CLUSTAL format seed alignment for MF_00277

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLND_RHILV      ----MRDLDFTNILDVELLQKQCDAVAEANRNRP--DVLRADLLAVLKKASTEGRQKARE
GLND_RHITR      --METHHIDFSTVLDVSALKAECEALAKRGLDK---NEERSALLALLKKASQDGREEARR
GLND_AGRFC      --MAIKDLDFSDILDVSALKRDCDVIFKEDSKRI--ADIKSDLLPIFRRASTEGREKARE
GLND_RHIME      --MARHETSFPEILDVAALRARCDFIASAHAEQR--EPMRRALLAAFKEANVAGRAKARE
GLND_BRUME      --MSAHDLKLEEIVNAETLRRKLNELADTADESYTSLPMRKVVLQTLKDALASGRANAED
GLND_RHILO      --MAKISLKLDELIDGEALRREMTALTTATAGDGSGAAARAGVLQLLKARLAEGRKIAEA
GLND_CAUVC      MPRRLRPTRLEHVVDGHALRARLSAAALDSIGNE--AEQRARAIDILKQALFRGRMIAKE
GLND_NEIMA      ---------------------------------------MPANLSSALETFKQQRDAAEA
GLND_NEIMB      ---------------------------------------MPANLSSALETFKQQRDAAEA
GLND_RALSO      ----------------------------------MHTAAAATPATSPRDILKAERAHLFA
GLND_AZOVI      -------------------MPQVDPDLFDPGQFQAELALKSSPIPAYKKALRCAREVLDA
GLND_PSEAE      -------------------MPQVDPELFDRGQFQAELALKSSPIAAFKKAIRQFREVLDN
GLND_ECOLI      -----------MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQRWLGD
GLND_ECO57      -----------MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQRWLGD
GLND_SALTI      -----------MNTLPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDIFQHWLGE
GLND_SALTY      -----------MNTLPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDIFQHWLGE
GLND_KLEOX      --------------MSNSLSNTVPPDLSAQPENPGEWPKSDFNCATIKALIDAFQRWLGE
GLND_YERPE      ---------MSDNHTEHSLSLTLTPTISEQPALPSTYLDSDIHCPILKQRLDAFQRWQAE
GLND_VIBCH      ----------------------------MPYQSPITFQEPQLTVESLKQQLESFTEYQKQ
GLND_ALIF1      ----------------------------MKYLSPLSLSDTQLNITELKQQLTLFSQYQIN
GLND_HAEIN      -------------------------------MLFSPTLSSLLTPSAVKIERENLKQFELE
GLND_PASMU      -------------------------------MLFPYFPLSELDVSAVRTQKENLKQFELT
GLND_MYCTU      ---------------------------------------MEAESPCAASDLAVARRELLS
GLND_STRCO      --------------------------------------MTDEAEDSGPGGYAAARLRLLT
                                                                            

GLND_RHILV      ALMADGGGLNCAYRISWLQDQITTVLYNFATAHIFPQ----QKDKFAVTAVGGYGRDTLA
GLND_RHITR      LLIADGSGLNCAHRISWLQDQIITVLYDLTVHHAYPK----QAGVFSVTAVGGYGRDTLA
GLND_AGRFC      LLKADGSGIDCARRISWLQDRLIETLYDLACQHVYPK----DAPQIAVAAVGGYGRGTLA
GLND_RHIME      LLAADGAGIKCAERISWLQDQLITLLHDFVLNQVFDAAKAPEASRIAVTAVGGYGRGTLA
GLND_BRUME      MLMKDGGGTLCAKRLCYLMDTLIDILFEFATTRAYPTRNPSKAENMALVAVGGYGRGGLA
GLND_RHILO      MLKEDGGGNACAERLSHLMDELIRALYDFAATHVYRVKNRSSAERMAVVAVGGYGRGTLA
GLND_CAUVC      RLENGASGVETSRLLSGVTDEVITALYDFTTVHVFRARNPTEGERLCLLAVGGYGRGTLA
GLND_NEIMA      HYLKANRVSVFFREYTAAVETLLAALWAEYFQNS--A--------LCLMAVGGFGRGELY
GLND_NEIMB      HYLKANRVSVFFREYTAAVETLLAALWAEYFQNS--A--------LCLMAVGGFGRGELY
GLND_RALSO      QFEQHANVNLLVTKLARAVDQALILLWQDEGMPD--T--------CALVAVGGYGRGELF
GLND_AZOVI      RFQEGRDIRRLIEDRAWFVDQILALAWNRFDWSEDAD--------IALIAVGGYGRGELH
GLND_PSEAE      RFNSGRDIRRLIEDRAWCVDQILQQAWQRFDWGDDAD--------IALVAVGGYGRGELH
GLND_ECOLI      AFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIAD--------LALVAVGGYGRGELH
GLND_ECO57      AFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIAD--------LALVAVGGYGRGELH
GLND_SALTI      AFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIAD--------LALVAVGGYGRGELH
GLND_SALTY      AFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIAD--------LALVAVGGYGRGELH
GLND_KLEOX      AFDSGIAAERLIEARTEFIDQLLQRLWVEYGFGSIND--------IALVAVGGYGRGELH
GLND_YERPE      AFNSGTSAEVLIAARSDYIDHLLQRLWTFYGFDKVPE--------TALVAVGGYGRGELH
GLND_VIBCH      EFFDHHPVTDLVLGRSEYMDLLLHRLWQFFGFDELVE--------VSLVAVGGYGRGELH
GLND_ALIF1      AFHQHKAVSDLVLERSHYFDQLLSRLWQFFKFDDIAN--------TSLIAVGGYGRSELH
GLND_HAEIN      NF-SCYSIFELIENRCDFYDALLIQLWQEIGLSEQQG--------ISLIAVGGYGRREMF
GLND_PASMU      QF-AHYEIYDLITNRTQFCDHLLRDLWLRFGLVKDNT--------LTLIAVGGYGREEMF
GLND_MYCTU      GNHRELDPVGLRQTWLDLHESWLIDKADEIGIADASG--------FAIVGVGGLGRRELL
GLND_STRCO      EGARSGPP--RRRALAELTDGWLAGLFGA-ATEEHTG--------ISLVAVGGYGRGELS
                                   :                           : .*** **  : 

