CLUSTAL format seed alignment for MF_00278

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HIS5_AQUAE       ---------MRTVVIDYGMGNLRSVSKALEAVGFP---------EVVVSNDYRVASE--A
HIS5_CALS4       ----------MIGIIDYGMGNLRSVEKALKYVGY----------DAKITSDAKEIKN--F
HIS5_RHOBA       ----------MITIVDYQMGNLRSVQKAVERSGV----------EAEITSDASQIAA--A
HIS5_CHLTE       ----------MVFIADYGAGNLRSVHKAFDYLGI----------EAVVSDKASEMSR--Y
HIS5_GEOSL       --------MTKIAIIDYGMGNLRSVQKGFEKVGF----------EAVVTADPKVVLE--A
HIS5_BACSU       ----------MIGVIDYGMGNLYSVSKALERVGV----------PYFVSEKPEELKE--A
HIS5_OCEIH       ----------MIAIIDYGAGNIKSLQFALDKLNK----------HSIVTTEAAEIKQ--A
HIS5_LACPL       ----------MFAIVDYDTGNTRNLKKAFDYLQV----------STILTADPQQLAA--A
HIS5_STRMU       ----------MIIVIDYDAGNTANVLRALDKLGV----------KAELSADPQKIVA--A
HIS5_LACLA       --------MKKIVIIDYNIGNLQSVQAAFLRLGQ----------ETVISRDLEEIRK--A
HIS5_METJA       ----------MIGIIDYNAGNLRSIQKAVELYD-----------KVIITNNSEELLA--C
HIS5_PYRFU       --------MDRIAIVDLGIGNLANVKKALKGY---------------ITSDPYEIEK--A
HIS5_METMA       --------MKRIVIIDYGLGNLRSVQKGLEHAGAS---------PAIS-GNPEEILA--A
HIS52_VIBVY      ---------MKIVIIDYDMGNVRSIENAINHIGDY---------TIIVSGEPDTIRS--A
HIS5_HELHP       ------MSKLRVGIINYGVGNLGSVQNAFAFIQTHFSDVLPHTLEIKVESHPERLQD--Y
HIS5_WOLSU       ----------MVGIVNYNIGNLASVLNALVKVGA----------KAQIEKEPSRLLE--Y
HIS51_CAMJE      ----------MIALIDYKAGNLNSVAKAFEKIGA----------INFIAKNPKDLQK--A
HIS5_ARCFU       ----------MIAIVNYGVGNLKSISKALETVGA----------KVSVTSDPEKIKC--A
HIS5_METKA       ---------MKVAIVEYGVGNLNSVYRAVKHLGH----------EPVVTDDPSELHD--A
HIS5_BACTN       ---------MKVAVVKYNAGNIRSVDYALKRLGVE---------AVITADK-EILQS--A
HIS5_XYLFT       --------MTEVALIDAGGANLGSVRYALQRLGVE---------PRLVCDA-RGLEG--A
HIS5_BUCBP       ---------MSIVIINTGCANLSSLKYAIQRLGYN---------VIITSNH-KNILN--A
HIS5_BLOFL       ---------MKIIIINTNCSNLSSVKIMLNKLGCN---------TIITDDP-DLIIQ--S
HIS52_CAMJE      ---------MKIIIIDTACANLASLKFCLDRLGFN---------ATISRDL-KELES--A
HIS5_ECOLI       ---------MNVVILDTGCANLNSVKSAIARHGYE---------PKVSRDP-DVVLL--A
HIS5_PASMU       --------MQNITIINTRCANLSSVKFAFDRLGYH---------TEITDNI-EKIQS--A
HIS5_SHEON       --MSANTDEFDVVIIDTGCANLSSVRFAFERLGAN---------VLVTDDK-ASIKA--A
HIS5_GLOVI       MARTPN-----IALVDYGVGNLHSARKGLEAMGAR---------VTLSGQP-LTLS--AA
HIS5_CYAPA       MINSKNNSPIEISIIDYQMGNLYSVCKGIERSGGI---------PKIINSA-EEIK--KA
HIS5_PROMP       --------MAKIGLIDYGMGNIHSVTKALESLEEE---------IILIKNN-HQIK--DC
HIS52_SYNPX      -------MGLHLGLIDYGMGNLHSVEKAFNRLGHQ---------PSRVVNP-SDLD--GC
