CLUSTAL format seed alignment for MF_00276

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KDPC_RHILO        ---------------------MLKQIRPAIVMIVFFTVLTGLVYPLGMTGIAQALFPRQA
KDPC_AGRFC        ---------------------MFRQFRPALVLILATTAITGLAYPLGMTGLAQALFPVQA
KDPC_BRADU        ---------------------MLREIRPAIVLLLVLTAITGLAYPLAMTGIAGMLFPAQA
KDPC_CAUVC        ---------------------MLSHLRPALVSMGLFTVLLGLAYPLAVTGVAQAAFPNQA
KDPC_RHIME        ---------------------MLNQLRPALVLTFALTLITGLGYPLLITGVAQALMPAEA
KDPC_MYCTU        ---------------------MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQA
KDPC_DEIRA        MTTPNANLQNSAPLPAERPTPLPRLLLSALLAAVLFMLVCGLAYPLLTTVVAGAAFPNQA
KDPC_ECO57        ----------------------MRGLRPALSTFIFLLLITGGVYPLLTTALGQWWFPWQA
KDPC_ECOLI        ----------------------MSGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQA
KDPC_SALTI        ----------------------MIGLRPAFSTMLFLLLLTGGVYPLLTTALGQWWFPWQA
KDPC_SALTY        ----------------------MIGLRPAFSTMLFLLLLTGGVYPLLTTALGQWWFPWQA
KDPC_YERPE        ----------------------MSYLRPALVLLILLTLITGIAYPLLTTGLAHLMFSQQA
KDPC_RALSO        -------MATTTQPAHAEAPQQGGLLRAALVIFVGLSLVTGVLYPVVVTGIGKAAFPAQA
KDPC_LISMO        ------------------MKRFMQIWKPAVIGFLLLTLVCGVLYPGVVTVFAGVAFHDKA
KDPC_LISIN        ------------------MKRFMQIWKPAVVGFLLLTLVCGVIYPGVVTIIAGAAFQDKA
KDPC_CALS4        ---------------------MGEEIKRTIKFTLVFMVLLGLVYPFVMTGIANLLFPYQA
KDPC_CLOAB        ----------------------MKYFKSALRLGIVLIIICGLIYPLFITAVGQTVFHNKA
KDPC_BACTN        ----------------------MKTLFKSLKITLVFCVFFSVFYILILWLFAQVAGPNKG
KDPC_SYNY3        ---------------------MIRNFVISLRSTALLWILTALIYPAIVLVIGQLVFPYQA
KDPC2_NOSS1       -------------------MSFIREILRAIRITLIFWLVTAIIYPLAILVVGQGLFPIQA
KDPC1_NOSS1       -------------------MSFAREASRAIRSSFVLWVIAAVIYPFFMIAVGQIVFPHQA
KDPC_PSEPK        ---------------------MTAYLRPALSLALLMTLVTGALYPLAVTGIAQVAFPNQA
KDPC_PSESM        ---------------------MSSVLRPALSLIVLMSLITGVAYPLVVTGVAQVAFPAQA
KDPC_PSEAE        ---------------------MFKQLRPALASLLVLSLVTGVAYPLLVTGIAQLAFPEQA
K1JF85_9GAMM      --------------------------MIAIRTLLTLTLLLGVAYPLAVTGLAQLIFPWQA
K0AG99_EXIAB      -------------------------MKQAIRVTVFITALCGIVFPALLTLFGQLLVPDKA
A4WZ31_RHOS5      ----------------------MKDIISGLRVTAATMAICVAGYTTVILGFAQAVTPATA
KDPC_LEPIN        -------------------MIFLNIISISIRLLLILTLITGILYPIVTTGFAERFFPFRS
A4FMI5_SACEN      -----------------MKSTLVRQSLAGLRLLLVMTAILGVLYPLAVWGVSRLPGLRAG
Q5YZH7_NOCFA      ------------MRFGTLLTNLARQTRAGAIVLLLLTAVVGAAYPAAVWAVSRID--RAA
KDPC_STRCO        --------------MNTSLTNAARLFTAGLRALLVLTVVTGIVYPLVVTGVAQGL-FPGK
I0H1T0_ACTM4      ----------------MRLPSWLSQHLAALRALLVFTVLLGLAYPLIFVGVGKIPGISDR
KDPC_XANCP        -------------MSTSLPLRDDGAVRASFALALFVLLGLGLGYSLVATGITSALMPDQA
KDPC_XANAC        -----------------MPLRDDGVLRGSLVLAVFTLFGLGLAYSLIATGITGALFSEQA
KDPC_HALSA        --------------------MNRQDLAVPLRLLGVSLLVFGLLYQGSLMAIGDAVFPNSS
F8G9R8_FRAST      ----------------------MKNLFKSFMAMFFLTIVLGLVYPFFIMAIGYGVAHDQA
KDPC_THEAC        ----------------------MKSYLKALVFAVLFLFILGFVYPTVTSLITEHALPFQS
KDPC_THEVO        ---------------------MVKSPLKALVISLVFLFVLGFLFPTVTSLITEKALPNQS
Q6L2R2_PICTO      ---------------------MVKRVFKAIVLSIIVMLIAGFAFPAIASLITEETLPFYS
