CLUSTAL format seed alignment for MF_00279

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PDXJ_RHILO      --------------------MPAKLSVNLNAIAMLRNRR-DLP-WPSVTGIGRLALA-AG
PDXJ_BRUAB      --------------------MPAKLSVNLNAIAMLRNRR-DLP-WPSVTGLGRAALA-AG
PDXJ_BRUA2      --------------------MPAKLSVNLNAIAMLRNRR-DLP-WPSVTGLGRAALA-AG
PDXJ_BRUME      --------------------MPAKLSVNLNAIAMLRNRR-DLP-WPSVTGLGRAALA-AG
PDXJ_BRUSU      --------------------MPAKLSVNLNAIAMLRNRR-DLP-WPSVTGLGRAALA-AG
PDXJ_AGRFC      --------------------MPAKLSVNLNAIAMLRNRR-DLP-WPDVAHFGQIALS-AG
PDXJ_RHIME      --------------------MPAKLSVNLNAIAMLRNRR-DLP-WPSVTGLGRTALQ-AG
PDXJ_XYLFA      ------------------MSQRTRLSVNVNKIAVLRNSR-GDG-APDVIRAASACID-AG
PDXJ_XYLFT      ------------------MSQRTRLSVNVNKIAVLRNSR-GHG-APDVIRAASACID-AG
PDXJ_XANCP      --------------------MSTHLSVNVNKIAVLRNSR-GGQ-DPDVVQAARSCIA-AG
PDXJ_XANC8      --------------------MSTHLSVNVNKIAVLRNSR-GGQ-DPDVVQAARSCIA-AG
PDXJ_XANOR      --------------------MTTQLSVNVNKIAVLRNSR-GGT-DPDVLQAARTCIA-AG
PDXJ_XANOM      --------------------MTIQLSVNVNKIAVLRNSR-GGT-DPDVLQAARTCIA-AG
PDXJ_XANAC      --------------------MTTQLSVNVNKIAVLRNSR-GGA-DPDVVQAARACIA-AG
PDXJ_XANC5      --------------------MTTQLSVNVNKIAVLRNSR-GGA-DPDVVQAARACIA-AG
PDXJ_PORGI      ---------------------MTRLSVNVNKIATLRNAR-GGN-VPDVLRVALDCER-FG
PDXJ_BACFR      ---------------------MTKLSVNINKVATLRNAR-GGN-VPNVVKVALDCES-FG
PDXJ_BACFN      ---------------------MTKLSVNINKVATLRNAR-GGN-VPNVVKVALDCES-FG
PDXJ_BACTN      ---------------------MTKLSVNINKVATLRNAR-GGD-TPNVVKVALDCEA-FG
PDXJ_PELUB      ---------------------MKRLGVNIDHVATVRNAR-GSF-HPDPFTIAKHVIK-CG
PDXJ_HELPY      ----------------------MRFGLNIDHIVTLREIR-KTY-EPEILEALFIAKNTHK
PDXJ_HELPJ      ----------------------MRFGLNIDHIVTLREVR-KTY-EPEILEALFIAKNTHK
PDXJ_BDEBA      ------------------MKHKIRLGVNVDHVATLRQVRGGTTAYPNLLDMVKKSVK-GG
PDXJ_WOLPM      ----------------------MKLGVNIDHVATLRNAR-GTS-YPDPLKAAEIAID-AG
PDXJ_ANAMM      ----------------------MQLGVNVDHVATLRNLR-STA-YPDVVRIASKAVE-CG
PDXJ_EHRCJ      -------------------MSSIALGVNIDHIATLRNAR-NVD-YPCIIEVANIAVN-NG
PDXJ_EHRRG      -------------------MSSIALGVNIDHIATLRNAR-NTE-YPDLVEIANIAVN-NG
PDXJ_EHRRW      -------------------MSSIALGVNIDHIATLRNAR-NTE-YPDLVEIANIAVN-NG
PDXJ_CAMJE      ----------------------MLLGVNIDHIAVLRQAR-MVN-DPDLLEAAFIVAR-HG
PDXJ_CAMJR      ----------------------MLLGVNIDHIAVLRQAR-MVN-DPDLLEAAFIVAR-HG
PDXJ_HELHP      --------------------MSIRLGVNIDHIATLREAR-AIY-EPDPLEAVFIAKN-AG
PDXJ_SULDN      ----------------------MKLGVNIDHVAVLREAR-KVN-DPDILNALYVATQ-NG
PDXJ_WOLSU      ----------------------MLLGVNIDHIATLREAR-KIN-EPDPLEAVFLAKR-AG
PDXJ_WIGBR      -------------------MSKLLLGVNVDHVASLRNVR-GGK-FPDPVQLAILAEI-AG
PDXJ_RHOBA      ------------------MPHFIDLGVNVDHVATLRQAR-RGQ-EPDPITAASLAEQ-GG
PDXJ_CHLTE      ----------------------MRLAVNIDHIATLRNAR-NEG-HPDPVEAALLAEK-HG
PDXJ_CHLCH      ----------------------MRLAVNIDHVATLRNAR-GEF-HPDPVEAALIAEQ-AG
PDXJ_PELLD      ----------------------MRLAVNIDHIATLRNAR-NEG-EPDPVAAALLAEE-SG
PDXJ_AQUAE      ----------------------MRLGVNVDHVATVRQAR-RTF-EPSPVFAALIAQQ-AG
PDXJ_DESAG      ---------------------MPVLVVNVDHVATLRQQR-MGK-EPEPVTAAHLAEL-AG
PDXJ_DESVH      ---------------------MPILVVNVDHVATLRQQR-LGI-EPDPVTAAHMAEL-AG
PDXJ_NITWN      ----------------MSSSQSLRLGVNVDHVATIRNAR-GGD-RPDVVRIALAAIA-AG
