVGGGAVTAVANGKKQIVDIKIEPEVVD------EDD----IEMLEDLIMSACNEALKKA
Y3166_CLOBM      TVGGGAVTAVANGKKQIVDIKIEPEVVD------EDD----IEMLEDLIMSACNEALKKA
Y043_CLOB1       TVGGGAVTAVANGKKQIVDIKIEPEVVD------EDD----IEMLEDLIMSACNEALKKA
Y785_CLOBK       TVGGGAVTAVANGKKQIVDIKIEPEVVD------EDD----IEMLEDLIMSACNEALKKA
Y074_CLOTE       SVGGGAVTAIANGKKEIVDIRIKPEVVD------PDD----VEMLEDLILSACNEALKKA
Y126_CLOAB       TVGGGAVSATVSGKKEITEIKIKPEVVD------PDD----VEMLQDLILSACNEALKKA
Y3826_CLOK5      TAGGEAITVVVNGKKQIVSIKIKPEVVD------PED----VEMLEDLVLTACNQALKSA
Y824_CLONN       SAGGGAVTVKANGKKEILSINIEPDVVD------PDD----VEMLQDLILAACNQALKTA
Y3225_CLOBA      SVGGGAVSVTVTGKKEVKSINIKPEVVD------PDD----VEMLEDLVLTAVNEALRKA
Y3446_CLOBB      SVGGGAVSVTVTGKKEVKSINIKPEVVD------PDD----VEMLEDLVLTAVNEALRKA
Y243_RUMCH       SVGGGAINIVATGKKEIKEITIKPEVVD------PDD----VEMLQDLILSAVNEALRKA
Y2143_ACET2      SAGGGAVTVVATGRKDIKEITIKPEVVD------PDD----VEMLQDLILAAVNEALRKA
Y017_CLOD6       SVGGGAVTVKVNGKKEVIDITIKPEVVD------PDD----IEMLQDLVLSAVNQALRNI
Y046_CLOPE       SAGGGAVVAKVNGKKELIALNIKPEVVD------PDD----VEMLEDLVFSAVKQALEKA
Y053_CLOP1       SAGGGAVVAKVNGKKELIALNIKPEVVD------PDD----VEMLEDLVFSAVKQALEKA
Y056_CLOPS       SAGGGAVVAKVNGKKELIALNIKPEVVD------PDD----VEMLEDLVFSAVKQALEKA
Y2017_LACE2      TAGGGVVEVTVTGKREVSKVKIDPEAVD------PDD----VEMLEDLIVAATNEALRKC
Y329_AGARV       KAGGGAVEVTVSGKKEITKVKLSEEVVD------PDD----IEMLEDLIMAATNEALRQI
Y047_LACP7       TAGGGAVTVTVSGKKEVVSVKLSKEVVD------PDD----IEMLEDLIVAATNEALRKM
Y1143_CALBD      SSGGGAVKVVINGKKEIKSIQILPEVVD------PED----VETLQDLIVACVNEAIRKV
Y1593_CALS8      TAGGGAVKVVINGKKEIKSIEISPEVVD------PDD----IETLQDLIVACVNEAIRKV
Y2199_THEP3      TAGGGMVKAVANGRKELVSIEINPDVVD------KDD----VETLEDLVLAAVNQALRNA
Y034_THEPX       TVGGGMVKAVANGRKELVSIEINPAVVD------KDD----VETLEDLVLAAVNQALRNA
Y040_CALS4       TSGGGMVKAVANGRKELVSININPEVVD------KDD----VETLEDLVLAAVNQALRNA
Y043_DESRM       TAGGGVVKVVASGKQEIISITIKPEAVD------PDD----VEMLQDLLITAVNDALRQS
Y052_PELTS       TAGGGAVKVVANGRNEIVSIEIKPEALD------PED----VEMLQDMILAAVNEALKKA
Y028_MOOTA       SAGGGVVKVTANGRQELVNIKIDPAAVD------PED----VEMLQDLILAAVNEALHQS
Y2790_SYNFM      SAGGGMVAVVVNGRQEVLSVKVDRQVVD------PED----IEMLQDLIVAAVNDGLRKS
Y020_BACAH       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y020_BACHK       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y020_BACAN       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y027_BACAA       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y027_BACAC       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y027_BACC3       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y027_BACC7       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y024_BACC0       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y021_BACC1       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y027_BACCQ       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y020_BACCZ       TAGGGMITVIANGHKQILEVKVKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y025_BACCR       TAGGGMITVIANGHKQILEVKIKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y025_BACC4       TAGGGMITVIANGHKQILEVKIKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y5293_BACC2      TAGGGMITVIANGHKQILEVKIKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y019_BACMK       TAGGGMVTVIASGHKQVLEVKIKEEVVD------PED----IEMLQDLVLAATNDALKKV
Y019_BACCN       TAGGGMVTVIANGHKQILDVKMKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y018_GEOKA       TAGGGMVTVVANGHKQILEVKIKEEVVD------PDD----IEMLQDLILAATNDALKKA
Y017_GEOTN       TAGGGMVTVVANGHKQILEVKIKEEVVD------PDD----IEMLQDLILAATNDALKKV
Y020_GEOSW       TAGGGMVTVIANGHKQILEVKIKEEVVD------PED----IEMLQDLVLAATNDALKKA
Y2358_BACLD      TAGGGMVTVKVNGQKEVIDVIIKEEVVD------PED----VEMLQDLVLAATNDALKKV
YAAK_BACSU       TAGGGMVTVKANGQKEILDVIIKEEVVD------PED----IDMLQDLVLAATNEALKKV
Y038_BACSK       TVGGGMVTVIASGDKRILEVNISEDVVD------PDD----VEMLQDLIIAATNEALKKV
Y035_ALKHC       TAGGGMVTVVASGDKRILDVRISEDVVD------PDD----VEMLQDLILAATNEALKKV
Y030_OCEIH       TAGGGMVTVKASGKKEIIDVEIKEEVVD------PDD----IDMLQDLILAATNDVLNQI
Y019_EXIS2       TAGGEMVSVVADGHKNIIDVIIKEEVVD------PDD----VEMIQDLVLAATNDALKKV
Y1710_EXISA      TAGGGMVKVVVSGHKEVLDVIIAEDVVD------PDD----VDMLQDLVLAAINDAMKQA
Y428_STAAB       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y453_STAA3       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y436_STAAS       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y476_STAA1       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y479_STAAM       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y434_STAAW       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y437_STAAN       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y444_STAA8       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y443_STAAE       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y478_STAAT       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y478_STAAR       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y2533_STAHJ      TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y521_STAAC       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y513_STAA2       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y500_STAA9       TAGGGMVAVTVTGHKEVVDVEIKEEAVD------PDD----IEMLQDLVLAATNEAMNKA
Y2306_STAES      TAGGGMVTVTVTGHKEVVDVEIKEEAVD------PED----IEMLQDLVLAATNEAMNKA
Y115_STAEQ       TAGGGMVTVTVTGHKEVVDVEIKEEAVD------PED----IEMLQDLVLAATNEAMNKA
Y2277_STAS1      TAGGGMVTVTVSGHKEVLDVEIKEEAVD------PDD----IEMLQDLVIAATNEAMNKA
Y120_STACT       SAGGGMVKVVVTGHKEVVDVVIDEEAVD------PDD----VEMLQDLVLAATNEAMNKA
Y1934_MACCJ      TAGGGMVTVVVSGHKEVLDVIIKEEVVD------PED----IEMLQDLVLAATNDALTKA
Y2703_LISMO      TAGGGMVTVKATGKRVITDVVINEEVVD------PED----IEMLQDLVLAATNDVLKQI
Y2831_LISMH      TAGGGMVTVKATGKRVITDVVINEEVVD------PED----IEMLQDLVLAATNDVLKQI
Y2677_LISMC      TAGGGMVTVKATGKRVITDVVINEEVVD------PED----IEMLQDLVLAATNDVLKQI
Y2683_LISMF      TAGGGMVTVKATGKRVITDVVINEEVVD------PED----IEMLQDLVLAATNDVLKQI
Y2851_LISIN      TAGGGMVTVKAIGKRVITDVVINEEVVD------PED----IEMLQDLVLAATNDVLKQI
Y2654_LISW6      TAGGGMVTVKATGKRVITDVVINEEVVD------PED----IEMLQDLVLAATNDVLKQI
Y039_LYSSC       VAGGGMVKVTVSGQREVVSVNLDESVVD------PED----IEMLQDLIVIATNEALKKV
Y513_FINM2       TSGGGAIEVVANGKKEIVSIKIDEDLVK------DGD----VEMLQDMVMVAVNDAIKKV
Y378_LACAC       KSADDLVVATFSGDRKLKDIKIDKDTID------PDD----PDMLQDLIIDAVNKGLSQI
Y401_LACH4       KSADDLVVATFTGDRKLKDIKIDKEAID------PDD----PDMLQDLVIDAVNKGLSQI
Y1634_LACDA      KAADDMVVATFTGDRTLKSLFIKPEAID------PDD----PDMLEDLVIDAVNKGLKQI
Y1514_LACDB      KAADDMVVATFTGDRTLKSLFIKPEAID------PDD----PDMLEDLVIDAVNKGLKQI
Y369_LACGA       KSADDMVVATFSGDRQLKDLKIDKEAID------PDD----PDMLQDLVIDAVNKGIKAV
Y424_LACJO       KAADDMVVATFSGDRKLKDLKINKEAID------PDD----PDMLQDLVIDAVNKGIKAV
Y2444_LACCB      KSASDMVTVKFTGEKIMKDIQIKPEAID------PDD----PDMLQDLIIEAVNQAMGTI
Y1227_LACS1      HAADDAVVVKFTGDHKMTDISIKEEAID------PDD----VDMLQDLVLMAVNDAMSKI
Y699_LACPL       AAPDDMVKVTFTGDKKMKDITINPDAVD------PDD----VDMLQDLVVAAVNDALTKV
Y1483_PEDPA      VAPDDMVKVVFTGDHRMKDIVINPEAID------EDD----PDMLQDLIVAAVNDAMNRV
Y2780_ENTFA      EATNQLVTATFTGDRTMKDLIIKEDVVD------PED----VDMLQDLVIMAVNDALVKI
Y128_LACLM       KSAQDLVTVEFSGDRTLKSLNINPDVID------PED----PETLQDMVTDAVNDALSQI
Y106_LACLS       KSAQDLVTVEFSGDRTLKSLNINPDVID------PED----PETLQDMVTDAVNDALSQI
Y120_LACLA       KSAQDLVTVEFSGDRTLKSLDIKPDVID------PED----PETLQDMVTDAVNDALSQI
Y1770_STRA1      KSAQELVTVTFTGDKKLISIDYKEAVVD------PED----IETLQDMTTQAINDALSQV
Y1791_STRA3      KSAQELVTVTFTGDKKLISIDYKEAVVD------PED----IETLQDMTTQAINDALSQV
Y1747_STRA5      KSAQELVTVTFTGDKKLISIDYKEAVVD------PED----IETLQDMTTQAINDALSQV
Y368_STRE4       KSAQELVTATFTGDKQLVSIDFKEAVVD------PED----IETLQDMTAQAINAALAQI
Y297_STREM       KSAQELVTATFTGDKQLVSIDFKEAVVD------PED----IETLQDMTAQAINAALAQI
Y1862_STRP1      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1638_STRPF      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1926_STRP8      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1647_STRPD      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1568_STRPM      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1605_STRPB      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1585_STRPC      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1606_STRP3      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1606_STRPQ      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y270_STRPG       KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1591_STRP6      KSAQDLVTATFTGDKKLVGIDFKEAVVD------PED----VETLQDMTTQAINDALTQI
Y1666_STRS7      KSAQELVTATFTGDKRLVNITFKEAVVD------PED----IETLQDMTTQAINDALTQI
Y1611_STRU0      KSAQDLVTATFTGDKKMVSIDFKEAVVD------PDD----METLSDMTTQAINDALAQI
Y394_STRMU       KSAQDLVVATFTGNKKLVSIDFKEAVVD------PDD----RETLQDMTVQAINDALGQI
Y1102_STRPN      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y1174_STRP7      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y1024_STRPJ      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y1010_STRR6      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y1178_STRPS      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y1195_STRPI      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y1041_STRZJ      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y1108_STRZP      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y1149_STRZT      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y1021_STRP4      KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y987_STRP2       KSAQDLVQATLTGDKKVVSIDFNPAVVD------PED----LETLSDMTVQAINSALEQI
Y326_STRSV       KSAQDLVVAKLTGDKKVVSIDFNPAVVD------PED----LETLSEMTAQALNHALAQI
Y1598_STRT2      KSAQDLVVAELTGDKKVVNITFADAVVD------PDD----VETLQDMTVQALNDALGQI
Y1560_STRTD      KSAQDLVVAELTGDKKVVNITFADAVVD------PDD----VETLQDMTVQALNDALGQI
Y1598_STRT1      KSAQDLVVAELTGDKKVVNITFADAVVD------PDD----VETLQDMTVQALNDALGQI
Y194_STRSY       SSVQDLVTATFTGDKKLVSIDFKADVVD------ADD----LETLQEMTIQAVNAALTKV
Y195_STRS2       SSVQDLVTATFTGDKKLVSIDFKADVVD------ADD----LETLQEMTIQAVNAALTKV
Y558_CHLSY       TAGGGAITVKMNGHREVQSITISPEVVDP------DD----VEMLQDLLLVAINDASRKA
Y522_CHLAA       TAGGGAITVKMNGHREVQSITISPEVVDP------DD----VEMLQDLLLVAINDASRKA
Y3200_CHLAD      TAGGGAIVVKMNGHREVQSITISPEVVDP------ND----VDMLQDLLLVAINDASRKA