                                                             :      .         

KDPC_RHILO        NGSLIEK-------------------------DGKVIGSELIGQ----------------
KDPC_AGRFC        NGSMIEK-------------------------DGKVVGSQLIGQ----------------
KDPC_BRADU        QGSLIEK-------------------------DGKVIGSALIGQ----------------
KDPC_CAUVC        NGSLIRDA------------------------DGKVVGSALIGQ----------------
KDPC_RHIME        NGSLVRK-------------------------GSVLIGSQLIGQ----------------
KDPC_MYCTU        NGALLER-------------------------DGQVIGSAHIGQ----------------
KDPC_DEIRA        GGSLVTR-------------------------NGQVVGSAVLGQ----------------
KDPC_ECO57        NGSLIREG-------------------------DTVRGSALIGQ----------------
KDPC_ECOLI        NGSLIREG-------------------------DTVRGSALIGQ----------------
KDPC_SALTI        NGSLIHKD-------------------------NLIRGSALIGQ----------------
KDPC_SALTY        NGSLIHKD-------------------------NVIRGSALIGQ----------------
KDPC_YERPE        SGSLARLG-------------------------DNVVGSTLIGQ----------------
KDPC_RALSO        GGSIIERG-------------------------GKPVGSALIGQ----------------
KDPC_LISMO        NGSIIEEKL--------------------ADGTTGKVGSAEIGQ----------------
KDPC_LISIN        NGSIIEGKL--------------------ADGETGKYGSTEIGQ----------------
KDPC_CALS4        KGSIIKVD-------------------------GKPVGSELIGQ----------------
KDPC_CLOAB        NGSIVTFK-------------------------GKEVGSALLGQ----------------
KDPC_BACTN        NAEVATLD-------------------------GKVVGAANVGQ----------------
KDPC_SYNY3        NG------------------------SLITDSQGQVVGSALIGQ----------------
KDPC2_NOSS1       NG------------------------SIMENIEGTPIGSTLISQ----------------
KDPC1_NOSS1       NG------------------------SLVRDSRGQVLGSTLIGQ----------------
KDPC_PSEPK        NG------------------------SLVRDAQGQVRGSALIAQ----------------
KDPC_PSESM        NG------------------------SLLYDEAGKVRGSALIAQ----------------
KDPC_PSEAE        NG------------------------SLLRDAEGKVLGSRLIAQ----------------
K1JF85_9GAMM      NG------------------------SLLTNDKQQVVGSALLAQ----------------
K0AG99_EXIAB      EG------------------------SLLQQ-NGKFIGSELIAQ----------------
A4WZ31_RHOS5      NG------------------------SLITQGDGSVIGSRLIAQ----------------
KDPC_LEPIN        SG------------------------SRVVI-QGKIVGSELIAQ----------------
A4FMI5_SACEN      AE-----------------------GSQVV-VDGRVVGSSLIGVDPVPADPA--------
Q5YZH7_NOCFA      AE-----------------------GAPLTDVHGCVVGSRLLAVDPVVPAGQ--------
KDPC_STRCO        AN-----------------------GSEIK-ADGKVVGSSLIGQSYNLPLKEGR------
I0H1T0_ACTM4      SGDLTLIGQSFTDADGNPVTRYFQSRPSAGGYDPTATGASNLGPEDVVDTPDRQSLLTQV
KDPC_XANCP        HG-------------------------SLLRADGRVIGSSLVAQ----------------
KDPC_XANAC        TG-------------------------SLMRVDARVVGSALVAQ----------------
KDPC_HALSA        AGSPVYVD-----------------------GQEQPVGSQMIGQQFRPG-----------
F8G9R8_FRAST      TGSQVYYN-------------------------GNVVGSELIGQ----------------
KDPC_THEAC        EGQP-------------------------VEIDGHIYGSYLLAE----------------
KDPC_THEVO        EGQP-------------------------IKIDGKVYGSYLLAE----------------
Q6L2R2_PICTO      NGHP-------------------------VTVDNKVVDSYLLAE----------------
                                                       .:  :.                 