PDXJ_BRADU      -----------------MPASPLRLGVNVDHVATLRNAR-GGR-NPDPVRAALLAIE-AG
PDXJ_RHOPA      ----------------MSKAPPLRLGVNIDHIATLRNAR-GGR-HPDPLRAAFAAIE-AG
PDXJ_GLUOX      ---------------------MIRLGVNIDHVATLRNAR-GGT-FPDPVAAAELAIA-SG
PDXJ_ZYMMO      ------------------MTKRIRLGVNIDHVATIRNAR-GGI-HPDPVRAAQLAAH-AG
PDXJ_CAUVC      --------------------MSLRLGVNIDHVATIRNAR-GAS-YPEPVRAAELALI-AG
PDXJ_RHORT      ------------------MSRVLRLGVNIDHVATIRNAR-GGD-HPDPLRAAKIAAE-AG
PDXJ_RHOS4      ----------------MKPLGRLRLGVNIDHVATVRNAR-GTS-YPDPLRAGLLAEA-AG
PDXJ_RUEPO      -----------------MSVPHLRLGVNIDHVATVRNAR-GGE-YPDPIRAAKIAEQ-AG
PDXJ_BLOFL      -------------------MSNLLLALNIDHIATVRNAR-GTQ-YPDPVYAAYIAEQ-SG
PDXJ_BLOPB      -------------------MSNLLLGVNIDHIATLRNAR-NTT-YPDPIYAAFIAEQ-SG
PDXJ_PSYA2      MTATAQILPNTLEQNSDNISKKPLLGVNVDHVATLRQAR-GVS-YPSPLAAALLCEK-AG
PDXJ_METCA      ----------------MNVKQPIRLGVNIDHVATIRQAR-HTP-YPSVLHAAFVAEQ-AG
PDXJ_NEIMA      ----------------------MLLGVNIDHIATVRNAR-GTT-YPSPVEAALVAET-HG
PDXJ_NEIMB      ----------------------MLLGVNIDHIATVRNAR-GTT-YPSPVEAALVAET-HG
PDXJ_NEIG1      ----------------------MLLGVNIDHIATVRNAR-GTT-YPSPVEAALVAET-HG
PDXJ_COXBU      ---------------------MVRLGVNIDHIATLRQAR-GVD-YPDPVEAAMMAIE-AG
PDXJ_NITOC      ----------------MIASHAILLGVNIDHVATLRQAR-GTR-YPDPIQAAIEAEQ-AG
PDXJ_LEGPA      ------------------MNKELLLGVNIDHIATIRQAR-GTR-YPDPVQAAMDAEE-AG
PDXJ_LEGPL      ------------------MNKELLLGVNIDHIATIRQAR-GTR-YPDPVQAAMDAEE-AG
PDXJ_LEGPH      ------------------MNKELLLGVNIDHIATIRQAR-GTR-YPDPVQAAMDAEE-AG
PDXJ_PSEAE      ----------------MTEATRILLGVNIDHVATLRQAR-GTR-YPDPVKAALDAEE-AG
PDXJ_PSEPK      ----------------MTHSNRMLLGVNIDHVATLRQAR-GTR-YPDPVKAALDAEE-AG
PDXJ_PSEU2      ----------------MTHSTRILLGVNIDHVATLRQAR-GTR-YPDPVKAALDAEE-AG
PDXJ_PSE14      ----------------MTQSTRILLGVNIDHVATLRQAR-GTR-YPDPVKAALDAEE-AG
PDXJ_PSESM      ----------------MTQSTRILLGVNIDHVATLRQAR-GTR-YPDPVKAALDAEE-AG
PDXJ_PSEPF      ----------------MTISNRILLGVNIDHVATLRQAR-GTR-YPDPVKAALDAEE-AG
PDXJ_PSEF5      ----------------MTTSNRILLGVNIDHVATLRQAR-GTR-YPDPVKAALDAEE-AG
PDXJ_IDILO      -------------------MKGLRLGVNIDHVATLRNAR-GVR-YPDPVAAAAIAEQ-AG
PDXJ_ACIAD      --------------------MAALLGVNIDHVATLRQAR-GTR-YPDPVSAALVCEQ-AG
PDXJ_CHRVO      ---------------------MILLGVNIDHVATLRQAR-GTR-YPSPVEAALVAES-SG
PDXJ_HYDCU      -------------------MNPIFLGLNIDHVATLRQAR-GTR-YPDPVKAALDAEM-AG
PDXJ_NITEU      ---------------------MIALGVNIDHVATVRQAR-GTT-YPSPVEAALVAEV-AG
PDXJ_NITMU      ---------------------MIKLGVNIDHVATLRQAR-GTT-YPDPIEAALIAES-AG
PDXJ_BORBR      ---------------------MIELGVNIDHVATLRQQR-HTA-YPDPVQAALRAED-AG
PDXJ_BORPA      ---------------------MIELGVNIDHVATLRQQR-HTA-YPDPVQAALRAED-AG
PDXJ_BORPE      ---------------------MIELGVNIDHVATLRQQR-HTA-YPDPVQAALRAED-AG
PDXJ_BURL3      ------------MSFFLTTPTAIDLGVNIDHVATLRNVR-GTT-YPDPIRAALAAEE-AG
PDXJ_BURP1      ------------MSFFLTTPAAIDLGVNIDHVATLRNAR-GTA-YPDPVRAALAAED-AG
PDXJ_BURMA      ------------MSFFLTTPTAIDLGVNIDHVATLRNAR-GTA-YPDPVRAALAAED-AG
PDXJ_BURPS      ------------MSFFLTTPTAIDLGVNIDHVATLRNAR-GTA-YPDPVRAALAAED-AG
PDXJ_CUPPJ      -------------MIFHANPGVIDLGINIDHVATLRNAR-GTV-YPDPIEAALQAEE-AG
PDXJ_RALSO      -------------MIFHASPGVIDLGVNIDHVATLRNAR-GTT-YPDPIAAALLAEE-AG