HIS5_CYACA       --------MKNIGIINCGMGNLHSVSNAISNIGFN---------PVIINAS-KDLVSFAC
HIS5_PYRAE       ---------MIVGVVDYTVGNIGSVLTALKRAGAV---------PVVVKGV-EEAG--RV
HIS5_CYAM1       ---------MKVGLVDYSMGNMHSVSRAIQQANQQ---------VCVVRSE-SELA--QV
HIS5_STAES       ----------MIAIIDYGLGNISNVTRAIQHLGYD---------VILTCND-KDVQ--KA
HIS5_LEPIN       ----------MIAILDYGMGNIHSCLKAVSLYTKD---------FVFTKDH-STIEN--S
HIS53_VIBVY      ----------MITIVDYGLGNIKAFANLYKKLNIE---------LVFASDV-NDLAN--A
HIS51_PROMM      -------MTACVLIVDAGLGNIGSVVAAYDRLGVR---------NFRIRKPPSDIAC--Y
HIS51_SYNPX      --------MSKIAIVDYGMCNLWSIKSAIQFIGYD---------SILTSDP-KDILN--S
HIS5_SULTO       ---------MKATLINYGVGNLFSIKAGLERVG------------FNVKISFLPEGD--E
HIS5_SULSO       ---------MKALVINYGVGNLYSISSALKRVG------------FEVTIDNKPRND--Y
HIS5_NITEU       --------MNSIAVVDYGMGNLRSVSKALEYVD--------SSAVVTVTSDPETIRS--A
HIS5_RALSO       --------MTTIAIVDYGMGNLRSVAQALSTVA--------PDADVRISAQADEIRA--A
HIS5_PSESM       --------MQTVAVIDYGMGNLHSVAKALEHVG---------AGRVLITSDAKVIRE--A
HIS5_CHRVO       ---------MKVAVIDYGMGNLHSVLKSLQAVNE-------NGADIFLTRDPEAVVK--A
HIS5_RHOPA       ---------MSVAIVDYGSGNLHSAAKAFERAARSME----NPEPILVTRDPDQVFR--A
HIS5_DEIRA       MSTTPVRAAPEVLLLDYGAGNVRSAARALERAGMT--------VRVTD----NAADVPHA
HIS5_THET2       ---------MKALLIDYGSGNLRSAAKALEAAGFS--------VAVAQ----DPKAHEEA
HIS5_MYCPA       ------MTSKSVVVLDYGSGNLRSAQRALERVGAS--------VQVTA----DADAAAAA
HIS5_MYCLE       ------MRSKSVVVLDYGSGNLWSVQRALQRVGAA--------VEVTA----DSAAGAAA
HIS5_BIFLO       --------MTTAVVFDYGFGNVRSMVRALANLGVD--------TTLTS----DYRQSLEA
HIS5_THEMA       ---------MRIGIISVGPGNIMNLYRGVKRASEN--------FEDVSIELVESPRNDLY
                              : .    *                                       

HIS5_AQUAE       DVLVLPGVGAFGDAMKNLEELN-LVSVIRRHIEKGK-PFLGICLGLQLLFEKSYEHGE--
HIS5_CALS4       EALILPGVGAFPDAIRVLIKTG-MAEEIKIHIEKGK-PFLGICLGMQLLFEKSFEGGK--
HIS5_RHOBA       ERLILPGVGAFGDAIGEIRRRD-LEKPIKDFIASGK-PFLGICLGLQMLFEQGFEGGT--
HIS5_CHLTE       DKVLIPGVGAFGPAMEALNRQG-FDEAIREHIDKGR-SVLGICLGMQLFLSESEEMGA--
HIS5_GEOSL       EKIVLPGVGAFRDCMRNLEQGG-FVEPILRVIREGR-PFLGICVGMQLLLTDSVEFGL--
HIS5_BACSU       DAFILPGVGSFGDAMDNLGYTK-LDQLIHDMVSEGR-LLLGICLGMQLLFEESEENGT--
HIS5_OCEIH       DSIILPGVGAFKDAMEAIRQLQ-LDSVIQEEAQKGK-PILGICLGMQLFYEQSLENGD--
HIS5_LACPL       DAVILPGVGAFAAAMAALKERQ-LVGVLQALARSGK-PVLGICLGMQLLFESSSEYGE--
HIS5_STRMU       SGLILPGVGAFPAAMAELEKRG-LVAVIKEAVAKGI-PLLGICLGMQLLVEKGLEHCE--
HIS5_LACLA       DALILPGVGAFPTAMNNLKKFN-LIELIQERAAAGI-PILGICLGMQVLFEKGYEIEE--