GLND_RHILV      PGSDIDLLFLFLPRPAEETHKAVEFMLYVLWDMGFKVGHATRTVEECIALSKSDMTIRTA
GLND_RHITR      PGSDIDLLFLFQPKPASETHKAVEFILYMLWDMGFKVGHATRSVEECIREAKSDMTVRTA
GLND_AGRFC      PGSDIDLLFLLPAKNTPDMHKAVEFVLYLLWDLGFKVGHATRTVDECIRLSKSDMTIRTA
GLND_RHIME      PGSDIDLLFLLPAKKAVWAEPAIEFMLYILWDLGFKVGHATRTIEECIRLSRADMTIRTA
GLND_BRUME      QGSDIDLLFLLPYKQTPWGEQVVEYTLYMLWDMGLKVGHSTRNIDECIRLAREDMTIRTA
GLND_RHILO      PGSDIDLLFLLPYKQTPWGEQTVEYMLYMLWDLGLKVGHATRNIDECLRLSRTDITIRTS
GLND_CAUVC      PFSDIDLLFLRPYKQTPHAESVIEYMLYALWDLGFKVGHASRTIEECVRLSKEDFTIRTS
GLND_NEIMA      PCSDVDLAVVSPAPLSDGIQEQIARFVQTLWDCKLMPSVKSGSVDELCESVRNDITGDTA
GLND_NEIMB      PCSDVDLAVVSPAPLSDGIQEQIARFVQTLWDCKLMPSVKSGSVDELCESVRNDITGDTA
GLND_RALSO      PHSDVDILLLLPQTADKALETRLEAFIGHCWDMGLDIGSSVRTVDECISEATQDVTVCTS
GLND_AZOVI      PYSDIDLLILMDGADHEVFREPIEGFLTLLWDIGLEVGQSVRSLAECAEEAQADLTVITN
GLND_PSEAE      PYSDVDLLILLDSEDQESFREPIEGFLTLLWDIGLEVGQSVRSVQQCAEEARADLTVITT
GLND_ECOLI      PLSDVDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATN
GLND_ECO57      PLSDIDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATN
GLND_SALTI      PLSDIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVATN
GLND_SALTY      PLSDIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVATN
GLND_KLEOX      PLSDIDLLILSRKKLPDEQAQKVGERLALLWDIKLEVGHSVRTLEECLLEGLSDLSVATN
GLND_YERPE      PLSDIDVLVLSKQRLNDEQAQRVGQLITLLWDLKLEVGHSVRTLEECLLEGLADLTIATN
GLND_VIBCH      PLSDIDLLVLSQQPLSEQVANKISQFLTLLWDLKLEIGHAVRTVEQCAEIGKADLTVATN
GLND_ALIF1      PLSDIDILILTENNTNDAFCQKVGELVTLLWDLKLEVGHSVRSIAECIEIGQNDLTVATN
GLND_HAEIN      PLSDLDFLILVEQTPSHEIEEKITQFIQFLWDCGFEVGNSVRTLEQCELEGKQDITIATN
GLND_PASMU      PLSDLDFLILTSEQVEAQTEQKIRQFVQFLWDCGFDVGHAVRTLSECEQAGRDNITVATN
GLND_MYCTU      PYSDLDVLLLHDGKPADILRPVADRLWYPLWDANIRLDHSVRTVSEALTIANSDLMAALG
GLND_STRCO      PRSDLDLLLLHDGRDDKAVAALADRLWYPVWDLGIDLDHSVRTPQQARKTAGQDLKVHLG
                  **:*. .:                    **  :  .    .  :       :.     

GLND_RHILV      ILEMRYICGLQRLETELETRFDKEIVTGTGPEFIAAKLAERDERHRKAGDTRYLVEPNVK
GLND_RHITR      ILETRYICGNVALERELQARFDKEIVTNTGPEFIAAKLAERDERHRKAGDTRYLVEPNVK
GLND_AGRFC      ILEVRAICGRKSLTDDLEKRFESEVVTGTGPEFIAAKLAERDQRHRKAGDTRYLVEPNVK
GLND_RHIME      ILECRYVCGSAALANELETRFDHEIVRNTGPEFIAAKLAERDERHRKAGDTRYLVEPNVK
GLND_BRUME      LLDARFLTGDKDLFRTLEIRFEEEIVKGTEPEFIQAKLAERDARHRKAGETRYLVEPNVK
GLND_RHILO      ILEARFLWGERKLYDELMLRFDHEVVRTTGPEYVQAKLAERDERHAKAGESRYLVEPNVK
GLND_CAUVC      ILEARRLTGDERLAEDLKKRFRDEVMKATGAQFVAAKLKERDDRQARAGASRYMVEPNVK
GLND_NEIMA      FLEARFLFGNRQTADKLAEKMNAQRNVAA---FVEAKLVEMEHRHAKSQGSGAVLEPNIK
GLND_NEIMB      FLEARFLFGNRQTVDKLAEKMNAQRNVAA---FVEAKLVEMEHRHAKSQGSGAVLEPNIK
GLND_RALSO      LLEARLLTGDEGLYRTFETHYQGHLDAAD---FYQSKMLEMRQRHAKYQDTPYSLEPNCK
GLND_AZOVI      LMESRTIAGPEHLRQRMQEVTSAQRMWPSR-AFFLAKRDEQKTRHARYNDTEYNLEPNVK
GLND_PSEAE      LMECRTICGPDSLRQRMLQVTGSAHMWPSK-EFFLAKRHEQQRRHAKYNDTEYNLEPNVK
GLND_ECOLI      LIESRLLIGDVALFLELQKHIFSEGFWPSD-KFYAAKVEEQNQRHQRYHGTSYNLEPDIK
GLND_ECO57      LIESRLLIGDVALFLELQKHIFSEGFWPSD-KFYAAKVEEQNQRHQRYHGTSYNLEPDIK
GLND_SALTI      LIETRLLIGDVALFLALQKHIFSEGFWPSD-KFYAAKVEEQNQRHQRYHGTSYNLEPDIK
GLND_SALTY      LIETRLLIGDVALFLALQKHIFSEGFWPSD-KFYAAKVEEQNQRHQRYHGTSYNLEPDIK
GLND_KLEOX      LIESRLLIGDVALFLELQKHIFSDGFWPSE-KFFAAKVEEQNDRHQRYHGTSYNLEPDVK
GLND_YERPE      MIESRLICGDVALFLQMQKHIFSDSFWPSP-QFFHAKVVEQQERHKRYHGTSYNLEPDIK
GLND_VIBCH      LQEARLLCGCEETFHRLKMVIHSESFWPSE-IFYQAKVREQKERHARYHDTTYNLEPDIK
GLND_ALIF1      LQEARYISGNKELSHQLKLKIHSDSFWPSE-LFYQAKIDEQKKRHSRYHDTTYNLEPDIK
GLND_HAEIN      LLEARFLTGNRPHFDVLNELVKRADFWSKE-DFFNAKVQEQIERYQRYHNTAYNLEPDIK
GLND_PASMU      LLEARYLEGNFSQFQQLDNVLQKADFWPRE-AFFQAKYQERVERYQRYHNTSYNLEPDIK
GLND_MYCTU      MLEARHIAGDQQLSFALIDGVRRQWRNGIR-SRMGELVEMTYARWRRCGRIAQRAEPDLK
GLND_STRCO      LLDARHLAGDLGLTASLRTAVLADWRNQAP-KRLPELRDLCAERAERQGELQFLLEPDLK
                : : * : *       :                          *  :        **: *