PDXJ_THIDA      ----------------MGGAMSIYLGVNIDHIATLRQAR-KTR-YPSPVEAALAAET-AG
PDXJ_PHOLL      -------------------MAEVLLGVNIDHIATVRNAR-GTH-YPDPVQAAFVAEQ-AG
PDXJ_SALCH      -------------------MAELLLGVNIDHIATLRNAR-GTD-YPDPVQAAFIAEQ-AG
PDXJ_SALPA      -------------------MAELLLGVNIDHIATLRNAR-GTD-YPDPVQAAFIAEQ-AG
PDXJ_SALTY      -------------------MAELLLGVNIDHIATLRNAR-GTD-YPDPVQAAFIAEQ-AG
PDXJ_SALTI      -------------------MAELLLGVNIDHIATLRNAR-GTD-YPDPVQAAFIAEQ-AG
PDXJ_ECOL6      -------------------MAELLLGVNIDHIATLRNAR-GTA-YPDPVQAAFIAEQ-AG
PDXJ_SHIDS      -------------------MAELLLGVNIDHIATLRNAR-GTA-YPDPVQAAFIAEQ-AG
PDXJ_ECOLI      -------------------MAELLLGVNIDHIATLRNAR-GTA-YPDPVQAAFIAEQ-AG
PDXJ_ECO57      -------------------MAELLLGVNIDHIATLRNAR-GTA-YPDPVQAAFIAEQ-AG
PDXJ_SHIBS      -------------------MAELLLGVNIDHIATLRNAR-GTA-YPDPVQAAFIAEQ-AG
PDXJ_SHISS      -------------------MAELLLGVNIDHIATLRNAR-GTA-YPDPVQAAFIAEQ-AG
PDXJ_PECAS      -------------------MAELLLGVNIDHIATLRNAR-GTP-YPDPVQAAFVAEQ-AG
PDXJ_YERPE      -------------------MADLLLGVNIDHIATLRNAR-GTI-YPDPVQAAFIAEQ-AG
PDXJ_YERPS      -------------------MADLLLGVNIDHIATLRNAR-GTI-YPDPVQAAFIAEQ-AG
PDXJ_PHOPR      -------------------MNNILLGVNIDHIATLRNAR-GTR-YPDPVHAAEVAER-AG
PDXJ_ALIF1      -------------------MSSILLGVNIDHVATLRNAR-GTK-YPDPVHAAEIAER-AG
PDXJ_VIBPA      -------------------MSSIYLGVNIDHIATLRNAR-GTK-YPDPVHAAEIAER-AG
PDXJ_VIBCH      -------------------MSSIYLGVNIDHVATLRNAR-GTQ-YPDPVHAAEIAER-AG
PDXJ_VIBVU      -------------------MSSIYLGVNIDHVATLRNAR-GTK-YPDPVHAAEVAER-AG
PDXJ_VIBVY      -------------------MSSIYLGVNIDHVATLRNAR-GTK-YPDPVHAAEVAER-AG
PDXJ_COLP3      -------------------MSELLLGVNVDHIATLRQAR-GTN-YPDPVYAASVAEH-AG
PDXJ_PSET1      -------------------MKDILLGVNVDHIATLRQAR-GTS-YPDPAHAASVAEH-AG
PDXJ_SHEON      -------------------MSRILLGVNIDHIATLRQAR-GTS-YPDPVHAAAVAEH-AG
PDXJ_AROAE      ---------------------MIELGVNIDHVATLRQAR-RTW-EPDPAWAAMEAHL-GG
PDXJ_DECAR      ---------------------MIELGVNIDHIATIRQAR-RTY-EPDPVWGAVEAHL-GG
PDXJ_PROM9      ---------------------MATLGVNIDHIANVRQAR-KTV-EPDPVQFAFLAEL-GG
PDXJ_PROMP      ---------------------MAKLGVNIDHIANVRQAR-QTV-EPDPVQFAFLAEL-GG
PDXJ_PELCD      ---------------------MALLGVNVDHVATIRQAR-GTN-EPDPVTAAALAEL-AG
PDXJ_GEOMG      ---------------------MAKLGVNIDHVATIRQAR-GGV-EPDPVAAAALAEL-AG
PDXJ_GEOSL      ---------------------MAKLGVNIDHVATIRQAR-GGV-EPDPVAAAAIAEF-AG
PDXJ_PROMT      ---------------------MASLGVNIDHIANVREAR-KTF-EPDPVKMVLLAEL-GG
PDXJ_THEEB      ---------------------MATLGVNIDHVATIRQAR-RTV-EPDPVAAALLAEL-GG
PDXJ_SYNP6      ---------------------MPTLGVNIDHVATVRQAR-RTV-EPDPIAAAVLAEL-AG
PDXJ_SYNE7      ---------------------MPTLGVNIDHVATVRQAR-RTV-EPDPIAAAVLAEL-AG
PDXJ_NOSS1      ---------------------MATLGVNIDHIATIRQAR-RTV-EPDPVAAAVLAEL-GG
PDXJ_TRIV2      ---------------------MATLGVNIDHIATIRQAR-RTV-EPDPVAAAVLAEL-GG
PDXJ_SYNY3      ---------------------MLTLGVNIDHVATIRQAR-QTVMEPDPIAAAVLAEL-AG
PDXJ_GLOVI      ---------------------MPTLGVNIDHVATIRQAR-RTV-EPDPAAAAVLVEL-AG
PDXJ_PROMA      ---------------------MTSLGVNIDHIANIRQAR-LAN-EPDPVQMALLAEL-GG
PDXJ_PROMM      ---------------------MASLGVNIDHIANVRQAR-QTV-EPDPVPMALLAEL-GG
PDXJ_SYNPX      ---------------------MASLGVNIDHIANIRQAR-RTV-EPDPVPFAMLAEL-GG
                                        : :*:: :. :*: *      *              