HIS5_METJA       DKIILPGVGNFGSAMENLAP---LKETIYKIVDDRV-PFLGICLGMQILFEESEEKRG--
HIS5_PYRFU       DKIVLPGVGNFGAVVDKLAP---IKDIIIEGINEGK-PFLGICLGMQLLFEESEESPG--
HIS5_METMA       DGIILPGVGAFIDAMKCLVP---LKKTIAEFAESGK-PMLGICLGQQVLMSSSEEGRL--
HIS52_VIBVY      DCLILPGVGAFPDAMKKLEQQKLIDLLTEEVVVRRK-PVLGICLGMQLLFESSEEIQL--
HIS5_HELHP       DKLLLPGVGAFGNAMTHLKNTH-LDEAIREFVQSGK-FLIGICLGMQLLFEQSEEFGN--
HIS5_WOLSU       DRLILPGVGAFGDAMEHLVQSG-MKEAVLEFAKSGK-PLLGICLGMQLLFEKSYEFGE--
HIS51_CAMJE      DKLLLPGVGSFKEAMKNLKELG-FIEALKEQVLVQKKPILGICLGMQLFLERGYEGGV--
HIS5_ARCFU       SGVVFPGVGAFKSAIEKLNL---IRDVIDSL----EVPILGICLGMQLFATESTEGGV--
HIS5_METKA       DAVILPGVGNFRAAAEKLEETG-LCDEIRELL--GSVPLLGICLGMQLLMESSEESPE--
HIS5_BACTN       DKVIFPGVGEAGTTMNHLKATG-LDELI-KNLR---QPVFGICLGMQLMCRHSEEGE---
HIS5_XYLFT       ARVILPGVGSAPEAMARLNNQG-LIEPL-LRLQ---VPLIGICLGMQLLFEHSEEGD---
HIS5_BUCBP       KKVFLPGVGTAFSAMKMLNQFK-LKDVL-YKYQ---QPVLGICLGMQLLCSFSSENNG--
HIS5_BLOFL       DKILLPGVGTANTAMKQLKKKN-LIQLI-KKCT---QPTLGICLGMQLFGSFSNENTH--
HIS52_CAMJE      DKLFLPGVGTAKEAMKNLEQFN-LIDFI-QNTK---KPLLGICLGMQILGNFSEELN---
HIS5_ECOLI       DKLFLPGVGTAQAAMDQVRERE-LFDLI-KACT---QPVLGICLGMQLLGRRSEESNG--
HIS5_PASMU       DKLILPGVGTAKAAMQNLADLG-LIEVI-QSLT---QPVLGICLGMQLMTDYSEEGN---
HIS5_SHEON       KRVVLPGVGSAGAAMASLTEKA-LVELI-QGLT---QPVLGVCLGMQMLTLLSKERGGQA
HIS5_GLOVI       DGVVLPGVGSFDTAITRLNDRG-LGDAI-IQLVRAGQPMLGICLGLQVLFDSSEEGRL--
HIS5_CYAPA       TALILPGVGSFDPAMKQLKKQD-LINPI-KDAISEKKPFLGICLGLHLLFEESEEGIE--
HIS5_PROMP       KALILPGVGSFDPAINNLSKTE-LIIDI-KNWIKSGKSFLGICLGLQLLFESSDEGTI--
HIS52_SYNPX      DALVLPGVGSFDPAIDNLQSTG-LIPDL-KRWNEADRPLLGICLGLQLLFESSAEGRL--
HIS5_CYACA       SALVLPGVGSFDLAIDRLEKKN-LIEPV-KLWIQEDRPFVGICLGLQLLFEGSDEGSK--
HIS5_PYRAE       DAVVLPGVGTYEAAYALARQ---------FKEVVLEKPTLAICLGMQLLFESSEEGGG--
HIS5_CYAM1       HILVVPGVGHFDLAMKKLEQKG-LRTGI-AKWIAKGNPYIGICLGMHILFETSEEGKE--
HIS5_STAES       EAIVLPGVGHFQDAMHSIEEKS-IKDML-KNIH--DKPVIGICLGMQLLFQHSAEGDV--
HIS5_LEPIN       KALILPGDGHFDKAMENLNSTG-LRKTIDKHVTSGK-PLFGICIGFQILFESSEEIAQGS
HIS53_VIBVY      TKIILPGVGAFDHAMQMLNDSG-MRETLDELVLEKKVPVIGICVGMQMMADSSE------
HIS51_PROMM      THLILPGVGSFSAGMDSLNSLG-WSDWLKDVWLPTGRPLLGICLGMQLLASRGFEGSDS-
HIS51_SYNPX      SAIILPGVGSFKTGMDNLLSLG-LSQAIIDACMFRSIPILGICLGFQLLCCSSEEPS---
HIS5_SULTO       DVIVLPGVGAFSAVSSYLNS---MKDKFNELRERG-VKFLGVCLGMQVMFDEGTEGGL--
HIS5_SULSO       DLIVFPGVGAFSAVAEFILR---YRELFNDLRRSG-TNFLGVCLGMQIMFEKGTEGKE--
HIS5_NITEU       ARVVVPGQGAMPHCMQALDD-QGLRESVIEAAKNK--PFLGICLGLQMLFEESEEGN---