GLND_RHILV      EGKGGLRDLHTLFWISKYYYHVRDQAELVKLGVLSKHEYRLLEKADDFLWAVRCHMHFLT
GLND_RHITR      EGKGGLRDLHTLFWISKYYYHVRDPAELVKLGVLSKQEYRLFEKAEDFLWAVRCHMHFLT
GLND_AGRFC      EGKGGLRDLHTLFWIAKYYYHVRDTADLVKLGVLSRSELKLFEKADDFLWAVRCQMHFIT
GLND_RHIME      EGKGGLRDLHTLFWISKYFYRVKDSADLVKLGVLSKQEYKLFQKAEDFLWAVRCHMHFLT
GLND_BRUME      EGKGGQRDLHTLFWITKYFYRVKTKEELVKLGVLSRAELKLFNKAEDFLWAVRCHMHFAT
GLND_RHILO      DGKGGLRDLQTLFWIGKYFYRVRTGEELVEKGVFTEAEYREFQKAEDFLWAVRCHMHFLT
GLND_CAUVC      EGKGGLRDLHTLMWIAEYLHPVDRPEDVFKMEVFSIRETKAFIRAFDFLHAVRAHLHFTT
GLND_NEIMA      SCPGGLRDIHTLLWIAKAQGLATDLPDLLKQRILTRAEAGMLSHGYRRLAHIRIHLHLNA
GLND_NEIMB      SCPGGLRDIHTLLWIAKAQGLATDLPDLLKQRILTRAEAGMLSHGYRRLAHIRIHLHLNA
GLND_RALSO      ESPGGLRDLQVILWMTRAAGFGSSWNELLVNQLLTRREAKELAANERLLKTIRARLHLLA
GLND_AZOVI      GSPGGLRDIQTLLWIARRQFGTINLHAMVGQGFLLESEYTLLASSQEFLWKVRYALHMLA
GLND_PSEAE      GSPGGLRDIQTILWMARRQFGSLNLHALVREGFLVESECSMLASSQEFLWRVRYALHMLA
GLND_ECOLI      SSPGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVV
GLND_ECO57      SSPGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVV
GLND_SALTI      SSPGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAECAELNECLHILWRIRFALHLVV
GLND_SALTY      SSPGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAERAELNECLHILWRIRFALHLVV
GLND_KLEOX      SSPGGLRDIHTLQWIARRHFGATSLDEMVGFGFLTEAERNELNECLHQLWRIRFALHLEL
GLND_YERPE      SSPGGLRDIHTLLWVARRHFGATSLSEMVDFGFLTNAERNELNESQSFLWRIRFALHLVL
GLND_VIBCH      STPGGLRDIHTLSWVARRHFGATSLYEMSRFGFLTDAEYRELVECQDFLWRVRFALHIEL
GLND_ALIF1      SSPGGLRDIHTLSWIARRHFGATSLLEMSQAGFLTDAEYRELLECQEFLWRVRFALHIEL
GLND_HAEIN      FSPGGLRDLHLLYWVALRHSGALTLEAILQSGFIYPQEYQQLQESRAFLFKVRFALHLIL
GLND_PASMU      HSPGGLRDLHLLYWIALRHTGAKNLTDILNSGFIYPQEYAQLLESQQFLFKVRFALHLIL
GLND_MYCTU      LGRGGLRDVQLLDALALAQLIDRHGI------GHTDLPAGSLDGAYRTLLDVRTELHRVS
GLND_STRCO      EARGGLRDATALRAVA-ASWL-------------ADAPREGLAEARRRLLDVRDALHLAT
                   ** **   :  :                          :      *  :*  :*   

GLND_RHILV      GKAEERLSFDIQREIAEAFGYHT--RPGLSAVERFMKHYFLVAKDVGDLTRILCAALEDQ
GLND_RHITR      GKAEERLSFDIQRDIAAALDYNA--RPGLSAVERFMKHYFLVAKDVGDLTRILCAALEDQ
GLND_AGRFC      GKAEERLSFDIQREIADALNYQP--RPGLSAVERFMKHYFLVAKDVGDLTRIVCAALEDR
GLND_RHIME      GKAEERLSFDIQREIAEALGYHD--HPGLSAVERFMKHYFLVAKDVGDLTRIFCSALEDQ
GLND_BRUME      LKAEERLSFDIQPEIAQRLGYTA--HPGQNYVERFMKHYFLVAKDVGDLTRIICAALEEQ
GLND_RHILO      GKAEERLHFDIQREIAERLGYTT--HPGLSAVERFMKHYFLVAKDVGDLTRIFCAALEEE
GLND_CAUVC      GRPEERLTFDLQPEIARRMGYGD--RGDAPAVERFMRRYFLIAKEVGTLTRAFSAKLEAE
GLND_NEIMA      KRAEDRLLFDLQPQVAESMGYEG--LNLRRQSEELMRVFYRAIKTVKQLSGILTPMLRSR
GLND_NEIMB      KRAEDRLLFDLQPQVAESMGYEG--LNLRRQSEELMRVFYRAIKTVKQLGGILTPMLQSR
GLND_RALSO      GRRQDVLVFDLQTQLGEAFGYRP--NAAKRTSEQLMRRYYWAAKAVTQLNTVVLQNIEAR
GLND_AZOVI      GRAEDRLLFDLQRQIAGLLGYED--SDAKLAVERFMQKYYRVVLGIAELTELVFQHFEEV
GLND_PSEAE      GRAEDRLLFDHQRSIARLFGYED--NDVKLAVERFMQKYYRVVMAISELNDLIIQHFEEV
GLND_ECOLI      SRYDNRLLFDRQLSVAQRLNYS---GEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEA
GLND_ECO57      SRYDNRLLFDRQLSVAQRLNYS---GEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEA
GLND_SALTI      SRYDNRLLFDRQLSVAQRLNYS---GEGNDPVERMMKDYFRVTRRVSELNQMLLQLFDEA
GLND_SALTY      SRYDNRLLFDRQLSVAQRLNYS---GEGNDPVERMMKDYFRVTRRVSELNQMLLQLFDEA
GLND_KLEOX      NRYDNRLLFDRQFSVARRLRYE---GESNQPIEHMMKDFFRVTRRVSELNQMLIQLFEEA
GLND_YERPE      TRYDNRLLFDRQLSVAQLLRYE---GEGNEPVEHMMKDFYRMTRRVSELNNMLLQLFDEA
GLND_VIBCH      KRYDNRLTFAHQVQVARHLGYF---GEGNRGIEMMMKEFFRTLRRVAELNKMLLKIFDKA
GLND_ALIF1      KRYDNRLTFGHQASVAEHLGFI---GEGNRGVERMMKEFYRTLRRVAELNSMLLKIFDQA
GLND_HAEIN      KRYDNRLLFDRQIKVSELLGFR---GEGNPAVEKMMKCFFQALHRISLISNLLIQHYREN
GLND_PASMU      KRYDNRLLFERQIRVAELLEFV---GPGNQGVEKMMKSFFQALQTISLLSDLLVKHYREH
GLND_MYCTU      GRGRDHLLAQFADEISAALGFGDRFDLARTLSSAGRTIGYHAEAGLRTAANALPRRGISA
GLND_STRCO      GRATDRLALQEQDQVAAELGLLDADALLRQVYEAARVISYAGDVTWREVGRVLRSRSVRP
                 :  : *       :.  :             .      :            .       