PDXJ_RHILO      AHGLTVHPRPDERHTRHSDLPEIRALIDDEFPQAEFNIEG-------YPSEDFLALVEKH
PDXJ_BRUAB      AAGLTVHPRPDQRHIRFSDLGDIRALIDDEYPQAEFNIEG-------FPSEAFLDLVEKH
PDXJ_BRUA2      AAGLTVHPRPDQRHIRFSDLGDIRALIDDEYPQAEFNIEG-------FPSEAFLDLVEKH
PDXJ_BRUME      AAGLTVHPRPDQRHIRFSDLGDIRALIDDEYPQAEFNIEG-------FPSEAFLDLVEKH
PDXJ_BRUSU      AAGLTVHPRPDQRHIRFSDLGDIRALIDDEYPQAEFNIEG-------FPSEAFLDLVEKH
PDXJ_AGRFC      ASGLTVHPRPDQRHIRFSDLPVLRALIDDRFPGAEFNIEG-------YPTEDFLVLCEKT
PDXJ_RHIME      ASGLTVHPRPDQRHIRFSDLQPIRDLIDDEFPAAEFNMEG-------FPNEAFLELVERH
PDXJ_XYLFA      AHGITVHPRPDARHIRHDDVIGLSALTRAR--GVEFNIEGNPFAEPRAGYCGLLALCRET
PDXJ_XYLFT      AHGITVHPRPDARHIRHDDVIRLSALTRAR--GVEFNIEGNPFAEPRAGYCGLLALCRET
PDXJ_XANCP      AHGITVHPRPDQRHIRADDVYALSTLTRMH--GVEFNIEGNPFAPPRAGYPGLLELCRAT
PDXJ_XANC8      AHGITVHPRPDQRHIRADDVYALSTLTRMH--GVEFNIEGNPFAPPRAGYPGLLELCRAT
PDXJ_XANOR      AHGITVHPRPDQRHIRAGDVLALSALTREH--AVEFNIEGNPFAPPRAGYPGLLELCRAT
PDXJ_XANOM      AHGITVHPRPDQRHIRAGDVLALSALTREH--AVEFNIEGNPFAPPRAGYPGLLELCRAT
PDXJ_XANAC      AHGITVHPRPDQRHIRADDVLALSALTREH--GVEFNIEGNPFAPPRGDYPGLLQLCRAT
PDXJ_XANC5      AHGITVHPRPDQRHIRADDVLALSALTRAQ--AVEFNIEGNPFAPPRAGYPGLLELCRAT
PDXJ_PORGI      AQGITVHPRPDERHIRRSDVYDLKKALTTE-----FNIEG-------NPDERFIRLIEEI
PDXJ_BACFR      ADGITVHPRPDERHIRRSDVYDLRPLLRTE-----FNIEG-------YPSPEFIDLVLKV
PDXJ_BACFN      ADGITVHPRPDERHIRRSDVYDLRPLLRTE-----FNIEG-------YPSPEFIDLVLKV
PDXJ_BACTN      ADGITVHPRPDERHIRRADVYDLRPLLRTE-----FNIEG-------YPSPEFIDLVLKV
PDXJ_PELUB      AHSVTIHLREDRRHIKDSDVVKICKSRKII-----TNLEI-------SLNKEIIDIALKN
PDXJ_HELPY      VDLITIHLREDRRHIQNEDVLKLLEISPLP-----INIEC-------SINAEITDFLCSL
PDXJ_HELPJ      VDLITIHLREDKRHIQNEDVLRLLEISPLP-----INIEC-------SINAEITDFLCSL
PDXJ_BDEBA      AEQITIHLREDRRHIQLEDLKVLSKHCSVP-----LNLEM-------AATSQMVTYAKKY
PDXJ_WOLPM      ADFITVHLREDRRHIRDEDVFNLKKSISTE-----LNLEI-------AATEEMLEIAKKV
PDXJ_ANAMM      ADFITVHLREDRRHIRDGDVFALKKHLAVP-----LNLEM-------AATREMLEIAKKV
PDXJ_EHRCJ      ADFITVHLREDRRHIMDDDVFRLKSSLKVP-----LNLEI-------AATDEMLSIAIEV
PDXJ_EHRRG      ADFITVHLREDRRHIRDSDVFRLKDNLNVP-----LNLEI-------AAIDEMLAIAIAV
PDXJ_EHRRW      ADFITVHLREDRRHIRDSDVFRLKDNLNVP-----LNLEI-------AAIDEMLAIAIAV
PDXJ_CAMJE      -DQITLHVREDRRHAQDFDLENIIKFCKSP-----VNLEC-------ALNDEILNLALKL
PDXJ_CAMJR      -DQITLHVREDRRHAQDFDLENIIKFCKSP-----VNLEC-------ALNDEILNLALKL
PDXJ_HELHP      AHQITFHLREDRRHIHDSDVKRIIQSSPLP-----INIEC-------ALDEKIIDYLCGL
PDXJ_SULDN      ADQITIHLREDRRHIQDADAYAIMKYSNVG-----VNLEC-------SINRAILDIVTDL
PDXJ_WOLSU      AFQITIHLREDRRHIHDYDVERIVESSFLP-----VNVEC-------STDKQIVDLLCEL
PDXJ_WIGBR      ADSITTHLREDNRHINEKDVICIKKSIQSR-----LNLEI-------STKKEMINKAINI
PDXJ_RHOBA      ADGITFHLREDRRHISDRDVELFVQTVQVR-----TNFEL-------ACAADVLAICCRV
PDXJ_CHLTE      AAGIVCHLREDRRHIKDDDLARLREEITTK-----LDLEM-------AMTDEMQKIALSV
PDXJ_CHLCH      AAGIVCHLREDRRHIKDDDLRRLRAAVTTK-----LDLEM-------AMTEELQAIALAT
PDXJ_PELLD      AAGIVCHLREDRRHIRDNDLKGLRRSVKTK-----LDLEM-------AMTEEMQRIAIET
PDXJ_AQUAE      ADQITLHLREDRRHIQDRDLELIKELITIP-----VNLEM-------APTEEMREIALRV
PDXJ_DESAG      ARGIIVHLREDRRHIQDRDVEMIAATLNTR-----MHLEM-------AGTPEMREIALRI
PDXJ_DESVH      ARGIIVHLREDRRHIQDRDVSLLRQTLKTR-----LHLEM-------AATEEMQGIALAE
PDXJ_NITWN      ADGITAHLREDRRHIRDSDMARLKAEIEKP-----LNFEM-------AATAEMQGIALAT
PDXJ_BRADU      ADGITAHLREDRRHIRDEDMARLKAEISKP-----LNFEM-------AATDDMMRISLAT