HIS5_RALSO       DRVVLPGQGAMPDCMAAFDQ-SGLREAVLEAARTK--PMLGVCVGEQMLLERSAEARAGE
HIS5_PSESM       DRVVFPGVGAIRDCMAEIRR-LGFDSLVREVSQDR--PFLGICVGMQALLDRSEESGG--
HIS5_CHRVO       DKVVFPGQGAMPDCMRELNR-HGLAEAVRETTQSK--PFFGICVGAQLLFEHSEE-GD--
HIS5_RHOPA       DRVVLPGVGAFADCRKGLDSIDGMVQALNETVRDKARPFFGICVGMQLMATRGKEHVT--
HIS5_DEIRA       PALVVPGQGHFRQVMEAFEHGG-FHGPVLDAARAGV-PLLGICVGMQLLFD-GSEEAPG-
HIS5_THET2       DLLVLPGQGHFGQVMRAFQESG-FVERVRRHLERGL-PFLGICVGMQVLYE-GSEEAPG-
HIS5_MYCPA       DGLVVPGVGAYEACMTGLRKIG-GDRIIAERVAAGR-PVLGVCVGMQILFARGVEFSVE-
HIS5_MYCLE       DGLLVPGVGAFEACMAGLRKIA-GERTIAERIVAGR-PVLGVCVGMQILFARGVEFGVE-
HIS5_BIFLO       DGLVVPGVGAFAACMEGLKKVD-GDRVIYDRIRAGR-PVLGVCVGEQIMFEHGLEHGAH-
HIS5_THEMA       DLLFIPGVGHFGEGMRRLREND-LIDFVRKHVEDER-YVVGVCLGMQLLFE-ESEEAPG-
                   ...** *                              ..:*:* : :           

HIS5_AQUAE       -------HRGLGILKGEVIL--LPLGV-------KIPHIGWNQLWFK------KESEILE
HIS5_CALS4       -------TEGLKIFKGNVVG--LPKGN-------KIPHVGWNSLTIK------KDTPFLK
HIS5_RHOBA       -------HEGLGVLGGDVVAFELPAEF-------KVPHMGWNAVDVK------DAGADL-
HIS5_CHLTE       -------YKGLDIVPGKVLRFTSSTD--------KIPQIGWNSVDYC------KDSVLFR
HIS5_GEOSL       -------YQGLNVIPGHVLRFPEGMREGGE--ELKVPHMGWNQLSIK------RRPPAFA
HIS5_BACSU       -------ASGLGLLKGKAVRLKAEDEKGN---KLKVPHMGWNRLSFH------NESPLL-
HIS5_OCEIH       -------WEGLGLLKGSIKRISGE---------VKVPHMGWNTLDIQ------QASPLFD
HIS5_LACPL       -------HAGLGLLSGRVSALPTDL-------NVKVPQMGWNQNELR------RPDSPFA
HIS5_STRMU       -------TAGFGFISGICQEISAKA-------GFPVPHMGWNDLQVK------QKSALTA
HIS5_LACLA       -------RQGLGLLKGEV--IPIKT-------NEKIPHMGWNQLNLA------KASPTTH
HIS5_METJA       -------IKGLGIIKGNVIKF--K-----D--VEKLPHMGWNSVKIV------KDCPLFE
HIS5_PYRFU       -------KEGLGIFKGKVVKL--K-----N--V-RTPHIGWNQVWIK------KECKLFE
HIS5_METMA       -------TDGLDLIQGRVLRF-PK-----S--ELKVPQMGWNNIRVK------QDHPLFK
HIS52_VIBVY      -------TKGLGWIPGKVEYMRPG-----N--DLRVPHVGWNSLILK------KENSLFD
HIS5_HELHP       -------HKGLGLIEGKVVGFEHI-----A--PLKVPHIGWNSCNFTPEG---KHSKLFR
HIS5_WOLSU       -------HAGLGLLEGEIIPFDKTRMG--E--GYKIPQMGWNRFYAK------KKSPLLK
HIS51_CAMJE      -------CEGLGFIEGEVVKFEED-----L--NLKIPHMGWNELEIL------KQVPLYQ
HIS5_ARCFU       -------YRGLDYIPGRVVRFPPSVG--------KVPHMGWNTLKIT------REAEILD
HIS5_METKA       -------SRGLGVFRGTCVALPNDV---------KTPHMGWNTVEFR------TEE--FR
HIS5_BACTN       -------VDCLNIFDVDVKRFVPQKH-ED-----KVPHMGWNTI-GKTNS------KLFE
HIS5_XYLFT       -------VPCLGLLPGRVRRLTPAPS-I------RVPHMGWNRLLPLRAS------PLLA