Y2292_ROSCS      TAGS-YITVTMNGHREIKSIKIAPEVVDP------DD----IETLQDLIVAAITDASKKA
Y1534_ROSS1      TAGS-YVTVTMNGHREIKSIKLAPEVVDP------DD----VETLQDLIVAAIADASKKA
Y1235_THET2      SAQG-LVEVEANGHGKILALRLKPEALKAF----QDD----PEGLEDLLLVAIQDAQTKA
Y1599_THET8      SAQG-LVEVEANGHGKILALRLKPEALKAF----QDD----PEGLEDLLLVAIQDAQTKA
Y199_DEIRA       TASG-LVTVQMNGHGKVTSLKIKPEAVDG------DD----VEALEDLILAAINDAAEKA
Y243_CORGL       NAGNGLVTVTMAGNGEVSAVTVDPKVVD------PED----VETLQDLLLGAFKDAHNKV
Y315_CORGB       NAGNGLVTVTMAGNGEVSAVTVDPKVVD------PED----VETLQDLLLGAFKDAHNKV
Y210_COREF       DAANGLVTVTMSGSGEVTAVNIDPKVVD------PED----VETLQDLVQGAFLDAHKKV
Y260_CORDI       TAGNGLVSIDMQGNGMVSSVTIDPKVVD------ADD----VETLQDLLVGAFAEAHEKL
Y2011_CORJK      EAGNGLVTISVAGSGEVTDMEIDPKIVD------PED----IDTLKDLLLGAFKDANQKL
Y1912_CORU7      EAGNGKVTLVLSGGGEVQDLKIDQEVVD------PED----VETLQDLIIGAFQDANQKL
Y143_CORK4       SAGNGLVKVTMKGTGEVTNVTIDKSVVD------PDD----VDTLQDLVLGALQDANTAL
Y4137_RHOOB      QAGGGLVTATVKGTGEVVGLKIDPKVVD------PDD----VETLQDLVIGAIEDASSKA
Y4210_RHOJR      QAGGGLVTATVKGTGEVVGLKIDPKVVD------PDD----VETLQDLVIGAIEDASNKA
Y390_RHOE4       QAGGGLVVATVKGTGEVVGLQIDPKVVD------PED----VETLQDLVIGAIEDASRKA
Y319_MYCA9       ESGGGLVRITGKGSGEVTSVQIDPKIVD------PED----VETLQDLIIGALADLTSKT
Y1287_MYCGI      QAGGGLVQVTMKGSGEVVGVSIDPKVVD------PSD----VETLQDLIVGAIADAAKQV
Y5528_MYCVP      QAGGGLVQVTMRGSGEVVAVRIDPKVVD------PSD----VETLQDLIVGAVADAAKQV
Y5272_MYCSJ      QAGGGLVQVTMKGSGEVTSVAIDPKVVD------PDD----VETLQDLVVGAIADAAKQV
Y4993_MYCSK      QAGGGLVQVTMKGSGEVTSVAIDPKVVD------PDD----VETLQDLVVGAIADAAKQV
Y4904_MYCSS      QAGGGLVQVTMKGSGEVTSVAIDPKVVD------PDD----VETLQDLVVGAIADAAKQV
Y294_NOCFA       QAGGGLVKATIKATGEVQALTIDPKVVD------PED----VEGLQDLVIGAINDAMARA
Y3743_MYCBO      QAGGGLVKVVVKGSGEVIGVTIDPKVVD------PDD----IETLQDLIVGAMRDASQQV
Y3776_MYCBP      QAGGGLVKVVVKGSGEVIGVTIDPKVVD------PDD----IETLQDLIVGAMRDASQQV
Y3753_MYCTA      QAGGGLVKVVVKGSGEVIGVTIDPKVVD------PDD----IETLQDLIVGAMRDASQQV
Y3778_MYCBT      QAGGGLVKVVVKGSGEVIGVTIDPKVVD------PDD----IETLQDLIVGAMRDASQQV
Y3716_MYCTU      QAGGGLVKVVVKGSGEVIGVTIDPKVVD------PDD----IETLQDLIVGAMRDASQQV
Y2330_MYCLE      QGGGGLVEVVVKGSGEVVSVAIDPKVVD------PGD----IETLQDLIVGAMADASKQV
Y2330_MYCLB      QGGGGLVEVVVKGSGEVVSVAIDPKVVD------PGD----IETLQDLIVGAMADASKQV
Y317_MYCPA       QAGGGLVKVVVKGSGEVVAVKIDPSVVD------PSD----VETLQDLVVGAMADASKQV
Y4556_STRAW      QAGGGLVKATVTGSGELRALVIDPKAVD------PED----TETLADLVVAAVQAANENA
Y3378_STRGG      QAGGGLVKATVTGSGELRALVIDPKAVD------PED----TETLADLVVAAVQAANENA
Y3619_STRCO      QAGGGLVKATVTGSGELRGLVIDPKAVD------PED----TETLADLVVAAVQAANENA
Y254_SACEN       SAGGGLVTAVVSGSGELKSVAIDPKAVD------PDD----TDTLSDLVVAAVRDANRAA
Y045_THEFY       SSGGGLVSVTMNGRGQVEDVSIDPKAVD------PDDAAETAQTIADLVLAAIRDGERMV
Y205_CUTAK       TAGGGLVRATVTGTGELDALTIAPEALE------DTD----AETLADLVVAAVKDATGQA
Y318_NOCSJ       TVAGGAVTVKVNGVGELVGVEIRAGGFDGSD---PDD----LSDLGDMIIAAYRDAKAQA
Y834_CHLP8       EAGGGMVKAKVNGRQKLLELSIDPEIMD--------D----VDMVQDLVVAAVNKALDAS
Y805_CHLTE       EAGGGMVRAKVNGRQKLLELTIDPEIMD--------D----VDMVQDLVVAAVNKALEAS
Y1171_CHLPD      EAGGGMVKVSVNGKQKLLTLQIDPDIMD--------D----AEMVQDLVIAAVNSALDEA
Y1174_PELPB      EAGGGMVKVSVSGKQKLLSLTIDPDIMD--------D----AEMVQDLVLAAVNNALDES
Y875_CHLL2       ESGGGMVKVSVSGKQKLLSLRIDPEIMD--------D----AEMVQDLVIAAVNNALDAS
Y1190_CHLCH      EAGGGMVKATVSGKQKLLSLAIDPEIMD--------D----YEMVQDLVVAAVNSALDAS
Y1285_CHLL3      EAGGGMVKVTVNGKQRVLSLWIDPEIMD--------D----AEMVQDLVLAAVNSALEAS
Y1034_CHLPM      EAGGGMVKVSVNGRQRLLSLAIDPDIMD--------D----REMVQDLVLAAVNSAIEES
Y1179_CHLPB      DAGGGMVKATVSGKQKVLSIAIDPEILD--------D----IEMVQDLVVAAVNAALEKA
Y1157_CHLT3      ESGGGLVKAMANGKHEIISIQIDKDVLD--------D----VDMLQDLIVAAVNQALTEA
Y1227_AKKM8      EGAGGKLKVTATCDGNLTELVIDPSIID------PSD----SEFLQELLLQTINAAIAKG
Y1429_DESPS      SAGGGMVEVQVNGQGEILAIKIEDALIN------TDE----KEMLQDLVTAATNDGLRRA
Y3467_GLUDA      SAGAGMVHVTLNGKGDMKAVKIDPKLAD-------PA---EMEMLQDLIVAACADARKLL
Y260_GRABC       SAGAGMVTVTLNGKGDLRRLHIDPKLAD-------PA---ETEMLEDLIVAAHNDAKKKI
Y1999_ACICJ      EAGAGLVKVTLSGKGEMKGIEIDPKLID-------PN---DAEMLQDLIVAAHRDAKSRL
Y603_GLUOX       SAGAGLVTVKLTGKGEMRDLKIDPQLAD-------PS---DIETLQDLIVAAYTDAKTKA
Y4104_MAGSA      SSGAGMLQVTLNGKYELKKVKIDPSLVD-------PS---DVEVLEDLILAAFNDAKAKA
Y2305_RHOCS      VSAGGMVSILLNGKGELKQIKLDKSVVD-------PE---DVEVLEDLIVAAFNDAKNKV
Y3472_RHORT      QSAAGMCVVTLDGKGGVRSIKIDPSLVD-------PK---ETEVMEDLIVAAFNDAKAKV
Y268_CAUVC       TSGGGMVTVTLMGNGELVRVLMDESLVQ-------PG---EGEVIADLIIAAHADAKKKL
Y269_CAUVN       TSGGGMVTVTLMGNGELVRVLMDESLVQ-------PG---EGEVIADLIIAAHADAKKKL
Y4574_CAUSK      TSGGGMVTVTLRGNGELAKVVLDESLIE-------PG---EGEVIADLIVAAHADAKKKL
Y369_PHEZH       TSGGGMVKLVLKGTGELARVDLDESLMA-------PG---EGEVVADLIVAAHADAKRKL
Y436_MARMM       EAGAGLVRVVLTAKGDMVSIHVDKSLMD-------PD---EPEILEDLLKAAHADARRKG
Y371_HYPNA       VAGAGLVRVKLRGKGELISVTIDKSLMG--------D---DPEIVEDLIKAAHSDARKRL
Y095_AGRFC       RAGGGLVTVILNGKGEMRGLKIDPSLFK-------ED---EVEILEDLIVAAHKDAKEKG
Y231_RHIME       TSGGGLVTVRLDGKGHMKSLKVDPSLFK-------ED---DVEILEDLIVAAHKDAKDKA
Y5504_RHILO      QAGGGLVSVILSGKFEMKSLKIDPSLFK-------ED---EVEILEDLILAAHNDAKAKV
Y033_BRUAB       SSGGGLVTVTLSGKGTLSALKIDPSLMK-------ED---EVEILEDLIIAAHNDAKAKL
Y030_BRUA2       SSGGGLVTVTLSGKGTLSALKIDPSLMK-------ED---EVEILEDLIIAAHNDAKAKL
Y033_BRUSU       SSGGGLVTVTLSGKGTLSALKIDPSLMK-------ED---EVEILEDLIIAAHNDAKAKL
Y035_BRUSI       SSGGGLVTVTLSGKGTLSALKIDPSLMK-------ED---EVEILEDLIIAAHNDAKAKL
Y290_BRUA1       SSGGGLVTVTLSGKGTLSALKIDPSLMK-------ED---EVEILEDLIIAAHNDAKAKL
Y034_BRUC2       SSGGGLVTVTLSGKGTLSALKIDPSLMK-------ED---EVEILEDLIIAAHNDAKAKL
Y1909_BRUME      SSGGGLVTVTLSGKGTLSALKIDPSLMK-------ED---EVEILEDLIIAAHNDAKAKL
Y033_BRUO2       SSGGGLVTVTLSGKGTLSALKIDPSLMK-------ED---EVEILEDLIIAAHNDAKAKL
Y033_BRUMB       SSGGGLVTVTLSGKGTLSALKIDPSLMK-------ED---EVEILEDLIIAAHNDGKAKL
Y022_BRUA4       SSGGGLVTITLSGKGTLSALKIDPSLMK-------EE---EVEILEDLIIAAHNDAKAKL
Y231_BARHE       TAGGGLVSITLNGKNTITAIKIDPSLLK-------PE---EIEILEDLIMAAYNEAKTKI
Y219_BARQU       TAGGGLINVTLNGKNTITAIKIDPSLLK-------PE---ESEILEDLIMAAHNDAKTKI
Y257_BART1       TAGGDLVSITLNGKNIITAIQIDPSLLK-------PE---EAEILEDLIMAAYNEARAKI
Y1239_BARBK      TAGGGLVSITLNGQNIISEVKIDPSLIK-------PE---ESEILEDLIMAAHNEAKEKI
Y7345_BRASB      ISGGGLVAVRMTAKMEVKGIKIDPSLLK-------PD---EAEILEDLLVTAHGDARRKA
Y764_BRASO       ISGGGLVAVRMTAKMDVKSIKIDPSLLK-------PE---EAEILEDLLVTAHGDARRKA
YUD3_BRADU       ISGGGLVVVRMTAKMDVKGVKIDPSLMK-------AE---EREVLEDLLVTALGDARRKA
Y463_NITHX       ASGGGLVSVRMTAKMEVKAISIDPSLMK-------PD---EREILEDLVVSALGDARRKA
Y368_NITWN       ASGGGLVTVRMTAKMEVKGISIDPSLIK-------PD---EREILEDLVVTALADARRKA
Y616_RHOPA       LSGGGLVKVRMSAKMEVRGISIDPSLIK-------AD---EREVLEDLLAAAHGDAHRKA
Y620_RHOPT       LSGGGLVKVRMSAKMEVRGISIDPSLIK-------AD---EREVLEDLLVAAHGDAHRKA
Y086_RHOPS       SSGGGLVQVRMSAKMEVRGVSIDPSLLK-------PD---EGGVLEDLLVAAHADAHRKA
Y667_RHOP2       LSGGGLVKIRMSAKMEVRGVSIDPSLLK-------AD---EGEVLEDLLVAALADAHRKA
Y4812_RHOP5      ISGGGLVNVRMSAKMEVRAVKIDPSLLN-------PD---EVGVLEDLLVSALADAHRKA
Y4847_RHOPB      ISGGGLVSVRMTAKMEVKTIKIDPSLIN-------AD---EAGVLEDLLVTALADAHRKA
Y7544_AFIC5      SAGGSMVTVRMTAKMELKAVSIDPSLMK-------PE---EREVLEDLLVAAQNDARRKA
Y1981_DICT6      TAGGGVVKIIMNAKEEIKEVKIDPEVVN-------KD---EVDILEDLIAAALRDALTKA
Y258_DICTD       TAGGGVVKIVMTAKEEVKEVKIDPEVVN-------KD---EVDILEDLIAAALRDALTKA
Y255_BEII9       HAGGGLVKITLTVKGQIRSVSIDPSLLK-------PE---EKEIVEDLVALAYENARHQA
Y275_METSB       QSGGGMVRVTLSAKGQLRNLAIDDQLIK-------AD---EKQILEDLIITAHEDARKKA
Y1224_RICAE      KAGGGLVEVIATGKGEVEKISIDESLLK-------AE---EKEMLEDLIKVAFNDAQQKC
Y1337_RICCN      KAGGGLVEVIATGKGEVEKISIDESLLK-------AE---EKEMLEDLIKVAFNDAQQKC
Y7555_RICPU      KAGGGLVEVIATGKGEVEKISIDESLLK-------AE---EKEMLEDLIKVAFNDAQQKC
Y1562_RICRO      KAGGGLVEVIATGKGEVEKISIDESLLK-------AE---EKEMLEDLIKVAFNNAQQKC
Y7310_RICRS      KAGGGLVEVIATGKGEVEKISIDESLLK-------AE---EKEMLEDLIKVAFNNAQQKC
Y1365_RICFE      KAGGGLVEVIATGKGEVEKITIDESLLK-------PE---EKEMLEDLIKVAFNDAKQKC
Y866_RICPR       KAGGMLVEIIITGKGEVEKISIDESLLK-------TE---EKEMLEDLIKVAFNDAKQKC
Y857_RICTY       KAGGMLVEIIITGKGEIEKVSIDESLLK-------IE---EKEILEDLIKVAFNDAKQKC
Y6705_RICAH      KAGGGLVEIIITGKGEVAKISIDESLLK-------SE---EKEMLEDLIKVAFNDAKQKC
Y5550_RICCK      KAGGRLVEITITGRSEVEKVSIDESLLK-------AE---EKEMLEDLIKVAFNDAKQKC
Y660_RICB8       KAGGGLVEIIATGKGEVEKVSIDASLLK-------EE---EKEMLEDLIKVAFNDAKQKC
Y048_RICBR       KAGGGLVEIIATGKGEVEKVSIDASLLK-------EE---EKEMLEDLIKVAFNDAKQKC
YBAB_SALHS       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALNS       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALG2       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALEP       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALDC       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALCH       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALAR       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALA4       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SHISS       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SHIF8       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SHIFL       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SHIDS       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SHIBS       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SHIB3       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALTY       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALTI       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALSV       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALPC       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALPB       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECO81       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOHS       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOL5       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECO7I       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECO45       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOL6       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOSE       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOSM       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECODH       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOLI       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOLC       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOBW       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECO55       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ESCF3       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECO27       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOK1       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECOLU       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECO5E       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECO57       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECO8A       ESGAGLIKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_ECO24       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