PDXJ_RHOPA      ADGITAHLREDRRHIRDADMQRLKAEISKP-----LNFEM-------AATDDMIRIALGV
PDXJ_GLUOX      ADGITAHLREDRRHIRDADMPRLRA-LSAP-----LNFEM-------AATDEMVRIACDL
PDXJ_ZYMMO      ADGITTHLREDRRHISDDDLINLEKGITLP-----LNLEM-------AATEEMLEIALQH
PDXJ_CAUVC      ADGITAHLREDRRHISDADIAVLTDLCHKR--GKPLNFEM-------AVTDEMVGIALNA
PDXJ_RHORT      ADGITAHLREDRRHIGDRDIARLRDEIDLP-----LNLEM-------AATAEMLAIALRH
PDXJ_RHOS4      ADGITAHLREDRRHIRDEDITALMQGLRVP-----LNLEM-------ATTPEMQAIALRH
PDXJ_RUEPO      ADGITAHLREDRRHITDADIDGLMAALSVP-----LNFEM-------AATDEMQKIALRH
PDXJ_BLOFL      IDGITVHLREDRRHITDRDVKLLREIVQTT-----MNLEM-------AATDEMVMIACQL
PDXJ_BLOPB      ADSITIHLREDRRHITDRDVEMLCKTIQTS-----MNLEI-------AATDEMINIACTL
PDXJ_PSYA2      ADGITIHLREDRRHIQDADVYEMAGQLTTR-----MNLEM-------AATTEMLEIACRV
PDXJ_METCA      AGGITAHLREDRRHIQDRDIELLREHIETR-----LNLEM-------AVTDEMVAIACRI
PDXJ_NEIMA      ADLITMHLREDRRHIKDADVFAVKNAIRTR-----LNLEM-------ALTEEMLENALKV
PDXJ_NEIMB      ADLITMHLREDRRHIKDADVFAVKNAIRTR-----LNLEM-------ALTEEMLENALKV
PDXJ_NEIG1      ADLITMHLREDRRHIKDADVFAVKNAIRTR-----LNLEM-------ALTEEMLENALKV
PDXJ_COXBU      ADGITLHLREDRRHIQDDDVRNLKRKLTVP-----MNLEM-------ATAEDIIQFAEEI
PDXJ_NITOC      ADGITLHLREDRRHIQERDVALLRDVLVSK-----MNLEM-------AVTGEMLAIAEKY
PDXJ_LEGPA      ADGITLHMREDLRHIQARDVRLIKQVLQTR-----MNLEL-------AVTEAMLDFAEEI
PDXJ_LEGPL      ADGITLHMREDLRHIQARDVRLIKQVLQTR-----MNLEL-------AVTEAMLDFAEEI
PDXJ_LEGPH      ADGITLHMREDLRHIQARDVRLIKQVLQTR-----MNLEL-------AVTEAMLDFAEEI
PDXJ_PSEAE      ADGITVHLREDRRHIQERDVRVLKEVLQTR-----MNFEM-------GVTEEMLAFAEEI
PDXJ_PSEPK      ADGITVHLREDRRHIQERDVVLLKDVLQTR-----MNFEM-------GVTEEMMAFAEKI
PDXJ_PSEU2      ADGITVHLREDRRHIQERDVLLLKDVLQTR-----MNFEM-------GVTEDMLAFAERI
PDXJ_PSE14      ADGITVHLREDRRHIQERDVLLLKDVLQTR-----MNFEM-------GVTEEMLAFAERI
PDXJ_PSESM      ADGITVHLREDRRHIQERDVLLLKDVLQTR-----MNFEM-------GVTEEMLAFAERI
PDXJ_PSEPF      ADGITVHLREDRRHIQERDVLLLKDVLQTR-----MNFEM-------GVTEEMMAFAERI
PDXJ_PSEF5      ADGITVHLREDRRHIQERDVLLLKDVLQTR-----MNFEM-------GVTEEMMAFAERI
PDXJ_IDILO      ADGITIHLREDRRHITDRDVAMLKQTLNVP-----MNLEM-------AVTEEMLDIAIKT
PDXJ_ACIAD      AEGITLHLREDRRHIQDDDVRRMRPLLKTR-----MNLEL-------AVTDEMIAFAKEI
PDXJ_CHRVO      ADLITLHLREDRRHIQDADVKAMRPVLKTR-----MNLEM-------AMTPEMLAHALQV
PDXJ_HYDCU      ADSITLHLREDRRHIQDADVYRLSELRQTK-----INLEM-------AATQEMLEIALKC
PDXJ_NITEU      ADAITLHLREDRRHIQENDVVILRDRLKTR-----MNLES-------AVTEEMIAFACRI
PDXJ_NITMU      ADAITLHLREDRRHIQDRDVEILRGALKTR-----MNLES-------AVTDEMIGFALRI
PDXJ_BORBR      ADLITLHLREDRRHIQDADVYAIRPLLRTR-----MNLEC-------AVTPEMLEIACAV
PDXJ_BORPA      ADLITLHLREDRRHIQDADVYAIRPLLRTR-----MNLEC-------AVTPEMLEIACAV
PDXJ_BORPE      ADLITLHLREDRRHIQDADVYAIRPLLRTR-----MNLEC-------AVTPEMLEIACAV
PDXJ_BURL3      ADAITLHLREDRRHIVDADVRKLRPLLKTR-----MNLEC-------AVTTEMLDIACEV
PDXJ_BURP1      ADAITLHLREDRRHIVDADVRTLRPRVKTR-----MNLEC-------AVTPEMLDIACEI
PDXJ_BURMA      ADAITLHLREDRRHIVDADVRTLRPRVKTR-----MNLEC-------AVTPEMLDIACEI
PDXJ_BURPS      ADAITLHLREDRRHIVDADVRALRPRVKTR-----MNLEC-------AVTPEMLDIACEI
PDXJ_CUPPJ      ADLITLHLREDRRHIRDADVRALRPQLATR-----MNLEC-------AITQEMLDIACEI
PDXJ_RALSO      ADLITLHLREDRRHIKDADVRALRPQLRTR-----MNLEC-------AVTQEMLDIACDI
PDXJ_THIDA      ADSITLHLREDRRHIQDADVTILRQTLKTK-----MNLEM-------AVTEEMLGIALET
PDXJ_PHOLL      ADGITIHLREDRRHITDRDVELLKKTIQTR-----MNLEM-------AVTDEMVDIACRI