GLND_RHILV      QAKSIPGLTGVISRFTHRNRKIAGSVEFVEDRGRIALADPEVFKRDPVNIIRLFHVADIN
GLND_RHITR      QAKATPGLTGVISRFANRSRKIPGTVEFVEDRGRIALANPDVFKRDPVSLIRLFFVADIN
GLND_AGRFC      QAKDVPGLSGVLSRFAHRVRKIPGSVEFVEDRGRIALARPDVFKNDPVNLIRLFHIADIN
GLND_RHIME      QAKDTPGITGVISRFRNRVRKIAGTLDFVDDGGRIALAGTDVFKRDPVNLMRLFHIADIN
GLND_BRUME      QAKHVPGFNRIFLTFSRRKRKLSDDGAFISENHRINIARPDIFRQDPVNMIRLFHLADRH
GLND_RHILO      QAKHVPGFNRIFLTFQRRKRKLAGTSDFIVDNHRINIADDQVFERDPVNLLRLFWFADKH
GLND_CAUVC      HFKNEPKGISRFLPGARPKRKALDVEGFYEDGGRLNIEGQEIFEADPVNLIRLFKIADER
GLND_NEIMA      VSSA-----------PMRVTLR-IDDDYIQVNNQIAARHTDIFFRRPEHIFKIVEIMQQR
GLND_NEIMB      VSST-----------PLRVTLR-IDDDYIQVNNQIAARHTDIFFRRPEHIFKIVEIMQQR
GLND_RALSO      LFPT-----------ELGITRT-INGRFVERQGMLEIADPELYQREPAAILETFLVYEQT
GLND_AZOVI      ILPG-----------DAAGRVEPLNERFQVRDGYLEVTHAGVFQETPSALLEIFVLLARR
GLND_PSEAE      ILPC-----------EQPVQIQPLNSRFQLRDGYIEVTHPNVFKRTPFALLEIFVLMAQH
GLND_ECOLI      ILAL-----------PADEKPRPIDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVHN
GLND_ECO57      ILAL-----------PADEKPRPIDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVRN
GLND_SALTI      ILAL-----------PADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRN
GLND_SALTY      ILAL-----------PADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRN
GLND_KLEOX      ILAL-----------TEDEKPRPIDDDFQLRGTLIDLRDDTLFIREPQAILRMFYTMVRN
GLND_YERPE      ILAL-----------DANEKPRPLDEEFQLRGDLIDLRDENLFVRQPEAIMRMFYLMVRN
GLND_VIBCH      ILNN-----------GEEAEAVIIDDDFQRRGNMIEARKPALFQARPETILDMFLHMASD
GLND_ALIF1      ILHQ-----------GEQDDAIIIDDDFQRRGRLIEARKPALFQARPDTILDMFLLMAND
GLND_HAEIN      VLSS-----------NQDTVIDQLDDDFQLINQSLCLRNSFVFQEKPARILDLFFYLTQY
GLND_PASMU      FLQT-----------NEPVQVRLLDKEFQCVNNAICLRQANLFVEQPEQILSLFFHLTQD
GLND_MYCTU      LVRR--------------PKRRPLDEGVVEYAGEIVLARDAEPEHDPGLVLRVAAASADT
GLND_STRCO      RLRAMMNGRN---GGKPVAERSPLAEGVVEQDGEAVLARTARPERDPALPLRAAAAAAQA
                                                              *   :         

GLND_RHILV      G--LEFHPDALKRVTRSLALIDNALRENDEANRLFMSILTSKRDPALILRRMNEAGVLGR
GLND_RHITR      G--LEFHPDALKRVTRSLSLIDNDLRENEEANRLFLSILTSKRDPALILRRMNEAGVLGR
GLND_AGRFC      N--LELHPDALRVVTRSLSLINDELRENEEANRLFLSILTSRRDPALTLRRMNEAGVLGK
GLND_RHIME      G--LEFHPAALKQVTRSLGLITPHLRENEEANRLFLSILTSRRNPELILRRMNEAGVLGR
GLND_BRUME      G--LEFHPEAMQSLTRSLKLINADLRENPEANRLFLEILTSPRNPELILRRMNESGVLGK
GLND_RHILO      G--LEFHPDALKLLTRSLGLVNKSLRRDEEANRLFLDILTSDRNAELNLRRMNEAGLLGR
GLND_CAUVC      D--LDLHPDAFTAVTRALPLITSRVRRDPDACRAFLDLLARGKRSYRTLTLMNDAGVLGR
GLND_NEIMA      NDITALEPQTLRAWWGATRKINRSFYQNSENRHRFAGFFRNGNGLTQTLRFLNLYGVLGR
GLND_NEIMB      NDITALEPQTLRAWWGATRKINRSFYQNPENRRRFAGFFRNGNGLTQTLRFLNLYGVLGR
GLND_RALSO      RGVKGLAANTLRALYNARTQMDARWRRDPANRATFLSILQQPQGITHALRLMNQTSVLGR
GLND_AZOVI      PEIRGVRADTIRLLRDHRYLIDDAFRRDPHNTGLFIELFKSRQGIHRNLRRMNRYGILGR
GLND_PSEAE      PEIKGVRADTIRLLRDSRHLIDDEFRHDIRNTSLFIELFKSSQGIHRNLRRMNRYGILGR
GLND_ECOLI      SAITGIYSTTLRQLRHARRHLQQPLCNIPEARKLFLSILRHPGAVRRGLLPMHRHSVLGA
GLND_ECO57      SAITGIYSTTLRQLRHARRHLQQPLCNIPQARKLFLSILRHPGAVRRGLLPMHRHSVLGA
GLND_SALTI      SAITGIYSTTLRHLRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWA
GLND_SALTY      SAITGIYSTTLRHLRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWA
GLND_KLEOX      SSITGIYSTTVRHLRHARRHLTQPLCYIPEARTLFLSMLRHQGGLSRGLLPMHRHSVLWA
GLND_YERPE      QDIKGIYSTTVRRLRHARRHLKAPLCHIPEARKLFMAILRHPGAVSRALLPMHRHSVLWA
GLND_VIBCH      STIESVAPATMRQLRTARRRLNKFLHTLPAAREKFIELVRHPNALHKAFSQMHKLGVLAA
GLND_ALIF1      STIDGVAPPTMRQLRTARRRLNRFLCEIPEAKEKFLQLTQHPNALNNAFSSMHKLGVLSA
GLND_HAEIN      EHVN-IHSDTLRQLQISLEQLSQKLCEIPAAREKFLRLFNQSNAIKRAFMPMHQYGVLTA
GLND_PASMU      HQLD-IHSSTLRQLHLALEQRSGYLSELPVARERFLRLFNQPGAIARALVPMHKYGVLKA
GLND_MYCTU      G--LPIGAATLSRLAASVPDLPTPWPQ--EALDDLLVVLSAGPTTVATIEALDRTGLWGR
GLND_STRCO      G--LPLSRHAVRRLAATARPLPTPWPA--EAREQLVTLLGSGRPTVQVWEALEAEGLVTR
                     .   :.                       :  .             :.  .:   