KDPC_RHILO        -----------------AFASDKYFHGRPSAA------------GNGYDAGA--------
KDPC_AGRFC        -----------------AFTGETYFHGRPSAA------------GDGYNAAS--------
KDPC_BRADU        -----------------EFKDDKYFHGRPSATLAPDPNDSTKTVSAPYNAAN--------
KDPC_CAUVC        -----------------VFAKPEYFHGRPSAA------------GAGYDASA--------
KDPC_RHIME        -----------------NFASEKYFWPRPSATG-----------PEPYNAVA--------
KDPC_MYCTU        -----------------QFTAAKYFHPRP--SSAGDG----------YDAAA--------
KDPC_DEIRA        -----------------NFTAPRYLHGRPSMTSKTDGSG-----PEPYNAEN--------
KDPC_ECO57        -----------------NFTDNGYFHGRPSATAE-----------MPYNPQA--------
KDPC_ECOLI        -----------------NFTGNGYFHGRPSATAE-----------MPYNPQA--------
KDPC_SALTI        -----------------SFTAAGYFHGRPSATAD-----------TPYNPLA--------
KDPC_SALTY        -----------------SFTAAGYFHGRPSATAD-----------TPYNPLA--------
KDPC_YERPE        -----------------NFTQPGYFTGRPSATAD-----------RPYNPMA--------
KDPC_RALSO        -----------------NFSEPQYFWGRLSATSP-----------NPYNGAA--------
KDPC_LISMO        -----------------TFTEPEYLIGRAASDG---------------------------
KDPC_LISIN        -----------------TFTQPEYLIGRAASDG---------------------------
KDPC_CALS4        -----------------KFTDPRWFMGRPSAVD--------------YDATS--------
KDPC_CLOAB        -----------------NFTDKRFFRGRVSSVN--------------YNTYTKNDSNKDE
KDPC_BACTN        -----------------MFTKDIYFWGRPSCAGD------------GYDASS--------
KDPC_SYNY3        -----------------TFTEEGYFWSRPSAINYSEGAD-----------------ASPT
KDPC2_NOSS1       -----------------VFTSEKYFHSRPSAVRYSQGRK-----------------AKPT
KDPC1_NOSS1       -----------------PFTSDRYFNSRPSTTVYSTANPNKDD-----------NLVLQT
KDPC_PSEPK        -----------------DFQGDGWFHSRPSAGAYA------------------------T
KDPC_PSESM        -----------------SFTGDEWFQSRPSAGAFA------------------------T
KDPC_PSEAE        -----------------KFDGEEWFHSRPSAGDYA------------------------T
K1JF85_9GAMM      -----------------KFERADYFHSRPSASDFA------------------------T
K0AG99_EXIAB      -----------------PFTSKQYFHGRPSAVDQL------------------------A
A4WZ31_RHOS5      -----------------GFTSPEYVWPRPSAVDYD------------------------A
KDPC_LEPIN        -----------------KFIKDEYFWPRPSAMDYA------------------------A
A4FMI5_SACEN      ---------RDP---YFHLRPAAS--AQTATGPGD------------------------P
Q5YZH7_NOCFA      ---------PDP---YFHPRLRGS--GDDAFAPGD------------------------P