PDXJ_SALCH      ADGITVHLREDRRHITDRDVRILRQTLHTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_SALPA      ADGITVHLREDRRHITDRDVRILRQTLHTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_SALTY      ADGITVHLREDRRHITDRDVRILRQTLHTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_SALTI      ADGITVHLREDRRHITDRDVRILRQTLHTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_ECOL6      ADGITVHLREDRRHITDRDVCILRQTLDTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_SHIDS      ADGITVHLREDRRHITDRDVRILRQTLDTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_ECOLI      ADGITVHLREDRRHITDRDVRILRQTLDTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_ECO57      ADGITVHLREDRRHITDRDVRILRQTLDTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_SHIBS      ADGITVHLREDRRHITDRDVRILRQTLDTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_SHISS      ADGITVHLREDRRHITDRDVRILRQTLDTR-----MNLEM-------AVTEEMLAIAVET
PDXJ_PECAS      ADGITVHLREDRRHITDRDVRILRETLQTR-----MNLEM-------AVTEEMLNIACEV
PDXJ_YERPE      ADGITVHLREDRRHITDRDVRILRQTIQTR-----MNLEM-------AVTDEMVDIACDI
PDXJ_YERPS      ADGITVHLREDRRHITDRDVRILRQTIQTR-----MNLEM-------AVTDEMVDIACDI
PDXJ_PHOPR      ADGITVHLREDRRHINDRDVRILKETIQTR-----MNLEM-------AVTDEMVSIALDT
PDXJ_ALIF1      AAGITIHLREDRRHIKDRDVRILRETLQTR-----MNLEM-------AVTDEMVGIALET
PDXJ_VIBPA      ADGITIHLREDRRHILDRDVRILRETIQTR-----MNLEM-------AVTEEMVEIALKT
PDXJ_VIBCH      ADGITIHLREDRRHITDRDVRILRETLQTR-----MNLEM-------AVTDEMVEIALQT
PDXJ_VIBVU      ADGITIHLREDRRHITDRDVRILRETLQTR-----MNLEM-------AVTDEMIEIALKT
PDXJ_VIBVY      ADGITIHLREDRRHITDRDVRILRETLQTR-----MNLEM-------AVTDEMIEIALKT
PDXJ_COLP3      ADGITVHLREDRRHIQDRDIHVLKQTLHTR-----MNFEM-------AVTDEMIAIACDV
PDXJ_PSET1      ADGITIHLREDRRHIQDRDVYVMAKTIQTR-----MNLET-------AVTDEMINIALEV
PDXJ_SHEON      ADGITIHLREDRRHIIDRDVYLLAKTLKTR-----MNFEC-------AVTEEMLNIACEV
PDXJ_AROAE      ADGITVHLREDRRHIQDEDVRRLRELTQVK-----LNLEM-------AATDEMVGIACAL
PDXJ_DECAR      ADGITVHLREDRRHIQDSDVRRLRETTQIK-----LNLEM-------AATDEMVGIACGL
PDXJ_PROM9      ADSITVHLREDRRHIQDRDVFLLKETIKTK-----LNLEM-------AATEEMLEIAKKT
PDXJ_PROMP      ADSITIHLREDRRHIQDRDIYLLKDTIKTK-----LNLEM-------AATEEMLRISKKL
PDXJ_PELCD      ADGITIHLREDRRHIQDRDVELIRQTVKTR-----LNLEM-------AATDEMVGIALKV
PDXJ_GEOMG      ADGITIHLREDRRHIQDRDLKLLRQTVKTK-----LNLEM-------AATAEMVAIALSV
PDXJ_GEOSL      ADGITVHLREDRRHIQDRDLRLLRQTVKTK-----LNLEM-------AATDEMVGIALSV
PDXJ_PROMT      ADGITVHLREDRRHIQDRDLNLLKETVHTR-----LNLEM-------AATEEMTSIALNL
PDXJ_THEEB      ADGITVHLREDRRHIQERDVRLLRQTVRTH-----LNLEM-------AATPEMVAIALDI
PDXJ_SYNP6      AEGITAHLREDRRHIQDRDVRLLRQTVRTR-----LNLEM-------AATDEMVAIALDI
PDXJ_SYNE7      AEGITAHLREDRRHIQDRDVRLLRQTVRTR-----LNLEM-------AATDEMVAIALDI
PDXJ_NOSS1      ADGITVHLREDRRHIQDRDVQLLRHTVRTH-----LNLEM-------AATDEMVGIALDI
PDXJ_TRIV2      ADGITVHLREDRRHIQDRDVQLLRQTVRTH-----LNLEM-------AATDEMVGIALDI
PDXJ_SYNY3      ADGITAHLREDRRHIQERDVEILRKTVRTH-----LNLEM-------AATKEMVEIALNL
PDXJ_GLOVI      ADGITVHLREDRRHIQDRDVEILRRTVRTH-----LNLEM-------AATRAMVDFALDV
PDXJ_PROMA      ADGITIHLREDRRHIQDRDLKLLRETIKSR-----LNLEM-------AATTEMIEIALDL
PDXJ_PROMM      ADGITVHLREDRRHIQDRDLDLLRATVRSR-----LNLEM-------AATAEMVGIALKI
PDXJ_SYNPX      ADGITVHLREDRRHIQDRDVQLLRQTVRSR-----LNLEM-------AATQEMVEIALAV
                   :  * * * **    *   .             ..*             .       