GLND_RHILV      FIPEFGKIVAMMQFNMYHHYTVDEHLIRTVDILSEIDKGRAEDLHPLANKLMPGIE-DRE
GLND_RHITR      FIPEFGKIVSMMQFNMYHHYTVDEHLIRAVEVLSEIDKGRAEDIHPLTNKLMPNIE-DRD
GLND_AGRFC      FIPEFGKIVAMMQFNMYHHYTVDEHLIRSVGVLSEVDKGTAVDAHPLANQLMPGVE-ERE
GLND_RHIME      FIPEFGKIVSMMQFNMYHHYTVDEHLLRSVDVLSRIERGLEEEAHPLTAMLMPGIE-DRE
GLND_BRUME      FIPDFGKIVAMMQFNMYHHYTVDEHLLRCIAVLSEIEHGELKTEHPLSNHLITTIKRDRN
GLND_RHILO      LIPDFGKIVAMMQFSMYHHYTVDEHLIRCIGVLAEIERGDGEKVHPLSHSLMPGLKKSRE
GLND_CAUVC      FIPEFGRVVAQMQFNMYHSYTVDEHTLRAVGVIGDIAAGRLVDDHPLAVSIMPLIE-DRE
GLND_NEIMA      YLPAWEKIVGLLQHDLFHIYPVDDHILTVVRNVRRLALDMHSHELPYASALMQSFE-KQD
GLND_NEIMB      YLPAWEKIIGLLQHDLFHIYPVDDHILTVVRNVRRLALDMHSHELPYASALMQSFE-KQD
GLND_RALSO      YLVNFRRIVGQMQHDLFHVYTVDQHILMVVRNVRRFAIVEHAHEFPFCSQLMANFD-KPW
GLND_AZOVI      YLPEFGHIVGQMQHDLFHIYTVDAHTLNLIKNLRKLFWPELAEKYPLASKLIEKLP-KPE
GLND_PSEAE      YLPEFGHIIGQMQHDLFHIYTVDAHTLNLIKHLRKLNRPEMAEKYPLASKIIDRLP-KPE
GLND_ECOLI      YMPQWSHIVGQMQFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVDVWPRLP-STE
GLND_ECO57      YMPQWSHIVGQMQFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVNVWPRLP-STE
GLND_SALTI      YMPQWSHIVGQMQFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLP-HPE
GLND_SALTY      YMPQWSHIVGQMQFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLP-HPE
GLND_KLEOX      YMPQWSHIVGQMQFDLFHAYTVDEHTIRVLLKLESFAKEETRSRHPLWLELWPRLT-HPE
GLND_YERPE      YMPQWGSIVGQMQFDLFHAYTVDEHTIRVLLKIESFADEDTRPRHPLCVELYPRLP-QPE
GLND_VIBCH      YLPQWNQIVGQMQFDLFHVYTVDEHSIRLLKHIHLFSDANNHDRHPICCEIYPKIQ-KKE
GLND_ALIF1      YLPQWSHIVGQMQFDLFHAYTVDEHSIRLLKHINKFSDTTNRDKHPICCEIFPKIM-KKE
GLND_HAEIN      YLPQWQAIEGLMQFDLFHIYTVDEHTLRVMLKLESFLPKGSAQEHPIAHRIFSQLS-DRT
GLND_PASMU      YLPQWHHIEGLMQFDLFHCYTVDEHIVRTLLKLEYFLEAESVVPHPICSQIFSRLT-DRT
GLND_MYCTU      LLPEWEPIRDLPPRDVAHKWTVDRHVVETAVHAAPLAT----R------VA--RPD----
GLND_STRCO      LLPDWERVRCRPQRNAVHLWTVDRHLIETAVRAAGFTR----R------VH--RPD----
                 :  :  :      .  * :.** * :        .                        

GLND_RHILV      ALYVAVLLHDIAKGRQEDHSIAGARVARKLCVRFGLSQKQTEIVVWLIEEHLTMSMVAQT
GLND_RHITR      ALYVAVLLHDIAKGREEDHSEAGAAVARKLCPRFGLSPKQTELVVWLIAEHLTMSMVAQT
GLND_AGRFC      ALYVAVLLHDVAKGRQEDHSIAGARVARKLCQRFRLTGKQTETVVWLIEQHLLMSMVAQT
GLND_RHIME      ALYVAVLLHDIAKGRPEDHSVAGAKVARKLCPRFRLTPKQTEMVVWLVEEHLTMSMVAQT
GLND_BRUME      LLYVTLLLHDIAKGRPEDHSIAGARIARRLCPRFGLTPSETETVEWLVREHLTMSMVAQS
GLND_RHILO      ALYVAVLLHDIAKGRPEDHSEAGARIARRICPHMGLSAADTETVAWLVENHLAMSMTAQT
GLND_CAUVC      ALFLAMLLHDTGKGGVGGQEKAGARSARSACERLGVERSKVELVAWLVENHLVMSDFAQK
GLND_NEIMA      ILYLAAFFHDIAKGRGGDHAIQGIADARQFAADHFLTGEESDLLAWLVENHLLMSAVAQK
GLND_NEIMB      ILYLAAFFHDIAKGRGGDHAIQGIADARQFAADHFLTGEESDLLAWLVENHLLMSAVAQK
GLND_RALSO      VLTVAALFHDIAKGRGGDHSVLGMADARRFCKQHGIASEDADLIVWLVEHHLTMSQVAQK
GLND_AZOVI      LIYLAGLYHDIGKGRGGDHSELGAADALAFCQRHDLPAMDTQLIVWLVRNHLLMSTTAQR
GLND_PSEAE      LIYIAGLYHDIAKGRGGDHSELGAVDAEAFCQSHQLPLWDTQLVSWLVQNHLVMSTTAQR
GLND_ECOLI      LIFIAALFHDIAKGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQR
GLND_ECO57      LIFIAALFHDIAKGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQR
GLND_SALTI      LILIAALFHDIAKGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQR
GLND_SALTY      LILIAALFHDIAKGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQR
GLND_KLEOX      LILIAALFHDIAKGAGGDHSILGAQDVLKFAELHGLNCAQTQLVAWLVRHQLLMSVTAQR
GLND_YERPE      LLLLAALFHDIAKGRGGDHSILGAHDAVEFAEQHGLNSRESQLVAWLVRCHLLMSVTAQR
GLND_VIBCH      LLILAAIFHDIGKGRGGDHSEIGADEAFDFCIEHGLSKPEAKLVAWLVKNHLLMSVTAQR
GLND_ALIF1      LLIIAAIFHDIAKGRGGDHSELGAVDAYDFCISHGLSKPEANLVSWLVKSHLLMSVTAQR
GLND_HAEIN      LLYIAALFHDIAKGRGGDHAELGAEDVADFAQLHGLDRREIDTLAWLVQSHLLMSITAQR
GLND_PASMU      LLYIAALFHDIAKGRGGDHAELGAVDVAQFAQQHGFDQREIHTLTWLVEQHLLMSVTAQR
GLND_MYCTU      LLALGALLHDIGKGRGTDHSVLGAELVIPVCTRLGLSPPDVRTLSKLVRHHLLLPITATR
GLND_STRCO      LLLIAALLHDIGKGWPGDHSVAGETIARDVAARIGFDGADTAVLATLVRHHLLLVETATR
                 : :  : ** .**   .:   *   .   .    .   .   :  *:  :* :   *  