Y2800_CROS8      ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
Y951_ENT38       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKDMLEDLVAAAFNDAARRI
Y4227_KLEP3      ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
Y444_KLEP7       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALPA       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
YBAB_SALPK       ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
Y2678_CITK8      ESGAGLVKVTINGAHNCRRVEIDPSLL--------ED---DKEMLEDLVAAAFNDAARRI
Y1109_EDWI9      ESGAGLVKVTINGAHNCRRVEIDPSLM--------ED---DKEMLEDLVAAAFNDAARRI
Y3840_PHOLL      ESGAGLVKVTINGAHNCRRVEIDPSLM--------ED---DKEMLEDLIAAAFNDAARRI
Y1177_PECAS      ESGAGLVKITINGAHNCRRVEIDPSLM--------ED---DKEMLEDLIAAAFNDAARRI
Y1077_PECCP      ESGAGLVKITINGAHNCRRVEIDPSLM--------ED---DKEMLEDLIAAAFNDAARRI
Y3121_YERPE      ESGAGLVKVTINGAHNCRRVEIDPSLLV-------ED---DKEMLEDLIAAALNDAARRI
Y2758_YERPP      ESGAGLVKVTINGAHNCRRVEIDPSLLV-------ED---DKEMLEDLIAAALNDAARRI
Y3197_YERPY      ESGAGLVKVTINGAHNCRRVEIDPSLLV-------ED---DKEMLEDLIAAALNDAARRI
Y2890_YERPG      ESGAGLVKVTINGAHNCRRVEIDPSLLV-------ED---DKEMLEDLIAAALNDAARRI
Y2615_YERPA      ESGAGLVKVTINGAHNCRRVEIDPSLLV-------ED---DKEMLEDLIAAALNDAARRI
Y967_YERPN       ESGAGLVKVTINGAHNCRRVEIDPSLLV-------ED---DKEMLEDLIAAALNDAARRI
Y993_YERPS       ESGAGLVKVTINGAHNCRRVEIDPSLLV-------ED---DKEMLEDLIAAALNDAARRI
Y1036_YERPB      ESGAGLVKVTINGAHNCRRVEIDPSLLV-------ED---DKEMLEDLIAAALNDAARRI
Y3058_YERP3      ESGAGLVKVTINGAHNCRRVEIDPSLLV-------ED---DKEMLEDLIAAALNDAARRI
Y3092_YERE8      ESGAGLVKVTINGAHNCRRVEIDPSLLV-------EE---DKEMLEDLIAAAFNDAARRI
Y1136_SERP5      ESGAGLVKVTINGAHNCRRVEIDPSLM--------ED---DKDMLEDLIAAAINDAARRI
Y140_PROMH       ESGAGLVKITINGAHNCRRVEIDPSLL--------ED---DKEMLEDLIAAAFNDAARRI
Y690_SODGM       ESGAGLVKVTINGAHNCRRVEVDPSLL--------ED---DKDMLEDLIAAAFNDAARRI
Y075_ACTPJ       ESGAGLVKVTINGAHNCRRIEIDPSLM--------ED---DKEMVEDLVAAAFNDAVRRA
Y075_ACTP2       ESGAGLVKVTINGAHNCRRIEIDPSLM--------ED---DKEMVEDLVAAAFNDAVRRA
Y075_ACTP7       ESGAGLVKVTINGAHNCRRIEIDPSLM--------ED---DKEMVEDLVAAAFNDAVRRA
Y1040_HAEPS      ESGAGLVKVTINGAHNCRRIEIDPSLM--------ED---DKEMAEDLVAAAFNDAVRRA
Y780_HAEIE       ESGAGLVKIAINGAHNCRRIDIDPSLM--------ED---DKEMLEDLIAAAFNDAVRRA
Y5435_HAEIG      ESGAGLVKIAINGAHNCRRIDIDPSLM--------ED---DKEMLEDLIAAAFNDAVRRA
Y442_HAEIN       ESGAGLVKITINGAHNCRRIDIDPSLM--------ED---DKEMLEDLIAAAFNDAVRRA
Y1309_HAES1      EAGAGLIKVTINGAHNCRRIDIDPSLM--------ED---DKEMLEDLIAAAFNDAVRRA
Y308_HISS2       EAGAGLIKVTINGAHNCRRIDIDPSLM--------ED---DKEMLEDLIAAAFNDAVRRA
Y997_ACTSZ       ESGAGLVKITLNGAHNCRRIEIDPSLM--------EE---DKEMLEDLIAAAFNDAVRRA
Y326_HAEDU       ESGAGLVKVTINGAHNCRRIEIDASLM--------ED---DKEMVEDLVAAAFNDAVRRA
Y1507_MANSM      ESGAGLVKVTINGAHNCRRVEIDPSLM--------ED---DKDMLEDLIAAAFNDAARRA
Y205_PASMU       ESGAGLVKITINGAHNCRRVEIDPSLM--------ED---DKDMLEDLIAAAFNDAVRRA
Y426_BUCBP       ESGAGAVKVTLIGSHYCKKIELDKNTIL-------EH---DKEILEDLITAAFNDAVRKI
YGG0_WIGBR       ESGAGLVKIKLNGSRYCNYVKID-NSLL-------K----DKEMLEDLIVAAFNDAIRRI
Y116_BAUCH       ESGAGLVKVTINGVYHCRRVEID-SSLL-------QD---DKDMLEDLITAAFNDAVRRI
Y482_BUCAI       EAGAGLVKVTINGAHNCRRVEVD-PSLL-------QD---DKDMLEDLAAAAFNDATRRI
Y475_BUCA5       EAGAGLVKVTINGAHNCRRVEVD-PSLL-------QD---DKDMLEDLAAAAFNDATRRI
Y476_BUCAT       EAGAGLVKVTINGAHNCRRVEVD-PSLL-------QD---DKDMLEDLAAAAFNDATRRI
Y467_BUCAP       EAGAGLVKVTINGAHNCRRVEVD-PSLL-------KD---DKDMLEDLAAAAFNDATRRI
Y2473_ERWT9      ESGAGLVKVTINGAHSCRRVEVD-PSLL-------ED---DKDMLEDLVAAAFNDAARRI
Y1686_ALIF1      ESGAGLVKVTITGSHSVRRVEIDPSLME-------ED---EKEMLEDLIAAAFNDASRRI
Y1810_ALIFM      ESGAGLVKVTITGSHSVRRVEIDPSLME-------ED---EKEMLEDLIAAAFNDASRRI
Y1086_ALISL      ESGAGLVKVTITGSHSVRRVEIDPSLME-------ED---EKEMLEDLIAAAFNDASRRI
Y2004_VIBVU      ESGAGLVKVTITGSHSVRRVNIDESLME-------DD----KEMLEDLIAAAFNDAARRV
Y2410_VIBVY      ESGAGLVKVTITGSHSVRRVNIDESLME-------DD----KEMLEDLIAAAFNDAARRV
Y1055_VIBCH      ESGAGLVKVTVTGSHSVRRVNIDESLME-------DD----KEMLEDLIAAAFNDAARRI
Y2178_VIBPA      ESGAGLVKVTITGSHSVRRVDIDESLME-------DD----KEMLEDLIAAAFNDAARRV
Y917_VIBA3       ESGAGLVKVTITGSHSVRRVDIDESLME-------DD----KEMLEDLIAAAFNDAARRV
Y3086_VIBCB      ESGAGLVKVTITGSHSVRRVEIDESLME-------DD----KEMLEDLIAAAFNDAARRV
Y2216_TOLAT      ESGAGMVKITITGSHNVRRVTIDPSLLQ-------DD---DQEMLEDLIAAAFNDAVRRA
Y2301_SHEPC      ESGAGLVKVTMTGAHTVRKVEIDPSLM--------ED---DKEMLEDLIAAACNDAARRI
Y1707_SHESW      ESGAGLVKVTMTGAHTVRKVEIDPSLM--------ED---DKEMLEDLIAAACNDAARRI
Y2014_SHEON      ESGAGLVKVTMTGAHTVRKVEIYPSLM--------ED---DKEMLEDLIAAACNDAARII
Y1770_SHEB2      ESGAGLVKVTMTGAHTVRKVEIDPSLM--------ED---DKEMLEDLIAAACNDAARRI
Y2380_SHEDO      EAGAGLVKVTMTGSHSVRKVEIDPSLM--------ED---DKEMLEDLIAAACNDASRRI
Y2406_SHEFN      EAGAGLVKVTMTGNHNVRKVEIDPSLM--------ED---DKEMLEDLIAAACNDAARRI
Y1591_SHEHH      EAGAGLVKVTMTGSHSVRKVDIDASLL--------ED---DKEMLEDLIAAACNDAARRV
Y1509_SHEPA      EAGAGLVKVTMTGSHSVRKVDIDASLL--------ED---DKEMLEDLIAAACNDAARRV
Y1717_SHEPW      EAGAGLVKVTMTGSHSVRKVDIDASLL--------ED---DKEMLEDLIAAACNDAARRV
Y1794_SHEWM      EAGAGLVKVTMTGSHSVRKVDIDPSLL--------ED---DKEMLEDLIAAACNDAARRV
Y2851_SHESH      EAGAGLVKVTMTGSHSVRKVDIDPSLL--------ED---DKEMLEDLIAAACNDAARRV
Y2234_SHELP      EAGAGLVKVTMTGSHSVRKVEIDPSLL--------ED---DKEMLEDLIAAACNDAARRV
Y1311_SHEAM      ESGAGLVKVTMTGTHNVRKVEIDPSLL--------ED---DKELLEDLVAAACNDAARRV
Y1612_MARHV      ESGAGLVKVTMNGRHDVRKVDIDPSLL--------SE---DKEILEDLLAAAVNDAVRRV
Y2276_PSYIN      ESGAGLVKITILGNHNVRKVEIDPSLM--------ED---DKEMLEDLIAAAMNDAVHRI
Y2212_AERHH      EAGAGMVKVTMAGSHSVRRIEIDPSLM--------ED---DKEMLEDLVAAAVNDAVRRV
Y2087_AERS4      EAGAGMVKVTMAGSHSVRRIEIDQSLM--------ED---DKEMIEDLVAAAVNDAVRRV
Y3743_COLP3      EAGAGMVKVTMTGSHSVRKVELDDSLM--------ED---DKDMIEDLLAAAVNDAVRRV
Y1098_ALTMD      EAGAGMVKVTMTCNHNVRRVNIDESLM--------DD---DKDMVEDLVAAAFNDAVRRV
Y1202_PSET1      EAGAGLVKVTMLGNHNVRRVELDESLM--------QD---DKDMIEDLLAAACNDAVRRV
Y1848_IDILO      EAGAGLVKITMLGNHNVKRVSIDPSLM--------ED---DQEMLEDLIAAATNDAVRRV
Y2533_MARMS      QAGAGLVKILMTGRHDVKRVSIDDSLF--------GD---DKEMLEDLIAAAVNDAVRNI
Y1459_CHRSD      EAGAGMIKVTMNGRHDVSRVNVDPSVM--------EE---DKELLEDLLAAAVNDAVRKV
Y1509_ALKEH      ESGGGMVAVTINGKHEARRVSIDPSLF--------ED---DREMVEDLVAAAFNDAVHKL
Y231_HALHL       EAGAGMVKVTMTGRNEVRKVEIDPSLF--------ED---DREMVEDLVAAAVNDAVQKV
Y1920_ACIF2      HAGGNLVEVTMTCRHDVRRVRIDPSLLT-------DG---DQEMLEDLVAAAINDAVRTA
Y1592_ACIF5      HAGGNLVEVTMTCRHDVRRVRIDPSLLT-------DG---DQEMLEDLVAAAINDAVRTA
Y2594_NITOC      QAGGGMVSIVMTGRYDCRRISIHSELWQ-------E----DKEMVEDLVAAAINDAVRQV
Y639_AROAE       QSGAGMVKVLMTCKYDVRRVTIDDSVMD-------D-----KEMLEDLLAAAVNDAVRRV
Y807_DECAR       VAGAGMVKVLMTCAHEVRRVNIDPSVMD-------D-----REMLEDLIAAALNDAVRRG
Y1611_CHRVO      QSGAGMVKVTMTCSHDVKRVAIDDSVLE-------DA-KEDKEMLEDLIAAAFNDAVRKV
Y434_NITEU       QAGAGMVKVTMTCRYDVKRVNIDSSLIG-------D----DKEMLEDLVAAAVNDAVRRV
Y591_NITEC       QAGAGMVKVIMTCRHDVKRINIDSSLIG-------D----DKEMLEDLVAAAMNDAVRRV
Y1439_BORBR      AAGGGLVKVTMTCRHDVKRVAIDPSLLG-------E----DKDMLEDLVAAAFNDALRKA
Y1222_BORPA      AAGGGLVKVTMTCRHDVKRVAIDPSLLG-------E----DKDMLEDLVAAAFNDALRKA
Y1550_BORPE      AAGGGLVKVTMTCRHDVKRVAIDASLLG-------E----DKDMLEDLVAAAFNDALRKA
Y915_BORA1       AAGGGLVKVTMSCRNDVKRIAIDPSLLA-------D----DKDMLEDLVAAAFNDALRKA
Y3552_BORPD      ESGGGLVKVSMSCRHDVKRVAIDPSLLA-------D----DKDMLEDLVAAAFNDALRKV
Y1764_BURCM      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1737_BURA4      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1753_BURVG      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y6253_BURCA      QSGAGLVKVTMTCRNEVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y5127_BURL3      QSGAGLVKVTMTCRNEVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1861_BURCJ      QSGAGLVKVTMTCRNEVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1826_BURCH      QSGAGLVKVTMTCRNEVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1850_BURCC      QSGAGLVKVTMTCRNEVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1796_BURM1      QSGAGLVKVTMTCRNEVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1499_BURPS      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y2243_BURP0      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y2372_BURP1      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y2205_BURP6      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1360_BURMA      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y2346_BURM9      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y3622_BURM7      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y3650_BURMS      QSGAGLVKVTMTCRNEVRRVAIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y2220_BURTA      QSGAGLVKVTMTCRNEVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1827_PARPJ      QSGAGLVKVTMTCKNDVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y2072_PARXL      QSGAGLVKVTMTCKNDVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y952_PARP8       QSGAGLVKVTMTCKNDVRRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1036_RALPJ      VSGAGLVKVVMTCKNDVKRVSIDPSLLA-------EG--EDKDLLEDLIAAAFNDAVRKA
Y1192_RALSO      VSGAGLVKVVMTCKNDVKRVSIDPSLLA-------EG--EDKELLEDLVAAAFNDAVRKA
Y1934_CUPTR      QSGAGLVKVVMTCKNDVKRVTIDPSLLA-------EG--EDKDLLEDLVAAAFNDAVRKA
Y2111_CUPPJ      QSGAGLVKVVMTCKNDVKRVTIDPSLLA-------D----DKDLLEDLVAAAFNDAVRKA
Y2128_CUPMC      QSGAGLVKVVMTCKNDVKRVTIDPSLLA-------D----DKDLLEDLVAAAFNDAVRKA
Y1046_HERAR      QSGAGLVKIVMSCKNDVKRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y2329_JANMA      QSGAGLVKVVMSCKNDVKRVSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRKA
Y1975_LEPCP      QSGAGLVKVVMTCKHDVKRLSIDPSLLA-------D----DKDMLEDLVAAAFNDAVRRA