HIS5_BUCBP       -------IKMLDIIHAPVNILKSNK--------FPLPHNGWNNVSVCDE------NPLFI
HIS5_BLOFL       -------TNTLNIINVPVKHMYSPT--------LPIPHMGWNNITILKK------HDLLN
HIS52_CAMJE      -------QETLKLIDFTTQKFKAKEG-------FTFPHMGWNE--VYSS------HALFK
HIS5_ECOLI       -------VDLLGIIDEDVPKMTDF--------GLPLPHMGWNRVYPQAG------NRLFQ
HIS5_PASMU       -------LDLLKLMSGKTEKLPDC--------QLPLPHMGWNKVHYAAD------HPLFA
HIS5_SHEON       LDCQAHDCKCLGIIPTEIDELNSQTL-KAE--GLPLPHMGWNQLTFSNPSQ---VHPLFA
HIS5_GLOVI       --------PGLGLLPGRVRRFRSEP-------GLTIPHVGWNQLHFDNVDC-----PLWR
HIS5_CYAPA       --------SGLGILSGSVKRIKNEP-------EITIPHMGWNQLQLTNPKC-----YLWD
HIS5_PROMP       --------NGLGIVKGQIKKIPQLS-------DQRIPHVGWCELLPTRKN------SLLK
HIS52_SYNPX      --------EGLGLIKGHVERLPIGA-------GARIPHMGWAPLDLRRAN------PMLA
HIS5_CYACA       --------PGLKIFNGYVSQFKHSL-------VKKVPHMGWNKLYFNRFNTIDNLVPHYF
HIS5_PYRAE       --------QGLGVFKGRVERIK----------ARKVPNIGWRYTHVVK----------NS
HIS5_CYAM1       --------EGLGVYKEQVKRLP----------VKVIPHMGWNRLECQNSEC-QNSEWVNW
HIS5_STAES       --------SGLELVPGNIVPIQ--S-------SHPIPHLGWNELKSTHPLL---------
HIS5_LEPIN       ---KKEQIEGLGYIKGKIKKFHGK--------DFKVPHIGWNRLQIRRKDK----SVLLK
HIS53_VIBVY      ----EGQLKGLGWIPGTVKKFKRESQALES--QYPLPHMGWNSLEIART------SELLL
HIS51_PROMM      ----GNSIPGLDLISGKIVLMSP-----SQ--NLALPHVGWNSVYWSNTI-----TPLSV
HIS51_SYNPX      ------YTKGLSLLPIQIVPLCRH---IDA--SFVLPHVGFTSVYTSKN------DPLFK
HIS5_SULTO       -------SKGLGWFKGKVDKIH---------SNVKLPHIGWDKLFVNKD------SCNLT
HIS5_SULSO       -------SNGLGWFKGIVDKIN---------ANVKLPHIGWDLVFEVKD------SCELT
HIS5_NITEU       -------IRALGILPGRVKKLESTDTADSDIPKIKIPHMGWNQVHQTLE------HPLWH
HIS5_RALSO       -----AFTAGLGLISGDVIRFDLDGRLQPDGSRYKVPQMGWNRVHQSRT------HALWA
HIS5_PSESM       -------VDCIGLFPGQVKFFGKNLHEEGE--HLKVPHMGWNQVTQAVD------HPLWH
HIS5_CHRVO       -------TAGLGLFPGKVVRFADDQVAGGE--RLKVPHMGWNQVYQTRS------HPLFA
HIS5_RHOPA       -------TDGLNWIAGDVVKIAPDRE------DLKIPHMGWNTLDPVRE------HPVLE
HIS5_DEIRA       -------VPGLGLIAGQVRKFAPAPE-------RKVPQMGWNALEARGD---------SP
HIS5_THET2       -------VRGLGLVPGEVRRFRAG----------RVPQMGWNALEFGGA---------FA
HIS5_MYCPA       -------TSGCGQWPGSVTRLQAP----------VIPHMGWNVVESGPD---------SV
HIS5_MYCLE       -------TTGCRQWPGVVTRLDAP----------VVPHMGWNVVDSASG---------SA
HIS5_BIFLO       -------AAGIGLIGGSVNLLDAD----------VVPHMGWDTIETAPD---------SV
HIS5_THEMA       -------VKGLSLIEGNVVKLRSR----------RLPHMGWNEV----------------
                                                     *: *:                   