GLND_RHILV      RDLTDRKTITDFADRVQSL-DRLKMLLILTICDIRAVGPGVWNGWKGQLLRTLYYETELL
GLND_RHITR      RDLTDRKTIIDFADRVQSL-DRLKMLLILTVCDIRAVGPGVWNGWKGQLLRTLYYETELL
GLND_AGRFC      RDLHDRKTITDFADKVQSM-ERLKMLLILTVCDIRAVGPGVWNGWKGQLLRSLYYETELL
GLND_RHIME      RDLNDRKTIVDFAERVQSL-ERLKMLLILTVCDIRAVGPGVWNGWKGQLLRTLYYETELL
GLND_BRUME      RDLNDRKTIIDFADTVQTM-ERLKLLLILTVCDIKAVGPGIWNGWKGQLLRTLFYETELV
GLND_RHILO      RDLNDRKTIEDFASIVQSV-ERLKLLLVLTVCDIRGVGPGVWNGWKGQLLRTLYYETELL
GLND_CAUVC      RDVSDPGTVAAFARIVENP-ERLRLLLVITVADIRAVGPGVWNGWKGQLLRELYNATEAV
GLND_NEIMA      EDIQDPDVLDAFCKRVQTH-ERLSALYLLTISDIRGTNPKLWNAWRASLLESLFHAAGRY
GLND_NEIMB      EDIQDPSVLDAFCKRVQTH-ERLSALYLLTISDIRGTNPKLWNAWRASLLESLFHAAGRY
GLND_RALSO      QDLGDPEVIRHFADQVGSE-RYLSALYLLTVADIRGTSPKVWNAWKAKLLEDLYRITLRV
GLND_AZOVI      KDLSDPQVIFDFAQKVRDQ-TYLDYLYVLTVADINATNPTLWNSWRASLLRQLYTETKHA
GLND_PSEAE      KDLSDPQVIFDFAQLVGDQ-THLDYLYVLTVADINATNPTLWNSWRASLLRQLYTETKRA
GLND_ECOLI      RDIQDPEVIKQFAEEVQTE-NRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQ
GLND_ECO57      RDIQDPEVIKQFAEEVQTE-NRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQ
GLND_SALTI      RDIQDPEVIKQFAEEVQTE-TRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQ
GLND_SALTY      RDIQDPEVIKQFAEEVQTE-TRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQ
GLND_KLEOX      RDIQDPEVIKQFAEEVQTE-NRLHYLVCLTVADICATNENLWNSWKQSLLRELYFATEKQ
GLND_YERPE      RDIQDPAVIQQFSAEVQSE-TRLRYLVSLTVADICATNENLWNSWKQSLLRELYFATEKQ
GLND_VIBCH      RDIYDPDVIIEFAKKVRDE-ERLEYLVCLTVADICATNPELWNSWKRTLLAELFYSTQRA
GLND_ALIF1      RDIYDPDVITEFAKQVRDE-ERLDYLVCLTVADICATNPDLWNSWKRSLIADLYNATQRA
GLND_HAEIN      RDIHDPEVVMNFAEAMQNQ-VRLDYLTCLTVADICATNGNLWNSWKRSLFASLYEFTEQQ
GLND_PASMU      RDIHDPEVVLHFAEAVQNN-VRLDYLTCLTVADICATNETLWNSWKRTLIATLYQFTTQQ
GLND_MYCTU      RDLNDPKTIEAVSEALGGDPQLLEVLHALSEADSKATGPGVWSDWKASLVDDLVRRCRMV
GLND_STRCO      RDLDDPATVRAVAQAVGTE-HTLELLHALTEADALATGPAAWSSWRGSLVADLVKRVSGV
                .*: *  .:  ..  :      *  *  :: .*  ...   *. *:  *.  *       

GLND_RHILV      LAGG--FSEVSRKERANAAAEALHSALADWS---QKDRNTYTKLHYQPYLLSVPLEDQIR
GLND_RHITR      LSGG--FSEVSRKERAEAAAEALEHALADWS---QKERKAYVKLHYQPYLLSVPLEDQIR
GLND_AGRFC      LSGG--FSEVSRKERAQIARQALYDALEDWG---QKARRKYTKLHYEPYLLTVALEDQVR
GLND_RHIME      LSGG--FSELSRKERAKHAAHMLEEALADWP---KKERQAYVRLHYQPYLLTVALEEQVR
GLND_BRUME      LTGG--FSELSRAARDKQAREALAERLSDWP---KEERDAYLALPYTNYFLTVSLDDQVR
GLND_RHILO      LTGG--FSEVSRAQRTAAARERLAEALADWP---DKDRKRYVGLHYENYLLTVDLPDQLR
GLND_CAUVC      FRGGRGSDAAANVQRHQESTAEAARAALLET---DPAAKGWVAAMENAYFSAFSQDDLFH
GLND_NEIMA      LTGNGGNPHTLFGRRRQEAADLLTRAAVP-----EKQQKKLWNALGSAYFARHQSREILW
GLND_NEIMB      LTGNGGNPHTLFGRRRQEAADLLTRAAVP-----EKQQKKLWNALGSAYFARHQSREILW
GLND_RALSO      LGGATTDPHAVLEGRKEEARVLLRLAAMD-----PHAHEALWAQLDVGVFLRHDARDIAW
GLND_AZOVI      LRRGLEQPVGREEQIRQTQKAALDILVRS--GTDPDDAEHLWTQLGDDYFLRHTSSDIAW
GLND_PSEAE      LRRGLENPVDREEQIRQTQTAALDQLVRN--GIDQDDAEQLWSQLGDDYFLRHTAGDVAW
GLND_ECOLI      LRRGMQNTPDMRERVRHHQLQALALLRMD--NIDEEALHQIWSRCRANYFVRHSPNQLAW
GLND_ECO57      LRRGMQNTPDMRERVRHHQLQALALLRMD--NIDEEVLHQIWSRCRANYFVRHSPNQLAW
GLND_SALTI      LRRGMQNTPDMRERVRHHQLQALALLRMD--NIDEAALHKIWTRCRANYFVRHSPNQLAW
GLND_SALTY      LRRGMQNTPDMRERVRHHQLQALALLRMD--NIDEAALHKIWTRCRANYFVRHSPNQLAW
GLND_KLEOX      LRRGMQNTPDMRERVRHHQLQALALLRME--NINEQALHQIWNRCRANYFVRHTPNQLAW
GLND_YERPE      LRRGMQNSPDLRERVRHHRLQALALLRMD--NIDEEALHRIWSRCRADYFLRHSPNQLAW
GLND_VIBCH      LRRGLENPVDVRERIRHNQQMASALLRKE--GFSSREIEVLWQRFKADYFLRHTHKQIAW
GLND_ALIF1      LRRGLENPPDLRDRIRHNQQMASAQLRSE--GFTQWEVDALWRRFKADYFLRHTHKQIAW
GLND_HAEIN      FSQGMKELLDYSEKSAENRKLAQQILTQDYSDITSISIEKLWTRCPEDYFVRNTPKQIAW
GLND_PASMU      FAQGMDCLLDHAEKIENHRQQALTLLTQN-SLLSAVQIEEIWQHCPEEYFLRNTPKQIAW
GLND_MYCTU      MAGESLPQAEPTAPHY------------------------LSLAADHGVHVEISPR----
GLND_STRCO      LAGEPQPEAESAAPTAEQERLAVEAFRTG--------GPVLALRAQTEPPADSAPAPSSP
                :                                                           