KDPC_STRCO        -------ETPEPDLRWFQGRPANGLGTNTVNTRYE------------------------L
I0H1T0_ACTM4      CARSLAVGKLEGVDGSRPFCTADGVGAVLAVFHRD------------------------G
KDPC_XANCP        -----------------PFADARYFQPRPSAAKYD------------------------P
KDPC_XANAC        -----------------PFTDARYFQPRPSAAKYD------------------------L
KDPC_HALSA        -----------------QPEDVQYFWSRPSANDYN------------------------A
F8G9R8_FRAST      ------------------TMPDSLFQSRPSASGYN------------------------P
KDPC_THEAC        -----------------AFNSSFFFHPRPSAIDYNLS-----------------------
KDPC_THEVO        -----------------AFNSSIFFHPRPSAIGYNLS-----------------------
Q6L2R2_PICTO      -----------------AFNNSVFFQPRPSAINYNLS-----------------------
                                                                              

KDPC_RHILO        --SGGSNLGPTNPKLIERIKGGAEKLKAEN---------------------PNQPVPMDL
KDPC_AGRFC        --SSGSNLGPTSAKLIDRVKTDYEAAKAEN---------------------PAAEVPADL
KDPC_BRADU        --SGGSNLGPTSKALADRLKEDVDKLKAEN---------------------PNAAVPVDL
KDPC_CAUVC        --SSGSNMGPLNETLIARLKTDAAALRAEN---------------------PGVAIPADA
KDPC_RHIME        --SSGSNLGTTSDKLKERVAADIERLRAAG---------------------IGGEIPADA
KDPC_MYCTU        --SSGSNLGPTNEKLLAAVAERVTAYRKENN------------------LPADTLVPVDA
KDPC_DEIRA        --SGASNWGPTNAKLQGAVQGRIAAFRQENG------------------LGADVPVPIDA
KDPC_ECO57        --SGGSNLAVSNPELDKLIAARVAALRAAN-------------------PNASTSVPVEL
KDPC_ECOLI        --SGGSNLAVSNPELDKLIAARVAALRAAN-------------------PDASASVPVEL
KDPC_SALTI        --SGGSNLAASNPELDAQIQARVAALRAAN-------------------PQASSAVPVEL
KDPC_SALTY        --SGGSNLAASNPELDAQIQARVAALRAAN-------------------PQASSAVPVEL
KDPC_YERPE        --SGGSNLASSNPALGQAIGERVKLQRQAN-------------------PTQLGPVPVDL
KDPC_RALSO        --SSGSNLGPSNPALTDAAKARIAALKEAD-------------------PANTAPIPVDL
KDPC_LISMO        ---VATNLNPTSEEQKQLVEKRIAWWHKLD-------------------PTNNRVIPMDL
KDPC_LISIN        ---AATNLNPTSEEQKQLVEKRITWWHKLD-------------------PANNRVIPMDL
KDPC_CALS4        --SGGTNYALSNPKFHEELEKNIEEFLKKNP------------------GVKRSEIPADI
KDPC_CLOAB        VASGSQNLAPSNKDLKNRVKKDIDDFLKTHP------------------GVKKDEIPTDL
KDPC_BACTN        --SSGSNKGPTNPEYLAEVEARIDTFLVHHP------------------YLSRKDVPAEM
KDPC_SYNY3        GISGASNLAPSNPDLLSRIEAE-AQRLED----------------------NAVQPTADL
KDPC2_NOSS1       GISGGSNLAPSNPALLERIIEE-ANQLRD----------------------ENVQPIADL