HIS5_AQUAE       GLKEGDF---VYFVHSYRVVPE-------------D-ESVVLTKTDYGEYFVSSIELD--
HIS5_CALS4       GIKNGDY---VYFVHSYYVNGN-------------E-KDFEYAVTEYGIEIPAVIIKD--
HIS5_RHOBA       GIQSGTH---FYFVHSYFVRPA-------------D-PSVVALTCDYGGEFCAAVRRG--
HIS5_CHLTE       NVPDQSY---FYFVHSYYCAPD-------------EPESVAATTFFAGKKFCSAIEKN--
HIS5_GEOSL       EVEDGAN---VYFVHSYYEMPD-------------D-ESVIAATCTYGVEFCAAIWKD--
HIS5_BACSU       TKTEQGY---AYFVHSYYIDGM-------------EENALLASADYG-VRVPAVVGKR--
HIS5_OCEIH       SKLENPY---VYFVHSYAVSSF-------------EENTLLASSQYG-QLIPAIVQKG--
HIS5_LACPL       SI-DAAY---TYFVHSYYAVCP-------------ATE-IVATVQHG-VQVPSIVQQQ--
HIS5_STRMU       GL-QGQA---VYFVHSYFTDVP-------------QEY-IDVTVDYS-IEVPAMIHKD--
HIS5_LACLA       YLSDNDE---VYFVHSYQATCP-------------DDE-LIAYTTYGEVKIPAIVGKN--
HIS5_METJA       GIKNNSY---FYFVHSYHVNP--------------DEDCIVGKTEY-GREFPSVINKD--
HIS5_PYRFU       GLKNGSY---FYFVHSYHAVPQ-------------DPDIIATTTDYENAEFVSSVCFE--
HIS5_METMA       GIPDGSF---VYFVHSYYVDT--------------AAENTLASCEY-GLEYAASVVNSKG
HIS52_VIBVY      YLQDDKD---FYFVHSLWVNC--------------PEKYKLATFEY-GIEMTASVQYE--
HIS5_HELHP       GIADGSF---FYFVHSFH-IQT-------------QPQFILAQCTY-GYPFGAIVHKD--
HIS5_WOLSU       GLEEGFY---LYYVHSFHAVAK-------------REEDVLGESVY-GYPFVSAIERD--
HIS51_CAMJE      GIDNKSD---FYFVHSFY-VKC-------------KDEFVSAKAQY-GHKFVASLQKD--
HIS5_ARCFU       GVESGEF---VYFVHSYYMQTD-------------D-EFVISKTDY-GIDFPSGVEREN-
HIS5_METKA       EFD-GEM---FYFVHSYRVAPE-------------D-DVVLGETEY-GERFPSVIGDRGR
HIS5_BACTN       GFTEEEF---VYFVHSFYVPVC----------------DFTAAETDYIHPFSAALHKD--
HIS5_XYLFT       EVPEGAN---AYFVHSYAVPLT----------------TAAVAACDHGGMFTAIVQQG--
HIS5_BUCBP       GIKNNSK---FYFLHSYALYEN----------------DYMIAKTFYNVYFSAAVRKE--
HIS5_BLOFL       GINNNHY---FYFAHSYCMELN----------------YTTIAYTNYGQPFSSVIVYK--
HIS52_CAMJE      GLEG-AY---FYFVHSYCVGLG----------------KYTIADCEYSQKFSASVMKD--
HIS5_ECOLI       GIEDGAY---FYFVHSYAMPVN----------------PWTIAQCNYGEPFTAAVQKD--
HIS5_PASMU       EIAQDSY---FYFVHSYGVLPN----------------PHTVATCDYGVPFSAVIQHN--
HIS5_SHEON       GVEAGSY---VYFVHSYRAPLS----------------DYTLAQCRYGEDFSAAIGKD--
HIS5_GLOVI       DLAAGGW---VYFVHSYYVDPA-------------RAEDRAASAVHGSQHFTAAVCRD--
HIS5_CYAPA       GLTKYPW---VYFVHSYFAQPK-------------NPNVIAAAVTHGTQQVTAAIQYE--
HIS5_PROMP       VDELNNW---VYFVHSYHAVPS-------------NNNLITANVSYGSEKLTAMIERD--
HIS52_SYNPX      AADPLAW---VYFVHSYAAVPE-------------RPETLAAAASFGSSSVTAMVWQR--
HIS5_CYACA       HYDLQPW---AYFVHSYYIEPKDC-----------YTFNTTSLTFYGKQKIVSSISYN--