GLND_RHILV      HAHFIRQADKAGQALATMVRTDSF--HAITEITVLSPDHPRLLAVIAGACAAAGANIVDA
GLND_RHITR      HTQFMRESDKAGKVLATMVRTDSF--HAITEITVLSPDHPRLLTVIAGACAAAGANIADA
GLND_AGRFC      HTRFMREADKQEKALSTMVRTHSF--HAITEITVLAPDHPRLLSIITGACAAAGANIADA
GLND_RHIME      HAGFIREADRAGRTLATMVRTHDF--HAITEITVLSPDHPRLLTVIAGACAAAGANIVGA
GLND_BRUME      HAHFIRDADQQGRALVTMAKPHAF--EAVTEITVLAPDHPRLLSVITGACAAAGGNIVDA
GLND_RHILO      HAEFVREADAAGKKLATMVKTHQF--EAVTEITVLAQDHPRLLSVIAGACVGAGGNIVDA
GLND_CAUVC      HAELARRAAIQG-GAAAEGQVRPG--SNAAEVVIAAKDRRGLFADLALAISSLGGNVVGA
GLND_NEIMA      HAANLVHDFET--PIVRSRILFKS---DSFQVMVFMPNGPRLFARLCRIFSRHGFDILAA
GLND_NEIMB      HAANLVHDFET--PIVRSRILPKS---DSFQVMVFMPNGPRLFARLCRIFSRHGFDILAA
GLND_RALSO      FTRHFYNRVDTTLPIVRARISPVG---EGLQVAVYSPDRPDLFARICGYFERKGLTILDA
GLND_AZOVI      HTEAILQHPSSGGPLVLIKETTQREFEGATQIFIYAPDQHDFFAVTVAAMDQLNLSIHDA
GLND_PSEAE      HTEAILQHPDDGTPLVLIKETTQREFESGSQIFIYAADQHDFFAVTVAAMDQLNLSIQDA
GLND_ECOLI      HARHLLQH-DLSKPLVLLSPQATR---GGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDA
GLND_ECO57      HARHLLQH-DLSKPLVLLSPQATR---GGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDA
GLND_SALTI      HARHLLQH-DLSQPLVLLSPQATR---GGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDA
GLND_SALTY      HARHLLQH-DLRQPLVLLSPQATR---GGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDA
GLND_KLEOX      HARNLLKH-DLSKPMILLSSHATR---GGTEIFIWSPDRPYLFAAVSAELDRRNLSVHDA
GLND_YERPE      HARHLLEH-DSTKPLVLVSRQATR---GGTEIFIWSPDRPSLFAAVVGELDRRNLSVHDA
GLND_VIBCH      HCTHLLRHEDSSKPLVLLSKKATR---GGTEVFIYTKDQAALFATVVAELDRRNLNVHDA
GLND_ALIF1      HASHLLRHQDKEKSLILISKNASR---GGTEIFVYSKDQPHLFATVAAELDRRSITIYDA
GLND_HAEIN      HTSLLVDF--VEALLVKISNRFSL---GGTEVFIYCQDQPHLFNKVVSTIGAKKFSIHDA
GLND_PASMU      HTELLADN--QTELLVKISNRFSE---GGTEIFVYCQDQPNLFHKVVTTIGAKKFSIHDA
GLND_MYCTU      ------------------DGER-------IDAVIVAPDERGLVSKAAAVLALNSLRVHSA
GLND_STRCO      SSPSFPSPLSSPSSPSSADGPEPL---G-VELLIAVPDQAGVLPAVAGVLAMHRLTVRTA
                                              :  :   :   ..             :  *

GLND_RHILV      QIFT------TSDGRALDTIHVSREFT---DDADELRRAATIGRMIEDVLSGRKRLPEVI
GLND_RHITR      QIFT------TSDGRALDTIHVSREFP---DDADELRRAATIGKMIEDVLAGRKRLPEVI
GLND_AGRFC      QIFT------TSDGRALDTILINREFP---IDEDETRRGANVGKLIEEVLSGKQRLPEMI
GLND_RHIME      QIHT------TSDGRALDTILVNREFS---VAEDETRRAASIGKLIEDVLSGRKRLPEVI
GLND_BRUME      QIFT------TSDGRALDTILISREFD---TDDDERRRAERVGKVIEDVLSGKAHLPDML
GLND_RHILO      QIFT------TADGRALDTILISREFD---RDEDERRRAERVGRLIEDVLSGKSWLPEMI
GLND_CAUVC      RVFT------SRQGQALDVFYVQDVTG---APFGCENPRALRRLADALEAAGKGDALAVE
GLND_NEIMA      RAFI------TEHDYILDTFIVQIPSQ--HAPEDYPDIQSALEAELNSFIHGHTVAETQS
GLND_NEIMB      RAFI------TEHDYILDTFIVQIPSQ--HAPEDYPDIQSALEAELNSFIHGHTVAETQS
GLND_RALSO      KIHT------TKHGYALDTFQVADPGSGLVEPGHYRDIITLVEHELAELIARETVLAEPP
GLND_AZOVI      RVIT------STSQFTLDTYIVLDADG--GSIGNNPARIQEIRQGLVEALRNPADYP-TI
GLND_PSEAE      RIIT------STSQFTLDTYIVLDADG--DSIGNNPERIAEIREGLIDALKNPDDYP-TI
GLND_ECOLI      QIFT------TRDGMAMDTFIVLEPDG--NPLSAD--RHEVIRFGLEQVLTQSSWQ--PP
GLND_ECO57      QIFT------TRDGMAMDTFIVLEPDG--SPLSAD--RHEVIRFGLEQVLTQSSWQ--PP
GLND_SALTI      QIFT------TRDGMAMDTFIVLEPDG--SPLAAD--RHDVIRTGLEQTITQHSWQ--PP
GLND_SALTY      QIFT------TRDGMAMDTFIVLEPDG--SPLAAD--RHDVIRTGLEQTITQRSWQ--PP
GLND_KLEOX      QIFT------TRDGMAMDTFIVLEPDG--SPLSAD--RTQMIRVGLEQTLSQRSWQ--PP
GLND_YERPE      QIFT------NRDGMAMDTFIVLEPDG--SPLAQD--RHPIISHALQQAINRSDYQH-PP
GLND_VIBCH      QIMA------SKDGYVLDTFMVLDQNG--QAIEED--RHQALIRHLVHVLEDGRPT--TQ
GLND_ALIF1      QVMS------SKDGYALDTFMVLDQND--DPIDEE--RQQRLIDQLYDVKLNDQAT--HI
GLND_HAEIN      QIIT------TQDGYVFDSFIITELNG--ELVEFD--RRRELEQALTVALQSEKLP---A
GLND_PASMU      QIIT------SHDGYVFDSFIITELDG--KLVKFD--RRRSLEKALMQALNTSKLP---T
GLND_MYCTU      SV-------NVHQGVAITEFVVSPLFG------SPP-AAELVRQQFVGALNGDVDVLGML
GLND_STRCO      ELRSVPLPDGVEGSVLLLDWRVAAQYG------SLP-QAARLRADLVRALDGTLDIAARL
                                :    :                                      