Y2533_METPP      QSGAGLVKVLMTCKHDVKRITIDPSLLA-------D----DKDMLEDLVAAAFNDAVRRA
Y1533_PSEAE      QSGAGLVSVVMTGRHDVKRVSLDDSLMQ-------E----DKEILEDLIAAAVNDAVRKI
Y3795_PSEA8      QSGAGLVSVVMTGRHDVKRVSLDDSLMQ-------E----DKEILEDLIAAAVNDAVRKI
Y4462_PSEAB      QSGAGLVSVVMTGRHDVKRVSLDDSLMQ-------E----DKEILEDLIAAAVNDAVRKI
Y1786_PSE14      QSGAGLVSVVMTGRHDVKRINLDDSLMQ-------E----DKEVLEDLIAAAVNDAVRKI
Y1826_PSEU2      QSGAGLVSVVMTGRHDVKRINLDDSLMQ-------E----DKEVLEDLIAAAVNDAVRKI
Y3645_PSESM      QSGAGLVSVVMTGRHDVKRINLDDSLMQ-------E----DKEVLEDLIAAAVNDAVRKI
Y2646_PSEMY      QSGAGLVSVVMTGRHDVKRITLDDSLMQ-------E----DKEVLEDLIAAAVNDAVRKV
Y1984_AZOVD      QSGAGLVSVVMTGRHDVRRVTLDDSLMQ-------E----DKEVLEDLIAAAVNDAVRKI
Y1600_PSEP1      QSGGGLVSVVMTGRHDVKRVSIDQSLMS-------TD-EDDKEVLEDLIAAALNDAVRKV
Y3833_PSEPG      QSGGGLVSVVMTGRHDVKRVSIDQSLMS-------TD-EDDKEVLEDLIAAALNDAVRKV
Y4268_PSEPK      QSGGGLVSVVMTGRHDVKRVSIDQSLMS-------TD-EDDKEVLEDLIAAALNDAVRKV
Y3586_PSEPW      QSGGGLVSVVMTGRHDVKRVSIDQSLMS-------TE-EDDKEVLEDLIAAALNDAVRKV
Y1789_PSEE4      QSGGGLVSVVMTGRHDVKRVSIDQSLMS-------TD-ADDKEVLEDLIAAALNDAVRKI
Y1905_PSEF5      KAGGDMVTVVMTGRHDIKRVSIDPSLLE-------GVSEDDREVLEDLFAAAVNDAVRKI
Y4577_PSEFS      KAGGDMVSVVMTGRHDIKRVSIDPSVLP-------GVGEDDLEMLEALFAAAVNDAVRKI
Y1806_PSEPF      KAGGDLVTVVMTGRHDVKKVSIDPSVLP-------GLDEDDREVVEDLVAAAVNAAVRQI
Y645_POLNS       QAAGGLVKVTISGKYELKRVQIDPGAMD-------D-----REMLEDLIVTAYTEAFKQV
Y701_POLAQ       QAAGGLVKVAISGKYELKRVQIDPGAMD-------D-----REMLEDLIVTAYTEAFKQV
Y1015_STRMK      SAGGGMVSVTLTGAKECRKVRIDPSLTS-------D-----PEMLEDLIAAAFNDASNKI
Y858_STRM5       SAGGGMVSVTLTGAKECRKVRIDPSLAS-------D-----PEMLEDLIAAAFNDASNKI
Y1065_XANOR      TAGGGMVNVTLTGAKECRKVRIDPSILS-------D-----QEMAEDLIAAAFNDASNKI
Y965_XANOM       TAGGGMVNVTLTGAKECRKVRIDPSILS-------D-----QEMAEDLIAAAFNDASNKI
Y1110_XANAC      TAGGGMVSVTLTGAKECRKVRIDPSILS-------D-----QEMAEDLIAAAFNDASNKI
Y1128_XANC5      SAGGGMVSVTLTGAKECRKVRIDPSILS-------D-----QEMAEDLIAAAFNDASNKI
Y1002_XANCP      SAGGGMVSVTLTGAKECRKVRIDPSILS-------D-----QEMAEDLIAAAFNDASNKI
Y3243_XANC8      SAGGGMVSVTLTGAKECRKVRIDPSILS-------D-----QEMAEDLIAAAFNDASNKI
Y3358_XANCB      SAGGGMVSVTLTGAKECRKVRIDPSILS-------D-----QEMAEDLIAAAFNDASNKI
Y1216_XYLFM      SAGGSMVSVILSGTKECRKVRIDPSILN-------D-----QEMIEDLIAAAFNDASNKV
Y1122_XYLF2      SAGGSMVSVILSGTKECRKVRIDPSILN-------D-----QEMIEDLIAAAFNDASNKV
Y1058_XYLFT      SAGGSMVSVILSGTKECRKVRIDPSILN-------D-----QEMIEDLIAAAFNDASNKV
Y1808_XYLFA      SAGGGMVSVILSGTKECRKVRIDPSILN-------D-----QEMIEDLIAAAFNDASNKV
Y1499_FRATF      ESGAGLVTVTMTGKYDVKSVSIDNSLMS-------ED----KEILEDLIAAAVNSAVKKV
Y1411_FRATH      ESGAGLVTVTMTGKYDVKSVSIDNSLMS-------ED----KEILEDLIAAAVNSAVKKV
Y1374_FRATO      ESGAGLVTVTMTGKYDVKSVSIDNSLMS-------ED----KEILEDLIAAAVNSAVKKV
Y810_FRATT       ESGAGLVTVTMTGKYDVKSVSIDNSLMS-------ED----KEILEDLIAAAVNSAVKKV
Y810_FRAT1       ESGAGLVTVTMTGKYDVKSVSIDNSLMS-------ED----KEILEDLIAAAVNSAVKKV
Y1023_FRATM      ESGAGLVTVTMTGKYDVKSVSIDNSLMS-------ED----KEILEDLIAAAVNSAVKKV
Y607_FRATW       ESGAGLVTVTMTGKYDVKSVSIDNSLMS-------ED----KEILEDLIAAAVNNAVKKV
Y1196_FRATN      ESGAGLVTVTMTGKYDVKSVSIDNSLMS-------ED----KEILEDLIAAAVNSAVKKV
Y120_FRAP2       ESGAGLVSVTMTGKYDVKKVTIDDSLMS-------ED----KEMLEDLIAAAVNSAVKKV
Y1774_ALCBS      ESGAGLVKVTMNGRHDVKGVDIDPSLMS-------ED----KELLEDLLAAAVNDAVRRI
Y3038_LEGPC      ESGGGMVTIKMNGRHDVTEVKIKPTLMD-------ED----IEMLEDLIAAAVNDAVRKI
Y2672_LEGPL      ESGGGMVTIKMNGRHDVTEVKIKPTLMD-------ED----IEMLEDLIAAAVNDAVRKI
Y2803_LEGPA      ESGGGMVTIKMNGRHDVTEVKIKPTLMD-------ED----IEMLEDLIAAAVNDAVRKI
Y2755_LEGPH      ESGGGMVTIKMNGRHDVTEVKIKPTLMD-------ED----IEMLEDLIAAAVNDAVRKI
Y2614_HAHCH      ESGGGLIKIVMNGRHDVKKVEIDASLMQ-------EE----KEILEDLLAAAVNDAVRKV
Y1327_METCA      ESGGGLVKIRMNGKREVLKVEIDPSLRQ-------EE----HEVLEDLIAAAFNDGVRRV
Y742_NEIG1       EAGNGLVKITMTCAHEVRKIDISPDLIQ-------EAAD-DKEMLEDLILAALKSARGKA
Y1136_NEIG2      EAGNGLVKITMTCAHEVRKIDISPDLIQ-------EAAD-DKEMLEDLILAALKSARGKA
Y1444_NEIMB      EAGNGLVKITMTCAHEVRKIDISPDLIQ-------EAAD-DKEMLEDLILAALKSARGKA
Y1380_NEIMF      EAGNGLVKITMTCAHEVRKIDISPDLIQ-------EAAD-DKEMLEDLILAALKSARGKA
Y1657_NEIMA      EAGNGLVKITMTCAHEVRKIDISPDLIQ-------EAAD-DKEMLEDLILAALKSARDKA
Y1355_NEIM0      EAGNGLVKITMTCAHEVRKIDISPDLIQ-------EAAD-DKEMLEDLILAALKSARDKA
Y1909_ACIB5      EAGGGLVKVTMTGRYIVKRIEINPELLQ-------DE----PDMIEDLIAAAVNDAVRQA
Y1813_ACIB3      EAGGGLVKVTMTGRYIVKRIEINPELLQ-------DE----PDMIEDLIAAAVNDAVRQA
Y1718_ACIBC      EAGGGLVKVTMTGRYIVKRIEINPELLQ-------DE----PDMIEDLIAAAVNDAVRQA
Y1684_ACIBT      EAGGGLVKVTMTGRYIVKRIEINPELLQ-------DE----PDMIEDLIAAAVNDAVRQA
Y1967_ACIBY      EAGGGLVKVTMTGRYIVKRIEINPELLQ-------DE----PDMIEDLIAAAVNDAVRQA
Y1914_ACIBS      EAGGGLVKVTMTGRYIVKRIEINPELLQ-------DE----PDMIEDLIAAAVNDAVRQA
Y793_PSYA2       EAGSGLVKVTMTGRHVVKRLTIDPSLLE-------DE----PDMIEDLIAAAINDAVRQA
Y799_PSYCK       EAGSGLVKVTMTGRHVVKRLTIDPSLLE-------DE----PDMIEDLIAAAINDAVRQA
Y1729_PSYWF      EAGNGLVKVTMTGRHVVKRLSIDPSLLE-------DE----PDLIEDLIAAAINAAVTKA
Y656_COXBU       ESGAGMVKLTMTAQHEVVEMNLDDELLK-------ES----KEVIEDLIKAALNDANQKI
Y1351_COXB2      ESGAGMVKLTMTAQHEVVEMNLDDELLK-------ES----KEVIEDLIKAALNDANQKI
Y772_COXBR       ESGAGMVKLTMTAQHEVVEMNLDDELLK-------ES----KEVIEDLIKAALNDANQKI
Y1603_COXB1      ESGAGMVKLTMTAQHEVVEMNLDDELLK-------ES----KEVIEDLIKAALNDANQKI
Y666_COXBN       ESGAGMVKLTMTAQHEVVEMNLDDELLK-------ES----KEVIEDLIKAALNDANQKI
Y701_BUCCC       ESGAGLVTIFMNGNYNCRKTKINDEIWN-------EK---NKILIQDLITSAINNAVNKI
Y5067_NOSS1      EAGGGLVKVIVSGNQEPKRVEISPDALA-------QG----ADLLSDLVTAAMKDAYIKS
Y2322_TRIV2      EAGGGLVKVIVSGNQEPKRVEISPDALA-------QG----ADLLSDLVTAAMKDAYIKS
Y448_NOSP7       ESGGGLVKVIVSGNQEPKRVEISPDALA-------EG----AEVLSDLVTVAMKEAYNKS
Y899_CYAP4       VAAGGLVKVIMSGNQEPRRVEISPDLMS-------EG----AEVVADLVTAAMKDAYLKS
Y723_THEEB       QAAGGAVKVIMSGTQEPRRVEISPDLLS-------EG----AEVLSDLVTAAMRDAYQKS
Y464_SYNE7       QAQGGLVKVWVSGNQEPLRAEIAPEALN-------EG----AEVLSELVAAAMKDAYQKS
Y1054_SYNP6      QAQGGLVKVWVSGNQEPLRAEIAPEALN-------EG----AEVLSELVAAAMKDAYQKS
Y2224_GLOC7      HSSDGSVTVVMSGNQEPRSVTIQPTALE-------KG----AEELSTLVTEAMKDAYSKS
Y1847_SYNY3      KSADGLVTVLMSGNQEPLSIEIDPSALE-------KG----AEGLSASVTEAMKAAYAES
Y2554_RIPO1      FSEGKLVKVIMSGNQEPRSVTILPEALE-------KG----ADELSQLVTDAMKDAYTQS
Y2391_MICAN      QSENGLVTVYLSGNQEPRGIEIDPALLS-------QD----LEIVAGSILEAMKVAYDAS
Y020_PROMA       TNEDGRVTVWLSGNQQPIRVKVENSILK-------EE----EEIVEAAILEAMQKAHEIS
Y020_PROM4       KNQDGRVSICLSGNQLPLRIEIDPSILL-------EG----KEKAEIAILEALKDAHELS
Y024_PROM3       SSPDGRASIWLSGNQQPLRVRLEPSLLA-------EG----QDASETAILAALQSAYEHS
Y025_PROMM       SSPDGRASIWLSGNQQPLRVRIEPSLLA-------EG----QDASETAILAALQSAYEHS
Y026_SYNS3       NSEDGRASIWLSGNQQPLRVRLDPSLLS-------EG----QEATEAATLAALQSAYERS
Y026_SYNPW       SSEDGRASIWLSGNQQPLRVKLDPSLLN-------EG----QDTAEAAVLAALQSAYERS
Y027_SYNSC       KSSDGRASVWLSGNQQPLRVRLDPALLQ-------EG----QQASETATLEALQAAYEQS
Y027_SYNPX       KSADGRASVWLSGNQQPLRVRLDPELLS-------AG----QETCEAATLEALQAAYEQS
Y023_SYNS9       KNSDGRASVWLSGNQQPLRVRLDPALVQ-------DG----AEACETATLEALQAAYEQS
Y025_SYNR3       SSVDGKASIWLSGNQQPLRVRLAPELLA-------SG----QEATEAATLEALQNAYAQS
Y019_PROM1       TNDDNRAKIWMSGNQKPLRVEIDPSLLS-------EG----KAIIEEAILEAMKSAHEVS
Y1347_PROMT      TNDDNRAKIWMSGNQKPLRVEIDPSLLS-------EG----KAIIEEAILDAMKSAHEVS
Y019_PROMS       KSDDEMIKVWISGNQLPLKVEVQENIFN-------SN----KEQIEKNILQAIKKAHELS
Y019_PROM2       KSDDEMIKVWISGNQLPLKVEVQENILN-------AD----KEKIEKNILQAIQKAHESS
Y019_PROM0       KSDDEMIKVWISGNQLPLKVEVQENFLN-------AD----KEKIEQNILQAIKKAHELS
Y020_PROM9       ESDDEMVKVWISGNQLPLRVEVQENILN-------SD----KEKIEQNILQAIQKAHELS
Y019_PROM5       KSDDEMIKVWISGNQLPLRVEVKDTIAE-------SN----KEEIEKNILEAIKKAHETS
Y020_PROMP       KSDDEMIKVWISGNQLPLRVEVNENIST-------AN----KEEIEKNILEAIKKAHESS
Y2894_SYNJB      EAGNGLVKVTVNGNQEPLKVSLDPQVLQ-------ES----VDVVEDLLLTAMVNAYTQS
Y1369_SYNJA      EAGNGLVKVTVNGNQEPLKVSLDPQVLQ-------EP----VDVVEDLLLTAMVNAYTQS
Y3498_GLOVI      VAGGGLVKVTLSGNQEPTGVTIDPQLLS-------ES----KEVVEDLLLTAYKDAYTKS
Y533_PERMH       EVGGGMVKVILNGLGEIKDVLIDKTLLT-------ED---NHEILQDLLVAAFNEANRRT
Y1366_SULSY      EVGGGMVKVVSDGLGTVLDLEIDKSLLN-------EN---EYPVLKDLLIAAINEVSERS
EBFC_BORBU       KAGSNIVTIEMDGEFNVKKVSINKEFFD------DLD----NDAFEQMIKSALNDAVSKV
EBFC_BORBZ       KAGSNIVAIEMDGEFNVKKVSINKEFFD------DLD----NDAFEQMIKSALNDAVSKV
EBFC_BORAP       KAGSNIVTIEMDGEFNVKKVSINKEFFD------DLD----NDAFEQMVKSALNDAVSKV
EBFC_BORDL       RAGSDVVVVEMNGEFVVKKILIKEDFFN------DLD----NEALEHMIKSAFNDAVFKV
EBFC_BORRA       RAGSDVVVVEMNGEFVVKKILIKEDFFN------DLD----NEALEHMIKSAFNDAVFKV
EBFC_BORHD       RAGSDVIVVEMNGEFLVKKVSIKEEFFS------DLD----NEALEHMIKSAFNDAISKV
EBFC_BORT9       RAGSDVVVVEMNGEFVVKKVVIKEEFFS------DLD----NEALEHMIKSAFNDAISKV
Y3002_LEPBJ      DAGAGMVTVTATGEGQIINVFINKQLFD------SDD----NKMLEDLVMAATNDALKKA
Y065_LEPBL       DAGAGMVTVTATGEGQIINVFINKQLFD------SDD----NKMLEDLVMAATNDALKKA
Y4332_LEPIN      DAGAGMVTVTASGEGQITNVFINKQLFD------ADD----NKMLEDLVMAATNDALKKA
Y3475_LEPIC      DAGAGMVTVTASGEGQITNVFINKQLFD------ADD----NKMLEDLVMAATNDALKKA
Y335_CHLTR       EAGNGLVSVTINGKCDLVDVRIKPDCLD------PED----PEVVADLFRAAFKAAKAAL
Y363_CHLTA       EAGNGLVSVTINGKCDLVDVRIKPDCLD------PED----PEVVADLFRAAFKAAKAAL
Y589_CHLT2       EAGNGLVSVTINGKCDLVDVRIKPDCLD------PED----PEVVADLFRAAFKAAKAAL
Y586_CHLTB       EAGNGLVSVTINGKCDLVDVRIKPDCLD------PED----PEVVADLFRAAFKAAKAAL
Y612_CHLMU       EAGNGLVSVTINGKCNLVDVKIKPDCLD------PED----PEVVADLFRAAFKAAKAAL
Y330_CHLCV       QAGNGLVSVVINGKCDIVSIKVQPTCLD------PEE----PEVVEDLFRSAFKEAKEAM
Y672_CHLFF       QAGNGLVSVVINGKCDIVSVKVQPTCLD------PEE----PEVIEDLFRSAFKEAKTAM
Y326_CHLAB       QAGNGLVSIVINGKCDIVSVKVQPTCLD------PED----PEVIEDLFHSAFKEAKEAM
Y039_CHLPN       QAGNGLVSVVINGKCDLISVKVQPTCLD------PED----PEVIEDLFRAAFKLAKEQM
Y477_PARUW       VAGSGLVTITLTGDGEMKQVKIKPECVD------VED----LEGLEMLIRAAHADAHKRL
Y429_ARCB4       KAGGGMVEISINGNSEVVDLKIDDSLLE------------DKDSLQILLISCMNDVIKQS
Y200_CAMHC       KSGAGMVEIKISGKGEVLDVSIDDSLMS------------DKDSLQILLISAINDAVKLI
Y1848_CAMC1      KSGGGLVSVRANGSGEILDISIDDSLLE------------DKESMQILLISAINDVLKSV
Y1819_CAMC5      KSGGGLVSVKANGKGEILDITIDDSLLE------------DKESLQILLISAINDVLKMA
Y066_CAMFF       KSGGGLISVKANGRSQILDISIDDTLLE------------DKESLQILLISAINDAIKLS
Y1642_CAMJE      KSGAGLVKVSANGKGEIIDVSIDDSLLE------------DKESLQILLISAINDVLAMV
Y113_CAMLR       KSGGGLVKVSANGKGEIIDINIDDSLLE------------DKESMQILLIAAINDVMKMV