KDPC1_NOSS1       GISGASNLAPSNPQLIERIKDEDLNRLQT----------------------SGIQPTADL
KDPC_PSEPK        VASGASNLSPSNPALAERVKGDAATLYQA----------------------QQGPVPQAL
KDPC_PSESM        VASGASNFAPSNPALATRVTEDAAKLANA----------------------AQGPVPLAL
KDPC_PSEAE        VSSAASNLAPSNPALAERIARDAAQERIA----------------------DQGPVPLAL
K1JF85_9GAMM      IGGGASNLGMSSPLRAEF----AAAVARA----------------------QPEARVPAL
K0AG99_EXIAB      GASAGDNLAASNPELTTKIKEQQEQSKE-----------------------DGRSLPDDA
A4WZ31_RHOS5      AGAGGSNLSPANPELAERALALIAAHGR-----------------------DGAPIPADL
KDPC_LEPIN        GASNASVTNVFLKAKVEERKKFLLEKHS-----------------------EQTQVPPDL
A4FMI5_SACEN      SATGGSNLAGDNPELLAAVGERRAVIA-------------------AREGVAPERVPVDA
Q5YZH7_NOCFA      AAALPTNQGPSSELLAGWIGQRRAAIA-------------------AREGVAPERVPVDA
KDPC_STRCO        ILSGATNRSADDPELLQWVQDAKAAVVRDN--------------SVPGHPVRPEDVPADA
I0H1T0_ACTM4      FTGPITRVVSVNQTGVPFVATYQGVVVEPAREGDDYRALGGVITPIRGDAPAEPAVPADA
KDPC_XANCP        TAAAGSNQARSNPELLARIATARAEIAQ-------------------RDGIAPDAVPGEL
KDPC_XANAC        TAAAGSNQARSNPDLLARIATTRAQVAA-------------------RDGIAPEAVPGEL
KDPC_HALSA        MTSASTNWGPTNPLLSERVRADLQNISQYETP--------------------DDSVPVNL
F8G9R8_FRAST      LATGGTNYAVNNQTQLQDVKNRIKDLQAKY---------------------GVKTIPEDL
KDPC_THEAC        -ESGSYDYSLGNPAMLNLTEKYLHRFLSENPG------------------VNISEIPYAM
KDPC_THEVO        -ESGSYPYSLGNPEVLNLTEKYLDEFLKDNPG------------------INASQIPYAM
Q6L2R2_PICTO      -CSGAYSYSLTNPEVYNITKNDLKKFAEYNH-------------------VNESKIPSAM
                                                                              

KDPC_RHILO        VTTSGSGLDPQISPEAAYFQVPRVAKAR---------GIDEAKVKALV---DGQVEGREL
KDPC_AGRFC        VTASGSGLDPHVSPEAAYFQVPRVAKAR---------GMDETALRALV---DRHVEAPEL
KDPC_BRADU        VTTSASGLDPDISPEAAQFQVPRVAKAR---------NMPEEAVKQLV---ASNVQGRLL
KDPC_CAUVC        VTTSGSGLDPDISPANARFQAPRVAGAR---------GVPEKDVTALI---DAQVQQPLL
KDPC_RHIME        GMASGSGLDPHISPEFARVQIARVAKAR---------GLPEAGVDALV---DRATQGRLF
KDPC_MYCTU        VTGSGSGLDPAISVVNAKLQAPRVAQAR---------NISIRQVERLI---EDHTDARGL
KDPC_DEIRA        VTASASGLDPDVTLATALLQVNRIAQAR---------GMQPAGVEKVI---RAHLKGRDL
KDPC_ECO57        VTASASGLDNNITPQAAAWQIPRVAKAR---------NLSVEQLTQLI---AKYSQQPLV
KDPC_ECOLI        VTASASGLDNNITPQAAAWQIPRVAKAR---------NLSVEQLTQLI---AKYSQQPLV
KDPC_SALTI        TTASASGLDNNLTPGAAAWQIPRVAAAR---------QLPVEQVAQLV---AEYTHRPLA
KDPC_SALTY        ATASASGLDNNLTPGAAAWQIPRVAAAR---------QLPVEQVAQLV---AEYTHRPLA