GLND_RHILV      ATRAR--------NRKKSKA------FVIPPSVNITNSL-SNKFTVIEVECLDRPGLLSE
GLND_RHITR      ATRTK--------NRRKNKA------FVIPPSVIITNSL-SNKFTVIEVECLDRPGLLSE
GLND_AGRFC      ATRTK--------SRRKKSA------FTIPPSVTISNGL-SNKFTVIEVECLDRPGLLAD
GLND_RHIME      ASRTR--------VKKRSRA------FTVTPEVTISNTL-SNKFTVIEVEGLDRTGLLSE
GLND_BRUME      AKRTK--------PKKAARA------FKVEPRVEINNTL-SNKFTVIEVEGLDRPGLLSE
GLND_RHILO      EKRTK--------PKRGAKV------FKIPPRAEIRNTL-SNRFSVIEVEGLDRPGLLSE
GLND_CAUVC      PRRGS--------EQTRAAA------FAIAPSVTIDNDA-SNDATVVEASGRDRPGLLHA
GLND_NEIMA      HSRR---------ISRRSRY------MPIAPSITITPEEDYPDWYSVEITAVNRPFLLAD
GLND_NEIMB      RSRR---------ISRRSRY------MPIAPSITITPEEDYPDWYSVEITAVNRPFLLAD
GLND_RALSO      RGR----------ISRQSRS------FPIKPRVDLRPDE-RGQYYLLSLSATDRTGLLYA
GLND_AZOVI      IQRR---------VPRQLKH------FAFAPQVTIQNDA-LRPVTILEIIAPDRPGLLAR
GLND_PSEAE      IQRR---------VPRQLKH------FAFAPQVTISTDA-LRQVSVLEVIAPDRPGLLAR
GLND_ECOLI      QPRR---------QPAKLRH------FTVETEVTFLPTH-TDRKSFLELIALDQPGLLAR
GLND_ECO57      QPRR---------QPAKLRH------FTVETEVTFLPTH-TDRKSFLELIALDQPGLLAR
GLND_SALTI      QPRR---------QPAKLRH------FTVETEVNFLPTH-TDRKSFMELIALDQPGLLAR
GLND_SALTY      QPRR---------QPAKLRH------FTVETEVNFLPTH-TDRKSFMELIALDQPGLLAR
GLND_KLEOX      APRR---------QAAKLRH------FSVPTEVNFLPTH-TDRKSFLELIALDQPGLLAR
GLND_YERPE      RVRR---------LSPKLRH------FSVPTEANFLPTH-NERRTYLELIALDQPGLLAR
GLND_VIBCH      KARR---------IPRNLQH------FKVKTQVDFLPTK-SKKRTLMEFVALDTPGLLAT
GLND_ALIF1      KTRR---------PPRQLQH------FNVKTRMEFLPTK-TGKRTLMEFVALDTPGLLAT
GLND_HAEIN      LSIV---------PNRQLQH------FTVQTDVRFLQEN-KKEHTEMELVALDKAGLLAQ
GLND_PASMU      FRAT---------DNPKLQH------FHVKTEVRFLKEQ-RTDQTEMELFALDQTGLLAK
GLND_MYCTU      QKRDSDAASLVSARAGDVQAGVPVTRTAAPPRILWLDTA-APAKLILEVRAMDRAGLLAL
GLND_STRCO      AERD--A--AHP-RRRGVEP--------PPPRVTVAPAA-SRLATVIEVRAQDAPGLLFR
                                              .               :.    : . **  

GLND_RHILV      ITAVLSDLSLDIQSARITTFGEKVIDTFYVTDLVGQKISGDSKRANITARMKAVMAEEED
GLND_RHITR      ITAVLSDLSLDIQSARITTFGEKVIDTFYVADLVGQKISNENRRAYITARLKAVMAGEED
GLND_AGRFC      MTAVIADLSLDIHSARITTFGEKVIDTFYVTDLFGQKVTNDNRQASIAQRLKAVMSEQED
GLND_RHIME      VTAVLSDLSLDIASAHITTFGEKVIDTFYVTDLVGSKITSENRQMNIAARLKAVLAGEVD
GLND_BRUME      LTGLISDLSLDIASAHITTFGEKVIDSFYVTDLVGHKISNATRQGNIKRKLLALLGAENG
GLND_RHILO      ITGTLSDLSLDIASAHITTFGEKVIDTFYVTDLTGQKIDSPARIATIRNRLMATLEGIAP
GLND_CAUVC      LAKTLADSALSIQSAHIDGYGERAVDAFYVQTTEGGKVTDTRKLNALKADLLAALEQNEA
GLND_NEIMA      MAEVFFAHNVSLRYAKISTLDERAEDSFTVFSLDLK-NPK--IQSSLKQTLLEQLS----
GLND_NEIMB      MAEVFFAHNVSLRYAKISTLDERAEDSFTVFSPDLK-NPK--IQSSLKQTLLEQLS----
GLND_RALSO      IARVLARHRVSVHTARINTLGERVEDVFLLDGRRLTQDNK--LQLALESELLEALAI---
GLND_AZOVI      IGKIFLDFDLSLQNAKIATLGERVEDVFFVTDAHNQPLSDPELCARLQLAIAEQLADGDS
GLND_PSEAE      IGGIFLDFDLSVQNAKIATLGERVEDVFYITDARNQPLADPDLCKRLQAALVEQLSQDNG
GLND_ECOLI      VGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNN-ELQQEVHQRLTEALNPNDK
GLND_ECO57      VGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNN-ELQQEVHQRLTEALNPNDK
GLND_SALTI      VGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNN-VLQLEVQQRLTAALNPNDK
GLND_SALTY      VGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNN-VLQLEVQQRLTAALNPNDK
GLND_KLEOX      VGQVFADLGISLHGARITTIGERVEDLFIIATADRRALNN-ELQQEVQQRLTEALNPNDK
GLND_YERPE      VGKIFADLGLSLHSARITTIGERVEDLFVLADKDRRALSL-ETRRELAQRLADTLNPNDK
GLND_VIBCH      VGATFAELNLDLHAAKITTIGERAEDLFILTNAQGTRLNE-EEEQHLREKLIEHVAELAP
GLND_ALIF1      VGATFAQLGINLHAAKITTIGERAEDLFILTSDVGGRLDD-EKQAELELALVKNVARLSS
GLND_HAEIN      VSQIFTELNLNLLNAKITTVGEKAEDFFILTNQFGQALAR-EERERLNSVIIQQIR----
GLND_PASMU      VSQVFSELKLNLLNAKITTIGEKAEDFFILTNSEDRALTA-EQRQCLTQRLHEVLEPK--
GLND_MYCTU      LAGALEGAGAGIVWAKVNTFGSTAADVFCVTVPAELDARA-AVEQHLLEVLGASVDVVVD
GLND_STRCO      LGRALEAAGVRVRSAHVSTLGANAVDAFYVTRGEGTPLPG-DEAASVARGLEESLRT---
                :   :      :  *::   .  . * * :                :   :   :     

GLND_RHILV      ELRERMPSGIIAPAATARTPPAS---EKKAGSPI
GLND_RHITR      EMRERMPSGIIAPAATRGVAVEKSDTEKKAGSAA
GLND_AGRFC      ELRDRMPNGIIAHPDVAALPAAR---TAKA----
GLND_RHIME      EARERMPSGIIAPTPVSRVPHGS--KTTKAET--
GLND_BRUME      ARTNGRSPQAAA----------------------
GLND_RHILO      ERG-GKAKAAAE----------------------
GLND_CAUVC      SAPAARPGLRRARASVAR----------------
GLND_NEIMA      ----------------------------------
GLND_NEIMB      ----------------------------------
GLND_RALSO      ----------------------------------
GLND_AZOVI      -YIQPSRISI------------------------
GLND_PSEAE      RDTLPTRINF------------------------
GLND_ECOLI      G---------------------------------
GLND_ECO57      G---------------------------------
GLND_SALTI      G---------------------------------
GLND_SALTY      G---------------------------------
GLND_KLEOX      G---------------------------------
GLND_YERPE      L---------------------------------
GLND_VIBCH      SAQ-------------------------------
GLND_ALIF1      ----------------------------------
GLND_HAEIN      ----------------------------------
GLND_PASMU      ----------------------------------
GLND_MYCTU      EPVGD-----------------------------
GLND_STRCO      ----------------------------------