Y1681_WOLSU      KSGGGLVSVSMSGAGELLDVSIDDSLLE------------DKESLQILLISAINDVYKSV
Y2278_SULNB      KAGGGLIEVTANGAGEVIDMNIDDSLLE------------DKESLQILLISAMNDVNKMI
Y256_NITSB       KSGGGLIKVTANGKGEIIDIEIDDSLLE------------DKDSLQILLISAINDVLKMV
Y035_HELPY       KSGGGMVSVSFNGLGELVDLQIDDSLLE------------DKEAMQIYLMSALNDGYKAV
Y033_HELPH       KSGGGMVSVSFNGVGELVDLQIDDSLLE------------DKEAMQIYLMSALNDGYKAV
Y031_HELP2       KSGGGMVSVSFNGMGELVDLQIDDSLLE------------DKEAMQIYLMSALNDGYKAV
Y175_HELPS       KSGGGMVSVSFNGVGELVDLQIDDSLLE------------DKEAMQIYLMSALNDGYKAV
Y048_HELAH       KSGGGMVSVSFNGVGELVDLQIDDSLLE------------DKEAMQIYLMSALNDGYKSV
Y032_HELPG       KSGGGMVSVSFNGLGELVDLQIDDSLLE------------DKEAMQIYLMSALNDGYKAV
Y031_HELPJ       KSGGGMVSVSFNGLGELVDLQIDDSLLE------------DKEAMQIYLMSALNDGYKAV
Y332_HELHP       KSGGGLVSVSCNGNGEVIDISIDDSLLE------------DKESLQILLMSALNDVRKSV
Y2555_FLAJ1      QSADGLLKITVTANRKVKSISIDDSLLE------------DKEQLEDYLVVTLNKVIEKA
Y1796_GRAFK      QSSDGLLKITITANREVKNISIDDKLLE------------DKEQLEDYLVLTMNKAIEKA
Y1374_THEAB      SVGGGAIKILATADRKVKDIEIDEDLLS------------DGETLKDLLTAGINELMEKI
Y542_THEM4       SVGGGAIKIFATADRKVKDIEIDEDLLE------------DTETLNDLLIAGINELMEKI
Y687_THEMA       SVGGGAVRIVATCDRRVKDIEIDEDLKE------------DFDTLKDLLIAGMNEVMEKI
Y244_THEP1       SVGGGAVRIVATCDRRVKDIEIDEDLKE------------DFDTLKDLLIAGMNEVMEKI
Y1899_THENN      SVGGGAVRIVATCDRRVKEIEIDEDLKE------------DLETLKDLLAAAVNEIMEKI
Y999_PSELT       TSGGGAVKVTAKCNYEIVSIEYEDSLLE------------DREMFNDLIVAAINEALREV
Y159_MYCA5       K-KQG-IKVVMLGTRKIKTIEISPALIDPE----------DPELVQDLVMLAINEAIDII
Y050_MYCPU       E-KQG-LTLVLNGKREVLKIDINEALVDPE----------DKDILEDLLLLAFNEAMEKI
Y740_MYCMO       S-KQG-VEIVINGAKEITKLVIHPALIDED----------DKETLEDLLILAFNEAISLI
Y600_MYCGA       E-YKKLIKTTLKGNLRIVKLEINKDLIDPE----------DPDTLQDMVTEAINEALGDL
Y807_MYCPE       V-YQKSITIQIKGNYEIIKMDINKELIDPE----------DKTMLEEMISEAINEAISAI
Y088_UREPA       D-YKGYVLVKIKGDLNIEAIEIKTEIVDPE----------DKETLQDILRAAINEAISIT
Y088_UREP2       D-YKGYVLVKIKGDLNIEAIEIKTEIVDPE----------DKETLQDILRAAINEAISIT
Y100_UREU1       D-YKGYVLIKIKGNLTIESIEVKTEIVDPE----------DKETLQDILRAAVNEAISKT
                                                                             

Y1974_KORVE      DQAMQSNLSGMMGGMGLP-------------------GF----------
Y492_ACIC5       EEILKSSMQGLLGGLNLPP------------------GLF---------
Y3777_ANAD2      RTAADESMSKATGGIKIP-------------------GIAG--------
Y3694_ANASK      RTAADESMSKATGGIKIP-------------------GIAG--------
Y3636_ANADE      RTAADESMSKATGGIKIP-------------------GIAG--------
Y3761_ANADF      RAAADEHMARATGGIKIP-------------------GVAG--------
Y1931_MYXXD      RQHMQRELAKISGGVKIP-------------------GIT---------
Y1069_THEYD      HELAQSEMAKVSMPFNLP-------------------GMPDLSSLFGKL
Y1113_GEMAT      ADAMQMELQKVTGGIDLPF------------------KLPF--------
Y1672_METI4      KEASQSQFQKLGGNLGIPG------------------MF----------
Y4780_ALKMQ      EEMVSKEMGKVTGGMNI-------------------PGLF---------
Y2855_ALKOO      DDMMSSEMGKITGKMNM-------------------PGLF---------
Y032_CLOBH       EEDTSSEVKRLTGGMNL-------------------PGMF---------
Y038_CLOBJ       EEDTSSEVKRLTGGMNL-------------------PGMF---------
Y037_CLOB6       EEDTSSEVKRLTGGMNL-------------------PGMF---------
Y048_CLOBL       EEDTSSEVKRLTGGMNL-------------------PGMF---------
Y3166_CLOBM      EEDTSSEVKRLTGGMNL-------------------PGMF---------
Y043_CLOB1       EEDTSSEVKRLTGGMNL-------------------PGMF---------
Y785_CLOBK       EEDTSSEVKRLTGGMNL-------------------PGMF---------
Y074_CLOTE       EHETANEMKKLTGGMNL-------------------PGMF---------
Y126_CLOAB       EEETSGEMKKLTGGLNI-------------------PGL----------
Y3826_CLOK5      EDQTASEMKKLTGGLNI-------------------PGMF---------
Y824_CLONN       DEETANEMKKLTGGLNM-------------------PGMF---------
Y3225_CLOBA      EEETASKMGKLTGGMP--------------------GGLF---------
Y3446_CLOBB      EEETASKMGKLTGGMP--------------------GGLF---------
Y243_RUMCH       DELANSEMSKITGGLGGL------------------PGMF---------
Y2143_ACET2      DEMVTAEISKITGGLGGI------------------PGLF---------
Y017_CLOD6       DDIQASQMSKVTGGMNI-------------------PGLF---------
Y046_CLOPE       SEETSEKMGKLTGGMGM-------------------PGLF---------
Y053_CLOP1       SEETSEKMGKLTGGMGM-------------------PGLF---------
Y056_CLOPS       SEETSEKMGKLTGGMGM-------------------PGLF---------
Y2017_LACE2      EEESQAQMAKITGGLGGLG-----------------GGLF---------
Y329_AGARV       DEQSQASMSKITGGLG--------------------GGLF---------
Y047_LACP7       EEESASAMNSIAGGLGNFGGL---------------GGLF---------
Y1143_CALBD      DKMVEEEMQKVTG-FGI-------------------PGLF---------
Y1593_CALS8      EKMIEEEMQKVAG-FGF-------------------TGLF---------
Y2199_THEP3      EEMIASEMAKITGGLNI-------------------PGLF---------
Y034_THEPX       EEMIASEMAKITGGLNI-------------------PGLF---------
Y040_CALS4       EEMIASEMAKITGGFNI-------------------PGLF---------
Y043_DESRM       QEMVAKEMGKLTGGLNI-------------------PGLF---------
Y052_PELTS       QDMISQEMGRLTGNLKI-------------------PGLF---------
Y028_MOOTA       QEMVTREMAKITGNIRL-------------------PGF----------
Y2790_SYNFM      QEMAAQEMGKIAGGLNI-------------------PGLKIPGLF----
Y020_BACAH       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y020_BACHK       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y020_BACAN       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y027_BACAA       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y027_BACAC       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y027_BACC3       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y027_BACC7       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y024_BACC0       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y021_BACC1       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y027_BACCQ       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y020_BACCZ       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y025_BACCR       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y025_BACC4       DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y5293_BACC2      DELSNSTMGKFTKGLNL-------------------PGGMF--------
Y019_BACMK       DELSNSTMGKFTKGMNL-------------------PGGMF--------
Y019_BACCN       EELSNATMGQFTKGLNL-------------------PGGLF--------
Y018_GEOKA       DELANEMMGQFTKGLNI-------------------PGLF---------
Y017_GEOTN       DELANDMMGQFTKGLNI-------------------PGLF---------
Y020_GEOSW       DELAAEMMGQFTKGLNI-------------------PGLF---------
Y2358_BACLD      DEVTNETMGKFTKGMNM-------------------PGLF---------
YAAK_BACSU       DEITNETMGQFTKGMNM-------------------PGLF---------
Y038_BACSK       DELVEQDLGKFTKGLNM-------------------PGMF---------
Y035_ALKHC       DELVEQDMGKFTKGLNM-------------------PGMF---------
Y030_OCEIH       DEKTNDTMGQFTKGMNM-------------------PGMF---------
Y019_EXIS2       DELVSSKMGKFTQGMNM-------------------PGMF---------
Y1710_EXISA      DQLVNDKMGRFTQGMNL-------------------PGF----------
Y428_STAAB       DELTQERLGKHTQGLNI-------------------PGM----------
Y453_STAA3       DELTQERLGKHTQGLNI-------------------PGM----------
Y436_STAAS       DELTQERLGKHTQGLNI-------------------PGM----------
Y476_STAA1       DELTQERLGKHTQGLNI-------------------PGM----------
Y479_STAAM       DELTQERLGKHTQGLNI-------------------PGM----------
Y434_STAAW       DELTQERLGKHTQGLNI-------------------PGM----------
Y437_STAAN       DELTQERLGKHTQGLNI-------------------PGM----------
Y444_STAA8       DELTQERLGKHTQGLNI-------------------PGM----------
Y443_STAAE       DELTQERLGKHTQGLNI-------------------PGM----------
Y478_STAAT       DELTQERLGKHTQGLNI-------------------PGM----------
Y478_STAAR       DELTQERLGKHTQGLNI-------------------PGM----------
Y2533_STAHJ      DELTQERLGKHTQGLNI-------------------PGM----------
Y521_STAAC       DELTQERLGKHTQGLNI-------------------PGM----------
Y513_STAA2       DELTQERLGKHTQGLNI-------------------PGM----------
Y500_STAA9       DELTQERLGKHTQGLNI-------------------PGM----------
Y2306_STAES      DELTQQRLGKHTQGLNI-------------------PGM----------
Y115_STAEQ       DELTQQRLGKHTQGLNI-------------------PGM----------
Y2277_STAS1      DELTQERLGKHTQGLNI-------------------PGM----------
Y120_STACT       DELTSERLGKHTKGLNI-------------------PGM----------
Y1934_MACCJ      DDVTAQRLGQHTKGLNI-------------------PGMM---------
Y2703_LISMO      EDTTSQTMGKFTQGLNI-------------------PGM----------
Y2831_LISMH      EDTTSQTMGKFTQGLNI-------------------PGM----------
Y2677_LISMC      EDTTSQTMGKFTQGLNI-------------------PGM----------
Y2683_LISMF      EDTTSQTMGKFTQGLNI-------------------PGM----------
Y2851_LISIN      EDTTSQTMGKFTQGLNL-------------------PGM----------
Y2654_LISW6      EDTTSQTMGKFTQGLNL-------------------PGM----------
Y039_LYSSC       EEKTNSTMGKFTQGLNL-------------------PF-----------
Y513_FINM2       LDMSESELGKITGGINI-------------------PGF----------
Y378_LACAC       DEATQASLGKYTKGLM---------------------------------
Y401_LACH4       DEATQASLGKYTKGLM---------------------------------
Y1634_LACDA      DQATQQSLGKYTKGLM---------------------------------
Y1514_LACDB      DQATQQSLGKYTKGLM---------------------------------
Y369_LACGA       DDATQASMGKYTKGLM---------------------------------
Y424_LACJO       DDATQASMGKYTKGLM---------------------------------
Y2444_LACCB      DKETQDKMGKYTRGLPM--------------------------------
Y1227_LACS1      DKQTQETMGKYSRNIPG-------------------L------------
Y699_LACPL       DEQTQSTMGKYTKGLQ---------------------------------
Y1483_PEDPA      DSETNKTMGKYTKGIPG-------------------M------------
Y2780_ENTFA      EKETEATLGKYTKGMPG-------------------F------------
Y128_LACLM       EKVTEQKLGKFTKGLPF--------------------------------
Y106_LACLS       EKVTEQKLGKFTKGLPF--------------------------------
Y120_LACLA       EKVTEQKLGKFTKGLPF--------------------------------
Y1770_STRA1      DDATKKIMGAFAGKMPF--------------------------------
Y1791_STRA3      DDATKKIMGAFAGKMPF--------------------------------
Y1747_STRA5      DDATKKIMGAFAGKMPF--------------------------------
Y368_STRE4       DEATKKTLGAFAGKLPF--------------------------------
Y297_STREM       DEATKKTLGAFAGKLPF--------------------------------
Y1862_STRP1      DETTKKTLGAFAGKLPF--------------------------------
Y1638_STRPF      DETTKKTLGAFAGKLPF--------------------------------
Y1926_STRP8      DETTKKTLGAFAGKLPF--------------------------------
Y1647_STRPD      DEATKKTLGAFAGKLPF--------------------------------