HIS5_PYRAE       EIIAEGY---YYYLHSYGVRWGE--------------NEAYTAYIKLEEKYVAAVERG--
HIS5_CYAM1       KAWPNAW---AYFVHSYGVMAS---------------SQACATTTYEKIQMVAAIEKD--
HIS5_STAES       ----QSD---VYFVHSYQAEMS----------------EYVVAYADYGTKIPGVIQYR--
HIS5_LEPIN       GIGDQSF---FYFIHSYRPTDAEG-----------N-AITGLCDYYQEK-FPAVVEKN--
HIS53_VIBVY      GLDEQKL---FYFLHSYYYEPNDK-----------E-HVVATANYGFE--YACIVNKD--
HIS51_PROMM      DINSGCD---FYFVHSY-TFRCDD-----------DSNCLATSNYGSQFSAVVSDISR--
HIS51_SYNPX      NIANKSD---FYFVHSYGAFNVPH-----------DFTTYSYCNYDAKI--ISSANVN--
HIS5_SULTO       EGLDGKY---VYYVHSYVAY----------------TNDYV-AYSEYGIKYPAIVCND--
HIS5_SULSO       YGLDKKY---VYYVHSYVAYPT--------------SGDYVYMKSQYGIEYPALVCDK--
HIS5_NITEU       GIDTDTR---FYFVHSYYVATD--------------EPQIVAGSTEYPVPFTCAVARD--
HIS5_RALSO       GVPDQSY---FYFVHSYYARPA--------------HPDESVGETEYGVRFTCAIARD--
HIS5_PSESM       DIPDLAR---FYFVHSFYIDAA--------------NQRQVVGRGHYGLDFAAALADG--
HIS5_CHRVO       GIADGER---FYFVHSYHFAPA--------------DAALTLAESDYPQRFACIVGRG--
HIS5_RHOPA       KLPLGPKGLHAYFVHSFHLAAE--------------HEGDVLARADYGGPVTAVVGKD--
HIS5_DEIRA       LLRGLGPDAYAYFVHSYYVPVD--------------VPVTDGAVTDYGVPFWSALSRG--
HIS5_THET2       PLTG----RHFYFANSYYGPL---------------TPYSLGKGEYEGTPFTALLAKE--
HIS5_MYCPA       LFRGLDADTRFYFVHSYAAQQWE------------GSPEAVLTWSRHEGPFLAAVEDG--
HIS5_MYCLE       LFKGLDAGVRFYFVHSYAAQRWE------------GSSKALLTWATHQVPFLAAVEEG--
HIS5_BIFLO       LLNGVE-NERFYFVHSYAAMEVKPADTSRFDIDLSDSPERVSWCSYGRSRFVAAYEHG--
HIS5_THEMA       IFKDTFPNGYYYFVHTYRAVCEE--------------EHVLGTTEYDGEIFPSAVRKG--
                            *: ::                                            

HIS5_AQUAE       NVVAFQFHPEKSQKKGLKLLENFKRKAEKLTT-------------
HIS5_CALS4       NVFSCQFHPEKSGETGLKILKNFGEMIKCL---------------
HIS5_RHOBA       NLMATQFHPEKSQGDGLRLMQRFATAPVEVA--------------
HIS5_CHLTE       GIFAVQFHPEKSSEAGLQVLKNFAEF-------------------
HIS5_GEOSL       NIVATQFHPEKSQAVGLSILKNFGEMK------------------
HIS5_BACSU       NVFGAQFHPEKSSTVGMSILTQFTKMAAEQKVKK-----------
HIS5_OCEIH       NITGMQFHPEKSGEFGIELLKRYEEMIR-----------------
HIS5_LACPL       NVIGMQFHPEKSGRVGLQQLAAFKEMVSANDFSSN----------
HIS5_STRMU       NVYGAQFHPEKSGDVGLGILKKFVDLCD-----------------
HIS5_LACLA       NVIGCQFHPEKSGEIGRKVLKAFLEEI------------------
HIS5_METJA       NVFATQFHPEKSGKIGLKIIENFVELL------------------
HIS5_PYRFU       NIFGVQFHPEKSSKNGLILLRNFRRL-------------------
HIS5_METMA       NVMGTQFHPEKSGATGLKILRNFVEMC------------------