KDPC_YERPE        VTASGSGLDPHISLAAAYYQAPRIASIR---------QMPLSDVQQLI---DNSMQKAIP
KDPC_RALSO        VTASASGLDPHISPAAAAYQVERVARAR---------HLPVERVKTLV---AEHTTAPIL
KDPC_LISMO        VTASASGVDPDISEAAAAYQVDRISRER---------GISTKEVKEII---AEHTSNRLL
KDPC_LISIN        VTASASGVDPDISEAAAAYQVDRISRER---------GISTKVVKEII---AENTSKRLL
KDPC_CALS4        VTSSGSGLDPHISPKAAYLQVKRVAKVN---------GLPEEVVKKLV---DKNIEGRFL
KDPC_CLOAB        LTSSGSGLDPDISPKAAEIQVPSVSKAT---------GISQSKLKQII---KKCTEGRTL
KDPC_BACTN        VTASASGLDPNITPQCAYVQVKRVAQAR---------GLTENQVKEIV---DQSVEKPLL
KDPC_SYNY3        LYSSGSGLDPHISPAAAQAQFDRVAKAR---------SIPPQELQSLI---TKHTEGRFL
KDPC2_NOSS1       IYSSGSGLDPHISVQAARQQLERVARAR---------GVQPDEILLAI---NKFTDGRFL
KDPC1_NOSS1       VYTSGSSLDPHITPEAARAQVSRIAKVR---------QLPPQQLETLI---TQNTDSRFL
KDPC_PSEPK        LTTSGSGLDPHLPPEALAYQIPRVAAAR---------QLPVERLQALL---EQATLH---
KDPC_PSESM        LTTSGSGLDPHLSPEAIAWQAGRVAAAR---------QLPLDKLQALI---DASTQR---
KDPC_PSEAE        VTTSGSGLDPQLPPQAARYQALRVATAR---------GLPLRLVEDLV---ESHTER---
K1JF85_9GAMM      LTRSASGLDPHLPLDAVLAQVERVAGQR---------GLDPVRLTEQV---KSAAQA---
K0AG99_EXIAB      RVTSGSGFDPHISLDYARAQVNRIATER---------DLSRGEVRRLI---DQEAGN---
A4WZ31_RHOS5      VTASGAGLDPHVSLEGALFQVDRVAEAR---------RVEPAAVRAII---DRMAHR---
KDPC_LEPIN        LFASGSGLDPHISPDSALFQINRVAKSR---------KLTEGQILRLK---NIVEESVEK
A4FMI5_SACEN      VTASASGADPHISPAYAELQVARVARVT---------GLPEAEVRRLV---AEHTSG---
Q5YZH7_NOCFA      VTGSGSGVDPHISPAYAELQVPRVARVT---------GLGEQRVRALV---AEHTAGRQA
KDPC_STRCO        VTSSGSGLDPDISPRYADLQVHRVAAKN---------GLPAERVQELV---DEHTTPRTL
I0H1T0_ACTM4      VTASGSGLDPHISPAYAEIQAPRVARER---------GISLDRVRQLI---TDNTDGRAL
KDPC_XANCP        LTQSGSGLDPHLSPAGAQVQLRRVAAAR---------GWPEQRVAALLQ--AATEQ-PQF
KDPC_XANAC        LTQSGSGLDPHLSPAGAQVQIRRVAAAR---------GWPEQRVAALVQ--ATTEAAPQF
KDPC_HALSA        VSESGSSYDAHISPAAAEYQVLRVANQT---------GISEQRLNEMI---DEATKEPWL
F8G9R8_FRAST      VFASGSGVDPEISLQAALYQSAYIAQKN---------NLSIDQVNKLI------KENTEE
KDPC_THEAC        ISYSGSGLDPGIPLQGAIIQIPRISIAIHNIT-----NLSVSDLYSYLYNLVNSTKTQNF
KDPC_THEVO        LSYSASGLDPNIPLQGALIQIPRISIALHSIT-----NNSVSLWENYLNDLVNKYTTQNF
Q6L2R2_PICTO      VSYSGSGLDPSIPLNGAELQVNRIANAIYNMAKNKSVDLNISSIKAFLLNIINRDKRMNF
                     *.:. *  :.      *   ::                                   

KDPC_RHILO        GFMGEPVVNVLALNLALDAAK----------------------