Y1568_STRPM      DEATKKTLGAFAGKLPF--------------------------------
Y1605_STRPB      DEATKKTLGAFAGKLPF--------------------------------
Y1585_STRPC      DEATKKTLGAFAGKLPF--------------------------------
Y1606_STRP3      DEATKKTLGAFAGKLPF--------------------------------
Y1606_STRPQ      DEATKKTLGAFAGKLPF--------------------------------
Y270_STRPG       DEATKKTLGAFAGKLPF--------------------------------
Y1591_STRP6      DEATKKTLGAFAGKLPF--------------------------------
Y1666_STRS7      DEATKKSLGAFAGKLPF--------------------------------
Y1611_STRU0      DEATKKTMGAFAGKLPF--------------------------------
Y394_STRMU       EDATQKTMGAFAGKLPF--------------------------------
Y1102_STRPN      DETTKKKLGAFAGKLPF--------------------------------
Y1174_STRP7      DETTKKKLGAFAGKLPF--------------------------------
Y1024_STRPJ      DETTKKKLGAFAGKLPF--------------------------------
Y1010_STRR6      DETTKKKLGAFAGKLPF--------------------------------
Y1178_STRPS      DETTKKKLGAFAGKLPF--------------------------------
Y1195_STRPI      DETTKKKLGAFAGKLPF--------------------------------
Y1041_STRZJ      DETTKKKLGAFAGKLPF--------------------------------
Y1108_STRZP      DETTKKKLGAFAGKLPF--------------------------------
Y1149_STRZT      DETTKKKLGAFAGKLPF--------------------------------
Y1021_STRP4      DETTKKKLGAFAGKLPF--------------------------------
Y987_STRP2       DETTKKKLGAFAGKLPF--------------------------------
Y326_STRSV       DDATQKKMGAFAGKLPF--------------------------------
Y1598_STRT2      DEATKKSMGAFAGKLPF--------------------------------
Y1560_STRTD      DEATKKSMGAFAGKLPF--------------------------------
Y1598_STRT1      DEATKKSMGAFAGKLPF--------------------------------
Y194_STRSY       DEATQKKLGAFAGKLPF--------------------------------
Y195_STRS2       DEATQKKLGAFAGKLPF--------------------------------
Y558_CHLSY       QQLAEERMQPLTGGLKGLF------------------------------
Y522_CHLAA       QQLAEERMQPLTGGLKGLF------------------------------
Y3200_CHLAD      QQLAEERMQPLTGGLKGLF------------------------------
Y2292_ROSCS      QELAEQRLGPLAGGMKLPGF-----------------------------
Y1534_ROSS1      QELAEQRLGPLAGGMKLPGF-----------------------------
Y1235_THET2      HELSEKEMAKELGGVGQMLGKLF--------------------------
Y1599_THET8      HELSEKEMAKELGGVGQMLGKLF--------------------------
Y199_DEIRA       EGL-QREATAGLGLPGF--------------------------------
Y243_CORGL       ANVAEEKMGPLSQG---------------------MGGLF---------
Y315_CORGB       ANVAEEKMGPLSQG---------------------MGGLF---------
Y210_COREF       ADLAQEKMGPLSQGFGG-----------------DMGSLF---------
Y260_CORDI       GTLAEQKMGPLSQGFDG------------------LGGMF---------
Y2011_CORJK      QTLAEEKMGPLSQG---------------------MSGLGF--------
Y1912_CORU7      QDLAQEKMGPLADLG--------------------GGGLPF--------
Y143_CORK4       QSYAQEKMGPFSQA---------------------LG------------
Y4137_RHOOB      QEIAAQKLGPLAGGFGG-GGL------------PGLPGF----------
Y4210_RHOJR      QEIAAQKLGPLAGGFGG-GGL------------PGLPGF----------
Y390_RHOE4       QEVAAEKLGPLAGGLGG-G-L------------PGLPGF----------
Y319_MYCA9       QELASQRLGPLAGGLGDLGGG------------LGLPGV----------
Y1287_MYCGI      TILAHDKLGPLAGGMGG----------------LGLPGM----------
Y5528_MYCVP      TILAHDRLGPLAGGMGG----------------LGLPGM----------
Y5272_MYCSJ      TILAHDRLGPLAGGMGG----------------LGIPGL----------
Y4993_MYCSK      TILAHDRLGPLAGGMGG----------------LGIPGL----------
Y4904_MYCSS      TILAHDRLGPLAGGMGG----------------LGIPGL----------
Y294_NOCFA       QQLAAERLGPLAGGGSM----------------PGLPGF----------
Y3743_MYCBO      TKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI-
Y3776_MYCBP      TKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI-
Y3753_MYCTA      TKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI-
Y3778_MYCBT      TKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI-
Y3716_MYCTU      TKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI-
Y2330_MYCLE      TKLAQERLGALTSAMRPTAPPPTPP--------TYMAGT----------
Y2330_MYCLB      TKLAQERLGALTSAMRPTAPPPTPP--------TYMAGT----------
Y317_MYCPA       TRMAQERLGSLAGGFG--APPGQPP--------APAPGV----------
Y4556_STRAW      QALQQQKLGPLAQGLGGGG----------------IPGLPF--------
Y3378_STRGG      QALQQEKLGPLAQGLGGGGG---------------IPGLPF--------
Y3619_STRCO      QNLQQQKLGPLAQGMGGGGSG--------------IPGLPF--------
Y254_SACEN       QELQQEKMGPVTGALGGGQG---------------LGGLGLPGL-----
Y045_THEFY       EEIQQQKMGPLAQGLGGGFPG--------------LPGL----------
Y205_CUTAK       RAMQQSLMPQMPSL-----------------------GL----------
Y318_NOCSJ       DALAGEALGPLAGGAEG------------------LPGMPGQLGF----
Y834_CHLP8       AQLAQNEIQKAAGGMINPAD--------------LLKQFGGQG------
Y805_CHLTE       AQLAQSEIQKAAGGMINPAD--------------LMKQFGGQG------
Y1171_CHLPD      AKVAQEELVKVTGGMMNPAD--------------ILKNLNLGK------
Y1174_PELPB      ARLAQEEISKVTGGMMNPAD--------------ILKNLNLGQ------
Y875_CHLL2       AALAQEEISKAAGGMINPAD--------------ILKNMNLGK------
Y1190_CHLCH      LKLAQDEIGKVTGGMMNPTE--------------LLKNLNLGQ------
Y1285_CHLL3      GRMAQEEISKVAGGMINPQD--------------ILKNLGQ--------
Y1034_CHLPM      GRVSQEEIAKVAGGMINPAD--------------ILKNMGK--------
Y1179_CHLPB      ADLAREELSKAAGGMLGGED--------------MLKNFNIGQ------
Y1157_CHLT3      TKMAQEEMSKVTGGMMGDMN--------------FLKNLNMGG------
Y1227_AKKM8      KETAAAEMKKLTGGLDLP------------------PGMGF--------
Y1429_DESPS      KDLSKQEMGQLTGGMNL-------------------PDLTNFLS-----
Y3467_GLUDA      DERASEE--MKKVT----GGMNL------------PAGLK--FPF----
Y260_GRABC       ETMAAEE--MQKVT----GGLNL------------PAGMK--LPF----
Y1999_ACICJ      ETLAAEE--MQKVT----GGISL------------PPGMK--LPF----
Y603_GLUOX       EAASSEA--MRDVT----GGLDL------------PAGLK--LPF----
Y4104_MAGSA      EAAMAEE--MAKMT----GGLNL------------PPGFK--LPF----
Y2305_RHOCS      EAHMAEE--TAKLM----GGLKL------------PPGFK--LPF----
Y3472_RHORT      DEMVKEK--MSELT----GGLKL------------PPGMS--LPF----
Y268_CAUVC       DAKQAQM--MQDAA----GPMAGL-----------MGGLP--GMKF---
Y269_CAUVN       DAKQAQM--MQDAA----GPMAGL-----------MGGLP--GMKF---
Y4574_CAUSK      DAQQAQL--MQEAA----GPMAGM-----------MGGLP--GMKF---
Y369_PHEZH       DEKQAEV--MREAA----GPFAG------------MPGMP--KLF----
Y436_MARMM       EEAQQDI--MKDAA----GGLQL------------PPGMQ--MPF----
Y371_HYPNA       DQAMEDA--MKTAT----AGFGGM-----------LPGFK--LPF----
Y095_AGRFC       EAQAQEK--MADLT----AGLPL------------PPGMK--LPF----
Y231_RHIME       EAVQAEK--TRELT----AGLPI------------PPGMK--LPF----
Y5504_RHILO      EQIMQEK--TKALT----SGLPI------------PPGMK--LPF----
Y033_BRUAB       EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y030_BRUA2       EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y033_BRUSU       EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y035_BRUSI       EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y290_BRUA1       EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y034_BRUC2       EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y1909_BRUME      EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y033_BRUO2       EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y033_BRUMB       EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y022_BRUA4       EAAMAEK--TQSLT----AGLPI------------PPGFK--LPF----
Y231_BARHE       EIAMQEK--TKSMT----AGLPL------------PPDFK--LPFS---
Y219_BARQU       EIAMEEK--TKSMT----AGLPL------------PSGFK--FPFS---
Y257_BART1       DNALEEK--TKSMT----AGLPL------------PSGFK--LPF----
Y1239_BARBK      STAMAEK--TQNIT----AGLPI------------PPGFK--LPFS---
Y7345_BRASB      EAAMQEK--MQAIT----GKLGL------------PPGFG--FG-----
Y764_BRASO       EAAMQEK--MQAIT----GKLGL------------PPGFG--FG-----
YUD3_BRADU       EAAVQEK--MQSLT----GGLGL------------PPGL---FGQ----
Y463_NITHX       EVAMQEK--MQALT----GGLGL------------PPGLG--LG-----
Y368_NITWN       EVAMQEK--MQALT----GGLGL------------PPGLG--FS-----
Y616_RHOPA       EAAMQEK--MQALT----GGLGL------------PPGLG--LG-----
Y620_RHOPT       EAAMQEK--MQALT----GGLGL------------PPGLG--LG-----
Y086_RHOPS       EAAMQEK--MQALT----GGLGL------------PPGLG--LG-----
Y667_RHOP2       EAAMQEK--MQALT----GGLGL------------PPGLG--LG-----
Y4812_RHOP5      EAAMQDK--MKTLT----GGLSL------------PPGLG--L------
Y4847_RHOPB      ESAMQEK--MQALT----GGLSL------------PPGLG--L------
Y7544_AFIC5      EEAMQER--MKALT----GGLSI-------------PGLG--LG-----
Y1981_DICT6      KEKSAEK--MGSLA----DGLPL------------PPGLF---------
Y258_DICTD       KEKSAEK--MGSLT----DGLPL------------PPGLF---------
Y255_BEII9       EQIMEEK--MREVT----GG------------------MQ--LPF----
Y275_METSB       ERLMEEK--MQGVT----AGLAL------------PPGMK--LPF----
Y1224_RICAE      DEDSQNS--LSGAL----NGMRL------------PPGFK--MPF----
Y1337_RICCN      DEDSQNS--LSGAL----NGMRL------------PPGFK--MPF----
Y7555_RICPU      DEDSQNS--LSGAL----NGMRL------------PPGFK--MPF----
Y1562_RICRO      DEDSQNS--LSGAL----NGMRL------------PPGFK--MPF----
Y7310_RICRS      DEDSQNS--LSGAL----NGMRL------------PPGFK--MPF----
Y1365_RICFE      DEDSQNS--LSGAL----NGMSL------------PPGFK--MPF----
Y866_RICPR       DEDSQNS--LSGAL----NGMSL------------PPGFK--IPF----
Y857_RICTY       DEDSQNS--LSGAL----NGMSL------------PPGFK--IPF----
Y6705_RICAH      DEDSQNS--LSGAL----NGMSL------------PPGFK--MPF----
Y5550_RICCK      DEDSQNS--LSGAL----NGINL------------PPGFK--MPF----
Y660_RICB8       DSDSQNS--MSGAL----SGMSL------------PPGFK--MPF----
Y048_RICBR       DADSQNS--MSGAL----SGMSL------------PPGFK--MPF----