HIS52_VIBVY      NIVGMQFHPEKSQRNGLEAIRSFLDWVKIQKLGVSHA--------
HIS5_HELHP       NLFAIQAHPEKSHNVGLRLLANFLTL-------------------
HIS5_WOLSU       NVAGFQPHPEKSHDVGLRILKNFCEIG------------------
HIS51_CAMJE      HIFATQFHPEKSQNLGLKLLENFARL-------------------
HIS5_ARCFU       -YIGFQFHPEKSGKVGLRILENFVNIVKR----------------
HIS5_METKA       LIYGMQFHPEKSGPVGLKLLGEVLTGASR----------------
HIS5_BACTN       NFYATQFHPEKSGKTGERVLRNFLDL-------------------
HIS5_XYLFT       VRCGAQFHPERSAETGARILRNFLEMDAA----------------
HIS5_BUCBP       NFFGVQFHPEKSGLVGLQLLKNFLEI-------------------
HIS5_BLOFL       NFFGVQFHPEKSSFSGEQLIKNFLEI-------------------
HIS52_CAMJE      NFYGVQFHPERSSEAGEILISNFIKDIG-----------------
HIS5_ECOLI       NFYGVQFHPERSGAAGAKLLKNFLEM-------------------
HIS5_PASMU       NFYGAQFHPERSGKAGALFLRNFVENIK-----------------
HIS5_SHEON       NFMGVQFHPEKSAAVGAQILGNFLKMQ------------------
HIS5_GLOVI       NLMAVQFHPEKSADTGLRILKNFVERAASRSAAEVAARCATRPPA
HIS5_CYAPA       NISAVQFHPEKSASIGLHMLNNFVQQSCN----------------
HIS5_PROMP       NLMACQFHPEKSGKTGEKLLRRWIKSIQ-----------------
HIS52_SYNPX      RLGACQFHPEKSSDSGSAMLKRWLDWLQRGAPIG-----------
HIS5_CYACA       NILATQFHPEKSGLFGLFILKRFLSSY------------------
HIS5_PYRAE       HIIGVQFHPERSGRTGLELIKRFLAVAKR----------------
HIS5_CYAM1       NCFAMQFHPEKSGEFGLWLWREVMKKAASL---------------
HIS5_STAES       NYIGIQFHPEKSGTYGLEILNQALKGGFIND--------------
HIS5_LEPIN       NIFGTQFHPEKSHTHGLKLLENFIRFI------------------
HIS53_VIBVY      NVYGIQCHPEKSHHNGVALLKSFASL-------------------
HIS51_PROMM      NVWGMQFHPEKSQKLGKCLLQNFIALNPC----------------
HIS51_SYNPX      HIMGVQFHPEKSQTNGLILLDNFLSFSNV----------------
HIS5_SULTO       FAVGTQFHPEKSSVTGKIFLRNFYSWVKR----------------
HIS5_SULSO       NVVGTQFHPEKSSNTGKIFLENLKGWIKR----------------
HIS5_NITEU       NIFAIQFHPEKSHSAGLALLSNFLKWTP-----------------
HIS5_RALSO       NIFATQFHPEKSAQAGLQIYRNFVHWKP-----------------
HIS5_PSESM       SRFAVQFHPEKSHTHGLQLLQNFAAWDGRW---------------
HIS5_CHRVO       NIFATQFHTEKSHRAGLQMMKNFLAWDGNV---------------
HIS5_RHOPA       TAIGTQFHPEKSQRFGLALISNFLKWKP-----------------
HIS5_DEIRA       NLHAAQFHPEKSGAVGLALLANFRRELAPA---------------
HIS5_THET2       NLLAPQFHPEKSGKAGLAFLALARRYFEVL---------------
HIS5_MYCPA       PLSATQFHPEKSGDAGAAVLRNWIERL------------------
HIS5_MYCLE       PLVATQFHPEKSGDAGATLLSNWLGEL------------------
HIS5_BIFLO       PLSATQFHPEKSGDAGSQLLKNWIATL------------------
HIS5_THEMA       RILGFQFHPEKSSKIGRKLLEKVIECSLSRR--------------
                    . * *.*:*   *