PDXJ_RHILO      --QPEQVTLVPDDPAQATSDHGWNFVADAALLTPIVRRLKKGGFRVSLFSD--ADPAGMT
PDXJ_BRUAB      --EPEQVTLVPDDPMQATSDHGWDFMSKADFLAPIVARLKGRGMRVSLFAD--PDSLGYE
PDXJ_BRUA2      --EPEQVTLVPDDPMQATSDHGWDFMSKADFLAPIVARLKGRGMRVSLFAD--PDSLGYE
PDXJ_BRUME      --EPEQVTLVPDDPMQATSDHGWDFMSKADFLAPIVARLKGRGMRVSLFAD--PDSLGYE
PDXJ_BRUSU      --EPEQVTLVPDDPMQATSDHGWDFMSKADFLAPIVARLKGRGMRVSLFAD--PDSLGYE
PDXJ_AGRFC      --QPEQVTLVPDDPSQATSDHGWDFRKHAVFLKDVVGRLKAGGMRVSLFADGDGEREPVE
PDXJ_RHIME      --EPEQVTLVPDDPAQATSDHGWDFRKSHNLLGNVVGRLKKRGFRVSLFADGIPDPEALK
PDXJ_XYLFA      --RPHQVTLVPDGDQQITSDHGFDFAREGPGLRPLIDEIKQWGCRVSLFVD--VNVTGLA
PDXJ_XYLFT      --RPHQVTLVPDGDQQITSDHGFDFAREGPGLRPLIDEIKQWGCRVSLFVD--VNVTGLA
PDXJ_XANCP      --RPQQVTLVPDGDGQLTSDHGVDFARDGARLAPLIAAFKTLGCRVSLFVD--AGNPEIA
PDXJ_XANC8      --RPQQVTLVPDGDGQLTSDHGVDFARDGARLAPLIAAFKTLGCRVSLFVD--AGNPEIA
PDXJ_XANOR      --RPEQITLVPDGDGQLTSDHGFDFAQDTTQLAELIAAFKAVGSRVSLFVD--AGNPDIA
PDXJ_XANOM      --RPEQITLVPDGDGQLTSDHGFDFAQDTTQLAELIAAFKAVGSRVSLFVD--AGNPDIA
PDXJ_XANAC      --RPEQVTLVPDGDGQLTSDHGFDFAQDTVQLAELITAFKRLGSRVSLFVD--AGNPDIA
PDXJ_XANC5      --RPQQITLVPDGDGQLTSDHGFDFAQDTTQLAELITAFKQLGSRVSLFVD--AGNPDIA
PDXJ_PORGI      --RPEQVTMVPDAPDVLTSNAGWDVARNYDHLCRLVERFHAWGIRTSIFID--TDLDNIS
PDXJ_BACFR      --KPHQVTLVPDDPSQITSNSGWDTKVNFDFLTEVLDEFNGAGIRTSVFVA--PDAEMIE
PDXJ_BACFN      --KPHQVTLVPDDPSQITSNSGWDTKVNFDFLTEVLDEFNGAGIRTSVFVA--PDAEMIE
PDXJ_BACTN      --KPHQVTLVPDDPSQITSNSGWDTKANLEFLSEVLDQFNSAGIRTSVFVA--ADPEMVE
PDXJ_PELUB      --RPNFICIVPEKRKEVTTEGGLNLIKNKKKIKSIISLFNKKSIRTSLFID--PNLKDIK
PDXJ_HELPY      KNKPSKVTIVPENRNEVTTEGGLDC--SLKGLGEVIRAYHNKGIEVSLFID--PLKDALH
PDXJ_HELPJ      KNKPSKVTIVPENRNEVTTEGGLDC--SLKGLEEVIRAYHNKGIEVSLFVD--PLKDALH
PDXJ_BDEBA      --RPDWVCFVPEKRAELTTEGGLDVKKGFKKMFPMVEKLQRIGIEISMFIE--PSLEQVE
PDXJ_WOLPM      --KPYSISIVPEKREELTTEGGLDIVNMHSKLSSIIEEMHSSSIKVSLFID--PNIDQLK
PDXJ_ANAMM      --APRYVCLVPEKREEITTESGVDAKGMFEILAPVVSDLRQSGIGVTLFIE--PEKEQVD
PDXJ_EHRCJ      --KPKCVCLVPEKRQELTTEGGLDVGSIFSYLVSFIEKLHSYDIDVTLFIE--PDISQID
PDXJ_EHRRG      --QPECVCLVPEKRQELTTEGGLDVKNMFTYLMPFVTQLHNHNIKVTLFVE--PDINQIN
PDXJ_EHRRW      --QPECVCLVPEKRQELTTEGGLDVKNMFTYLMPFITQLHNHNIKVTLFVE--PDINQIN
PDXJ_CAMJE      --KPHRVTLVPEKREELTTEGGLCL--NHAKLKQSIEKLQNANIEVSLFIN--PSLEDIE
PDXJ_CAMJR      --KPHRVTLVPEKREELTTEGGLCL--NHAKLKQSIEKLHNANIEVSLFIN--PSLEDIE
PDXJ_HELHP      --KPQRITLVPEKREEITTEGGLDIESRYDSIRDTLKAFESCGIVSALFID--PKKESIF
PDXJ_SULDN      --KPHRTTLVPEKREEVTTEGGLDVVGHEDEIAYAIELLHDYLIPVSLFID--PTIEAVE
PDXJ_WOLSU      --RPHRITLVPEKREEVTTEGGLDLLGRFEILKSRIAQFRENDIAVSLFVD--PDITSIE
PDXJ_WIGBR      --LPYSCCLVPENRQEITTESGIDVIKNKKYLKKVICKLKSLGIKVSLFVD--PIKNQIL
PDXJ_RHOBA      --QPDWALLVPESREEVTTEGGLDVAGDSGRIADAIQMLKDAGIATSLFLD--PEPNQIE
PDXJ_CHLTE      --RPDLVTLVPEKREELTTEGGFAIQKHFTRLTEFVKPLRDKEIGVSVFIE--PEEEAIE