YBAB_SALHS       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALNS       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALG2       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALEP       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALDC       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALCH       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALAR       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALA4       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SHISS       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SHIF8       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SHIFL       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SHIDS       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SHIBS       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SHIB3       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALTY       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALTI       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALSV       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALPC       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALPB       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECO81       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOHS       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOL5       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECO7I       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECO45       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOL6       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOSE       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOSM       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECODH       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOLI       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOLC       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOBW       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECO55       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ESCF3       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECO27       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOK1       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECOLU       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECO5E       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECO57       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECO8A       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_ECO24       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
Y2800_CROS8      EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
Y951_ENT38       DETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
Y4227_KLEP3      EETQKEK--MASVS----AGMQ------------LPPGFK--MPF----
Y444_KLEP7       EETQKEK--MASVS----AGMQ------------LPPGFK--MPF----
YBAB_SALPA       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
YBAB_SALPK       EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
Y2678_CITK8      EETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
Y1109_EDWI9      ESEQKER--MASVS----SGMQ------------LPPGFK--MPF----
Y3840_PHOLL      EETQKEK--MAGIS----SGMQ------------LPPGFK--MPF----
Y1177_PECAS      AETQKEK--MATVS----SGMQ------------LPPGFK--MPF----
Y1077_PECCP      AETQKEK--MAAVS----SGMQ------------LPPGFK--MPF----
Y3121_YERPE      DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y2758_YERPP      DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y3197_YERPY      DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y2890_YERPG      DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y2615_YERPA      DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y967_YERPN       DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y993_YERPS       DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y1036_YERPB      DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y3058_YERP3      DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y3092_YERE8      DETQKEK--MASVS----SGMQ------------LPPGFK--MPF----
Y1136_SERP5      DETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y140_PROMH       EETQKEK--MASVS----NGMQ------------LPPGFK--MPF----
Y690_SODGM       AETQKEK--MAAVS----SGMQ------------LPPGFK--MPF----
Y075_ACTPJ       EEMQKEK--MASVT----AGMQ------------LPPGMK--FPF----
Y075_ACTP2       EEMQKEK--MASVT----AGMQ------------LPPGMK--FPF----
Y075_ACTP7       EEMQKEK--MASVT----AGMQ------------LPPGMK--FPF----
Y1040_HAEPS      DEMQKEK--MASVT----AGMQ------------LPPGMK--FPF----
Y780_HAEIE       EELQKEK--MASVT----AGMP------------LPPGMK--FPF----
Y5435_HAEIG      EELQKEK--MASVT----AGMP------------LPPGMK--FPF----
Y442_HAEIN       EELQKEK--MASVT----AGMP------------LPPGMK--FPF----
Y1309_HAES1      EEMQKEK--MASVT----AGMS------------LPPGFK--MPF----
Y308_HISS2       EEMQKEK--MASVT----AGMS------------LPPGFK--MPF----
Y997_ACTSZ       EEMQKEK--MASVT----AGMS------------LPPGFK--MPF----
Y326_HAEDU       EDLQKEK--MASVT----SGMQ------------LPPGMK--LPF----
Y1507_MANSM      DELQKEK--MASVT----AGMP------------IPPGFK--MPF----
Y205_PASMU       EELQKEK--MASVT----AGMA------------LPPGFK--MPF----
Y426_BUCBP       SDLQKQK--MSSIS----SEMK------------FSNNLN--LPF----
YGG0_WIGBR       SEIQQEK--IASVS----SSIQ------------IPEGFK--MPF----
Y116_BAUCH       TEIKKDK--MTSLS----SSLQ------------MPLGFNWNMPFL---
Y482_BUCAI       SEVQKKK--MSAIS----TGMQ------------LPNGFN--MPV----
Y475_BUCA5       SEVQKKK--MSAIS----TGMQ------------LPNGFN--MPV----
Y476_BUCAT       SEVQKKK--MSAIS----TGMQ------------LPNGFN--MPV----
Y467_BUCAP       SEVQKKK--MSAIS----TGMQ------------LPTGFN--IPI----
Y2473_ERWT9      SEAQKDK--MASVS----NGMS------------LPPGFK--MPF----
Y1686_ALIF1      EETQKEK--MASVT----GGMQ------------MPPGFK--MPF----
Y1810_ALIFM      EETQKEK--MASVT----GGMQ------------MPPGFK--MPF----
Y1086_ALISL      EETQKER--MAGVT----GGMQ------------MPPGFK--MPF----
Y2004_VIBVU      EETQKEK--MAAIT----GGMQ------------LPPGMK--MPF----
Y2410_VIBVY      EETQKEK--MAAIT----GGMQ------------LPPGMK--MPF----
Y1055_VIBCH      EETQKEK--MASIT----GGMQ------------LPPGMK--MPF----
Y2178_VIBPA      EETQKEK--MASVT----GGMQ------------LPPGMK--MPF----
Y917_VIBA3       EETQKEK--MAGVT----GGMQ------------LPPGMK--MPF----
Y3086_VIBCB      EETQKEK--MASVT----GGMQ------------LPPGMK--MPF----
Y2216_TOLAT      EEQNKAK--MAEIT----GGMQ------------LPPGFK--MPF----
Y2301_SHEPC      EENQKAK--MAEVT----GGMQ------------LPPGMK--MPF----
Y1707_SHESW      EENQKAK--MAEVT----GGMQ------------LPPGMK--MPF----
Y2014_SHEON      EENQKAK--MAEVT----GGMQ------------LPPGMK--MPF----
Y1770_SHEB2      EENQKTK--MAEVT----GGMQ------------LPPGMK--MPF----
Y2380_SHEDO      EENQKNK--MAEVT----GGMQ------------LPPGMK--MPF----
Y2406_SHEFN      EENQKTK--MAEVT----GGMQ------------LPPGMK--MPF----
Y1591_SHEHH      EENQKEK--MAEVT----GGMQ------------LPPGMK--MPF----
Y1509_SHEPA      EENQKEK--MAEVT----GGMQ------------LPPGMK--MPF----
Y1717_SHEPW      EENQKDK--MAEVT----GGMQ------------LPPGMK--MPF----
Y1794_SHEWM      EENQKDK--MAEVT----GGMQ------------LPPGMK--MPF----
Y2851_SHESH      EENQKER--MAEVT----GGMQ------------LPPGMK--MPF----
Y2234_SHELP      EESQKEK--MAEVT----GGMQ------------LPPGMK--MPF----
Y1311_SHEAM      EENQKTK--MAEVT----GGMQ------------LPPGMK--MPF----
Y1612_MARHV      EANQKDK--MSGMM----SGMG------------MPPGFK--MPF----
Y2276_PSYIN      GEVNKNK--MSGVS----GGME------------LPPGFK--MPF----
Y2212_AERHH      EEQNKSK--MGELT----GGMQ------------LPPGFK--MPF----
Y2087_AERS4      EEQSKSK--MGELT----GGMQ------------LPPGMK--LPF----
Y3743_COLP3      EEQNKDK--MGALT----GGMQ------------LPPGMK--MPF----
Y1098_ALTMD      QETSKEK--MGDVT----GGMP------------LPPGFK--MPGF---
Y1202_PSET1      ADETQER--MGKVT----GGMQ------------LPPGMK--MPF----
Y1848_IDILO      EETSKER--MSEIT----GGMG------------LPPGFK--MPF----
Y2533_MARMS      EVTQKEK--MAAAT----AGMS------------LPPGFK--MPF----
Y1459_CHRSD      EETSRGR--MEEAT----EGMN------------LPPGFK--MPF----
Y1509_ALKEH      EQESQQR--MAGLS----EGMN------------LPSGFK--LPF----
Y231_HALHL       QRESQER--MSGMA----EGMG------------LPPGMK--LPF----
Y1920_ACIF2      EKVSAER--MSEVT----GGMN-------------IPGMN--LPF----
Y1592_ACIF5      EKVSAER--MSEVT----GGMN-------------IPGMN--LPF----
Y2594_NITOC      ETQSKEK--MSSMT----SGML-------------PPGFK--LPL----
Y639_AROAE       ETTTQEK--MAGFT----SGLN------------LPPGMK--LPF----
Y807_DECAR       EALSKDK--MSGFT----SGLN------------LPPGFK--LPF----
Y1611_CHRVO      EATTQER--MSGFT----NGLN------------LPAGMK--FPF----
Y434_NITEU       ETVTQEK--MASVA----GGLG------------LPAGMK--FPF----
Y591_NITEC       EAATQEH--MASVT----SGLG------------LPAGMK--FPF----
Y1439_BORBR      EATSQEK--MASVT----AGMP------------LPPGMK--LPF----
Y1222_BORPA      EATSQEK--MASVT----AGMP------------LPPGMK--LPF----
Y1550_BORPE      EATSQEK--MASVT----AGMP------------LPPGMK--LPF----
Y915_BORA1       EATSQEK--MSALT----AGLP------------LPPGMK--LPF----
Y3552_BORPD      ESTSQEK--MASVT----AGMP------------LPAGMK--LPF----
Y1764_BURCM      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y1737_BURA4      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y1753_BURVG      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y6253_BURCA      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y5127_BURL3      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y1861_BURCJ      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y1826_BURCH      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y1850_BURCC      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y1796_BURM1      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y1499_BURPS      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y2243_BURP0      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y2372_BURP1      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y2205_BURP6      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y1360_BURMA      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y2346_BURM9      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y3622_BURM7      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y3650_BURMS      EATSQEK--MSGMT----SGLP------------LPPGFK--LPF----
Y2220_BURTA      EVTSQEK--MSGMT----AGLP------------LPPGFK--LPF----
Y1827_PARPJ      EATAQEK--MGGMT----SGLP------------LPPGFK--LPF----
Y2072_PARXL      EATAQEK--MGGMT----SGLP------------LPPGFK--LPF----
Y952_PARP8       EATAQEK--MGGMT----SGLP------------LPPGFK--LPF----
Y1036_RALPJ      EATTQEK--MGSLT----SGLGGMAGM-------LPPGFK--LPF----
Y1192_RALSO      EATTQEK--MGTVT----SGLGGMASM-------LPPGFK--LPF----
Y1934_CUPTR      EATTQEK--MGSMT----SGLP------------LPPGFK--LPF----
Y2111_CUPPJ      EATTQEK--MGSMT----SGLP------------LPPGFK--LPF----
Y2128_CUPMC      EATTQEK--MGSMT----SGLP------------LPPGFK--LPF----
Y1046_HERAR      EATSQEK--MAGAT----AGMP------------MPPGFK--MPF----
Y2329_JANMA      EATSQEK--MSGVT----AGMP------------LPPGFK--MPF----
Y1975_LEPCP      EAVSQEK--MGKLT----AGMP------------LPPGMK--FPF----
Y2533_METPP      AATSEEK--MGKLT----AGMP------------LPPGMK--LPF----
Y1533_PSEAE      EQNNQEK--MSGFT----SGMQ------------LPPGFK--MPF----
Y3795_PSEA8      EQNNQEK--MSGFT----SGMQ------------LPPGFK--MPF----
Y4462_PSEAB      EQNNQEK--MSGFT----SGMQ------------LPPGFK--MPF----
Y1786_PSE14      EQASQDK--TASMT----AGMQ------------LPPGMK--LPF----