KDPC_AGRFC        GFMGEPVVNILALNMALDAAGS---------------------
KDPC_BRADU        GLLGEPRVNVLALNLALDRAAAK--------------------
KDPC_CAUVC        GFIGQPRVNVLALNRALDARYPPLASQKDG-------------
KDPC_RHIME        GLIGEPRVNVLELNLALDAPRT---------------------
KDPC_MYCTU        GFLGERAVNVLRLNLALDRL-----------------------
KDPC_DEIRA        GLLGEPRVNVLAVNLSLDGQ-----------------------
KDPC_ECO57        KYIGQPVVNIVELNLALDKLDE---------------------
KDPC_ECOLI        KYIGQPVVNIVELNLALDKLDE---------------------
KDPC_SALTI        SFLGQPVVNIVELNLALDALQGHRAK-----------------
KDPC_SALTY        RFLGQPVVNIVELNLALDALQGHRAK-----------------
KDPC_YERPE        SFFGEPVVNVLNLNMALDSHSHVKVPANPAKP-----------
KDPC_RALSO        GVFGEPVVNVLELNLGLGDLK----------------------
KDPC_LISMO        GFWGEPTVNVLQVNLALDRLKM---------------------
KDPC_LISIN        GFWGEPTVNVLQVNVALDSLKM---------------------
KDPC_CALS4        GLFGEPRVNVLKLNLSLLEEIKKHKK-----------------
KDPC_CLOAB        GVLGEERVNVLKVNLEVASMLKNSKIGE---------------
KDPC_BACTN        GIFGTEKINVLKLNIALEENK----------------------
KDPC_SYNY3        GIFGEPGVNVLTLNLALDNR-----------------------
KDPC2_NOSS1       GIFGEPGVNVLRLNYALDLQDINRQQN----------------
KDPC1_NOSS1       GIFGEPGVNVLQLNLALDELKPT--------------------
KDPC_PSEPK        PLIGPPVVNVLALNQALEKLAIVR-------------------
KDPC_PSESM        PLIGPPVVNVLTLNMSLNQLPSAPRNAQL--------------
KDPC_PSEAE        PLVGPAVVNVLALNMALAGLKR---------------------
K1JF85_9GAMM      GILGPQVVNILQLNLQLDHQKGA--------------------
K0AG99_EXIAB      ----HEYVNVLLLNLALDRSQS---------------------
A4WZ31_RHOS5      ----PGGSSPRRPSSTSWN------------------------
KDPC_LEPIN        GYIGENRINVLLLNLKLDSEFGIILK-----------------
A4FMI5_SACEN      GVLQERVVNATELNLAV-AAAS---------------------
Q5YZH7_NOCFA      GFLGAERVEVPALNVAL-GLTAPGCGVGG--------------
KDPC_STRCO        GFIGEPRVNVLELNIALVELVAPGAGH----------------
I0H1T0_ACTM4      GFLGQPVVNVLKLNLALDRPSNHPDHRP---------------
KDPC_XANCP        GLLGQPRINVLALNLALDRAGDGVPGTENGVEQQR--------
KDPC_XANAC        GLLGQPRVNVLALNLALDQAGNGESGRGNGVKQAH--------
KDPC_HALSA        GIWGHERVNVLELNLMVRDALNEQNETDQNSDMNASEIANGDH
F8G9R8_FRAST      HLFNVATVNVLPLNIALLQLIGKNSQGISSLI-----------
KDPC_THEAC        PFFGSYYVNVVRLNVDIVEFLLKGGYISQSQI-----------
KDPC_THEVO        PFFGSYYVNIMYLNVNILEYLMNNGYIKSLNSIPP--------
Q6L2R2_PICTO      PIFGTYYVNVVRLNFDIIYYLMDKHIINNSFLE----------
                          .    .