Y1826_PSEU2      EQASQDK--TASMT----AGMQ------------LPPGMK--LPF----
Y3645_PSESM      EQASQDK--TASMT----AGMQ------------LPPGMK--LPF----
Y2646_PSEMY      EQNSQEK--MAGMT----AGMQ------------LPPGFK--MPF----
Y1984_AZOVD      EQNNQEK--MAGMT----AGMG------------LPPGFK--MPF----
Y1600_PSEP1      EQSSQEK--MGGMT----AGMQ------------LPPGFK--MPF----
Y3833_PSEPG      EQSSQEK--MGGMT----AGMQ------------LPPGFK--MPF----
Y4268_PSEPK      EQSSQEK--MGGMT----AGMQ------------LPPGFK--MPF----
Y3586_PSEPW      EQSSQEK--MGGMT----AGMQ------------LPPGFK--MPF----
Y1789_PSEE4      EQNSQDK--MGSMT----AGMQ------------LPPGFK--MPF----
Y1905_PSEF5      ESNSQEK--MSGMT----AGMQ------------LPPGMK--LPF----
Y4577_PSEFS      EANSQEK--MGGVT----AGMQ------------LPPGMK--LPF----
Y1806_PSEPF      EANSQAK--MGSMT----AGMN------------LPAGMK--LPF----
Y645_POLNS       EAASAQM--MSGAT----AGMP------------MPPGFK--LPF----
Y701_POLAQ       EAASTQL--MSGAT----AGMP------------MPPGFK--LPF----
Y1015_STRMK      DAESKSK--MGSAT----AGMQ------------LPPGMK--LPF----
Y858_STRM5       DAESKSK--MGSAT----AGMQ------------LPPGMK--LPF----
Y1065_XANOR      DAESKDR--MGSAT----AGMQ------------LPPGMK--LPF----
Y965_XANOM       DAESKDR--MGSAT----AGMQ------------LPPGMK--LPF----
Y1110_XANAC      DAESKDR--MGSAT----AGMQ------------LPPGMK--LPF----
Y1128_XANC5      DAESKDR--MGSAT----AGMQ------------LPPGMK--LPF----
Y1002_XANCP      DAESKER--MGSAT----AGMQ------------LPPGMK--LPF----
Y3243_XANC8      DAESKER--MGSAT----AGMQ------------LPPGMK--LPF----
Y3358_XANCB      DAESKER--MGSAT----AGMQ------------LPPGMK--LPF----
Y1216_XYLFM      DAESKER--MGSAT----LGMS------------LPPGFK--LPF----
Y1122_XYLF2      DAESKER--MGSAT----LGMS------------LPPGFK--LPF----
Y1058_XYLFT      DAESKER--MGSAT----LGMS------------LPPGFK--LPF----
Y1808_XYLFA      DTESKER--MGSAT----LGMS------------LPPGFK--LPF----
Y1499_FRATF      EENSTASSNIYKMAK--DAGID------------LPSGIN--FPFK---
Y1411_FRATH      EENSTASSNIYKMAK--DAGID------------LPSGIN--FPFK---
Y1374_FRATO      EENSTASSNIYKMAK--DAGID------------LPSGIN--FPFK---
Y810_FRATT       EENSTASSDIYKMAK--DAGID------------LPSGIN--FPFK---
Y810_FRAT1       EENSTASSDIYKMAK--DAGID------------LPSGIN--FPFK---
Y1023_FRATM      EENSTASSDIYKMAK--DAGID------------LPSGIN--FPFK---
Y607_FRATW       EENSTASSDIYKMAK--DAGID------------LPSGIN--FPFK---
Y1196_FRATN      EENSTASSDIHKMAK--DAGID------------LPSGIN--FPFK---
Y120_FRAP2       ED-SSSSADIGKMAK--EAGID------------LPNGFN--FPFK---
Y1774_ALCBS      EKQQQDS--MQNMA----GGFP------------FPPGFK--P------
Y3038_LEGPC      EKASKEK--ISQLT----AGLN------------IPTDLM--GGKEGE-
Y2672_LEGPL      EKASKEK--ISQLT----AGLN------------IPTDLM--GGKEGE-
Y2803_LEGPA      EKASKEK--ISQLT----AGLN------------IPTDLM--GGKEGE-
Y2755_LEGPH      EKASKEK--ISQLT----AGLN------------IPTDLM--GDKEGE-
Y2614_HAHCH      EKNNQDK--MSNMT----AGLG------------IPPNFK--MPF----
Y1327_METCA      AKLKQEK--MAGLT----GSLG------------IPPGFN--LPF----
Y742_NEIG1       EETANKT--MGAFTQD------------------LPPGVGDFFR-----
Y1136_NEIG2      EETANKT--MGAFTQD------------------LPPGVGDFFR-----
Y1444_NEIMB      EETANKT--MGAFTQG------------------LPPGVGDFFR-----
Y1380_NEIMF      EETANKT--MGAFTQG------------------LPPGVGDFFR-----
Y1657_NEIMA      EETANKT--MGAFTQG------------------LPPGVGDFFR-----
Y1355_NEIM0      EETANKT--MGAFAQG------------------LPPGVGDFFR-----
Y1909_ACIB5      EVVSEEK--MQKAN----SGMG------------LPPGLA--GMF----
Y1813_ACIB3      EVVSEEK--MQKAN----SGMG------------LPPGLA--GMF----
Y1718_ACIBC      EVVSEEK--MQKAN----SGMG------------LPPGLA--GMF----
Y1684_ACIBT      EVVSEEK--MQKAN----SGMG------------LPPGLA--GMF----
Y1967_ACIBY      EVVSEEK--MQKAN----SGMG------------LPPGLA--GMF----
Y1914_ACIBS      EVVSEEK--MQKAN----SGMG------------LPPGLA--GMF----
Y793_PSYA2       DELYETT--MAGAT----SGMG------------LPPGMQ--GMF----
Y799_PSYCK       DALYEET--MAGAT----SGMG------------LPPGMQ--GMF----
Y1729_PSYWF      DELSETT--LAKAT----SGMG------------LPPGMQ--GLFG---
Y656_COXBU       LKITQEK--MMSAGSL-FGGNE-------------SDNEE---T-----
Y1351_COXB2      LKITQEK--MMSAGSL-FGGNE-------------SDNEE---T-----
Y772_COXBR       LKITQEK--MMSAGSL-FGGNE-------------SDNEE---T-----
Y1603_COXB1      LKITQEK--MMSAGSL-FGGNE-------------SDNEE---T-----
Y666_COXBN       LKITQEK--MMSAGSL-FGGNE-------------SDNEE---T-----
Y701_BUCCC       TELQKKK--IILKT---------------------PFHNE---------
Y5067_NOSS1      TATMRER--MEDLTSG--LELP---------------GF----------
Y2322_TRIV2      TATMRER--MEDLTSG--LELP---------------GF----------
Y448_NOSP7       TATMRER--MEELTSG--LELP---------------GF----------
Y899_CYAP4       TTTMRER--MEELTGG--LSLP---------------GM----------
Y723_THEEB       TATMRER--MEELTGS--LNVP---------------GLG---------
Y464_SYNE7       TAAMKEK--MEALTAG--LGIP---------------GL----------
Y1054_SYNP6      TAAMKEK--MEALTAG--LGIP---------------GL----------
Y2224_GLOC7      TDTMRQK--MEELTSG--LNLP---------------GL----------
Y1847_SYNY3      TETMRSK--MEELTSG--LNLP---------------GM----------
Y2554_RIPO1      TETMRTK--MEELTSG--LNLP---------------GL----------
Y2391_MICAN      TETMRSK--MEELTSG--LNIP---------------SM----------
Y020_PROMA       TSNMKSR--MQELTGGLNLNLP---------------GINDDN------
Y020_PROM4       TSTMKER--MQELTGGLNLNLP---------------GIDDGD------
Y024_PROM3       TTTMKEQ--MEELTGGLNLNLP---------------GMSD--------
Y025_PROMM       TTTMKEQ--MEELTGGLNLNLP---------------GMSE--------
Y026_SYNS3       TGTMKER--MEELTGGLNLNLP---------------GMGG--------
Y026_SYNPW       TATMKER--MQDLTGGLDLNLP---------------GMGG--------
Y027_SYNSC       TATMKGR--MEELTGGLNLNLP---------------GMGG--------
Y027_SYNPX       TATMKGR--MEELTGGLNLNLP---------------GMGG--------
Y023_SYNS9       TATMKGR--MEELTGGLNLNLP---------------GMGG--------
Y025_SYNR3       TATMKER--MEELTGG--LNLP---------------GLGG--------
Y019_PROM1       TSTMKER--MEDLTGGFKLNLP---------------GMGEES------
Y1347_PROMT      TSTMKER--MEDLTGGFKLNLP---------------GMGEEN------
Y019_PROMS       TTTMKER--MNDLTGGLNLNLP---------------GFDNSDS-----
Y019_PROM2       TTTMKER--MNDLTGGLNLNLP---------------GFDNSDS-----
Y019_PROM0       TTTMKER--MNDLTGGLNLNLP---------------GFDNNDS-----
Y020_PROM9       TTTMKER--MNDLTGGLNLNLP---------------GFDNTDS-----
Y019_PROM5       TTTMKER--MNDLTGGLNLNLP---------------GLDNNDS-----
Y020_PROMP       TTTMKER--MNDLTGGLNLNLP---------------GLDNNDS-----
Y2894_SYNJB      AETMRKR--MEELTGN--ISLP---------------GLGLG-------
Y1369_SYNJA      AETMRKR--MEELTGN--ISLP---------------GLGLG-------
Y3498_GLOVI      AETMKAK--MQELTGG--MELPP--------------GLGF--------
Y533_PERMH       KEVMGEK--MTQAA-----GLPS-----------NIPGLGNLF------
Y1366_SULSY      KEVVADK--ISQAT-----GLPM-----------NMSKFGGMF------
EBFC_BORBU       KEEIKLK---TMGVLPFGM------------------------------
EBFC_BORBZ       KEEIKLK---TMGVLPFGM------------------------------
EBFC_BORAP       KEEIKLK---TMGVLPFGM------------------------------
EBFC_BORDL       KEEIKSK---TMGSIPFGI------------------------------
EBFC_BORRA       KEEIKSK---TMGSIPFGI------------------------------
EBFC_BORHD       KEEIKSK---TMGSMPFGI------------------------------
EBFC_BORT9       KEEIKSK---TMGSIPFGI------------------------------
Y3002_LEPBJ      KEATAYEFQAASGGLDFSEISKMFGGNFG--------------------
Y065_LEPBL       KEATAYEFQAASGGLDFSEISKMFGGNFG--------------------
Y4332_LEPIN      KEATAYEFQSASGGLDFSEISKMFGGKFG--------------------
Y3475_LEPIC      KEATAYEFQSASGGLDFSEISKMFGGKFG--------------------
Y335_CHLTR       DSEMSAM----QMGMPF--------------------------------
Y363_CHLTA       DSEMSAM----QMGMPF--------------------------------
Y589_CHLT2       DSEMSAM----QMGMPF--------------------------------
Y586_CHLTB       DSEMSAM----QMGMPF--------------------------------
Y612_CHLMU       DSEMSAM----HMGMPF--------------------------------
Y330_CHLCV       DKEMSVM----RAGMPF--------------------------------
Y672_CHLFF       DQEMSVM----RAGLPF--------------------------------
Y326_CHLAB       DKELSVM----RASMPF--------------------------------
Y039_CHLPN       DQEMSLM----RSTMPF--------------------------------
Y477_PARUW       KEQSPPI----PGFPGFLA------------------------------
Y429_ARCB4       DENKKMMAMNLMGGLGSFGQK----------------------------
Y200_CAMHC       DNEKKNLAAKMLGDIGNLGGFGCEK------------------------
Y1848_CAMC1      EADKKNTASRMLGGLASMGIK----------------------------
Y1819_CAMC5      EDDKKAIAGRMLGGLGDFGFKG---------------------------
Y066_CAMFF       EDEKKRAASAMFGGLGGFGV-----------------------------
Y1642_CAMJE      AQNRSSMANDVLGGFGGMKL-----------------------------
Y113_CAMLR       EQNKKSMASNLFSGMGVL-------------------------------
Y1681_WOLSU      EENKKSMTLGMLGGMAPFPFGS---------------------------
Y2278_SULNB      EDNKKSQAMGMMGGMNPFGS-----------------------------
Y256_NITSB       EEDKQRSALSMMTP-DIFGQK----------------------------
Y035_HELPY       EENRKNLAFNMLGN---FAKL----------------------------
Y033_HELPH       EENRKNLAFNMLGN---FAKL----------------------------
Y031_HELP2       EENRKNLAFNMLGN---FAKL----------------------------
Y175_HELPS       EENRKNLAFNMLGNLGNFAKL----------------------------
Y048_HELAH       EENRKNLAFSMLGN---FAKL----------------------------
Y032_HELPG       EENRKNLAFNMLGN---FAKL----------------------------
Y031_HELPJ       EENRKNLAFNMLGN---FAKL----------------------------
Y332_HELHP       EDNRQSSAMNLFNGLGTDLNIFGGKPNG---------------------
Y2555_FLAJ1      TSVNERELDAVARMDMPSIPGMDNLFK----------------------
Y1796_GRAFK      TNINEAEIGAAAKDGMPDIPGMDGLMK----------------------
Y1374_THEAB      EKIREEEMAKVT--QNLLPFGF---------------------------
Y542_THEM4       EKIREEEMAKIT--QNFLPF-----------------------------
Y687_THEMA       EKRREEEMSKIT--QQFGIPGLM--------------------------
Y244_THEP1       EKRREEEMSKIT--QQFGIPGLM--------------------------
Y1899_THENN      EKRREEEMSKIT--QQFGIPGLM--------------------------
Y999_PSELT       TKKREEELSKIV--GLSGLPGL---------------------------
Y159_MYCA5       DEEYDELGDKYS--NTSI-------------------------------
Y050_MYCPU       DEAHKEIEKQIP--SGKLPF-----------------------------
Y740_MYCMO       SEEEAKIAPKAN--SLGF-------------------------------
Y600_MYCGA       EKKRDELSNSIT--PPIKFPGF---------------------------
Y807_MYCPE       TEEKEKITKGAM--PF---------------------------------
Y088_UREPA       CKERDAIMNATI--PKGTGLF----------------------------
Y088_UREP2       CKERDAIMNATI--PKGTGLF----------------------------
Y100_UREU1       CKERDAIMNSTI--PKGTGFF----------------------------