PDXJ_CHLCH      --KPELITLVPEKREELTTEGGFDIVRHFDTLKAYLQPFRSAGIEVSLFIE--PDKQAIE
PDXJ_PELLD      --VPELITLVPEKREELTTEGGFDIERHFKRLALFIEPIRAAGIEVSLFIE--PDSRSID
PDXJ_AQUAE      --KPDRITLVPERREEITTEGGLDVVSLKEKLKEYLKPIKEAGIEVSLFIE--AQKEQID
PDXJ_DESAG      --NPHIVCLVPEKREELTTEGGLVVAGREKELAAYLAPIHARGIRSSLFIE--ADPAQIR
PDXJ_DESVH      --KPHMVCLVPEKREELTTEGGLVVAGRVDFLQAYVKPFHEIGIATSLFIE--ADPDQIR
PDXJ_NITWN      --QPHAVCLVPERREELTTEGGLDAAGQYNALAPFIAKLNDAGIRVSLFIA--ADPRQIE
PDXJ_BRADU      --RPHAVCLVPERRQEVTTEGGLDVVGQHNALAPYIARLNDAGIRVSLFIA--ADPAQIE
PDXJ_RHOPA      --KPHAVCLVPERREELTTEGGLDVVGQQASLGPAIARFNDAGIRTSLFIA--ADPAQIE
PDXJ_GLUOX      --RPHACCLVPEKRQEVTTEGGLDIVGQSEALKPKIARLRDAGIRVSLFID--PEARQIE
PDXJ_ZYMMO      --RPHAVCLVPEKREEQTTEGGLDAAGQIDSLKPIVAKLLAAGIRVSLFIE--PDETQIR
PDXJ_CAUVC      --RPHAACLVPERREEVTTEGGLDVIKGQKRIADATARLRTVGARVSLFIE--PDPDQIR
PDXJ_RHORT      --RPHAACIVPEKREERTTEGGLDVVGGAVHLAPIITALGEAGVRVSLFIE--PDLRQLD
PDXJ_RHOS4      --KPHAVCLVPERREERTTEGGIDVAGDIGRLKDFVAPLRAAGCRVSMFIG--HDVRQIE
PDXJ_RUEPO      --KPHAVCIVPEKREERTTEGGLEVAREENRLAHFIAPLREVGCRVSIFIA--ADRRQVE
PDXJ_BLOFL      --KPHYCCLVPERRRELTTEGGLDLIYQIDKMQNIVLKLSDAGIRVSLFID--PDIEQID
PDXJ_BLOPB      --KPHCCCLVPERRQELTTEGGLDIINKANKLQDIIFKLTEAGIRVSLFID--PNEQQIS
PDXJ_PSYA2      --KPYWVCLVPEKRAELTTEGGLDVAGQLDLLKDYVAKLQAAGIKVSLFID--PEDKQIN
PDXJ_METCA      --HPHACCLVPERREELTTEGGLDVAGHLDRIGETCRRLGDAGIEVSLFID--PEPAQIE
PDXJ_NEIMA      --MPEDVCIVPEKRQEITTEGGLDVLAQQDKIAEFTKILTDAGIRVSLFID--ADDRQIQ
PDXJ_NEIMB      --MPEDVCIVPEKRQEITTEGGLDVLAQQEKIAGFTKILTDAGIRVSLFID--ADDRQIQ
PDXJ_NEIG1      --MPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFAKILTDAGIRVSLFID--ADDRQIQ
PDXJ_COXBU      --KPEHCCLVPEKREELTTEGGLDVAGQQNTLKKVCARLAKVGIEVSLFID--PEEKQID
PDXJ_NITOC      --CPEDCCLVPERREELTTEGGLNVTGQLARITEACVRLKEAGTRVSLFID--ADPRQVE
PDXJ_LEGPA      --LPEHACLVPEKREELTTEGGLDILTHRNVVERAVRRLQLMGSEVSLFID--PDKEQIR
PDXJ_LEGPL      --SPEHSCLVPEKREELTTEGGLDILTHRNVVEKAVRRLQLMGSEVSLFID--PDKEQIR
PDXJ_LEGPH      --SPEHACLVPEKREELTTEGGLDILTHRNVVEKAVRRLQLMGSEVSLFID--PDKEQIR
PDXJ_PSEAE      --RPAHSCLVPERREELTTEGGLDVAGQEQRIRDAVRRLAAVGSEVSLFID--PDPRQIE
PDXJ_PSEPK      --RPAHICLVPETRQELTTEGGLDVAGQEARIKAAVERLARTGAEVSLFID--ADERQIE
PDXJ_PSEU2      --RPAHICLVPETRQELTTEGGLDVAGQEARIKAAVERLAKIGCEVSLFID--ADERQIA
PDXJ_PSE14      --RPAHICLVPETRQELTTEGGLDVAGQEARIRSAVERLAKIGCEVSLFID--ADERQIA
PDXJ_PSESM      --RPAHICLVPETRQELTTEGGLDVAGQEARIKAAVERLAKIGCEVSLFID--ADERQIA
PDXJ_PSEPF      --RPAHICLVPETRQELTTEGGLDVAGQEERIRAAVERLSKIGSEVSLFID--ADERQIA
PDXJ_PSEF5      --RPAHICLVPETRQELTTEGGLDVAGQEARIKAAVERLSKIGSEVSLFID--ADERQIE
PDXJ_IDILO      --QPTYSCLVPEKRQELTTEGGLNVAGQLETITDATRRLSDAGIQVSLFID--ADHEQID
PDXJ_ACIAD      --QPQHVCFVPERRQEVTTEGGLDVVGQFEKVKAATQTLAAVGCDVSLFID--ADLAQID
PDXJ_CHRVO      --APEDVCLVPEKREEVTTEGGLDVRGHYADVKHYTGKLTEAGIRVSIFID--PDREQIQ
PDXJ_HYDCU      --QPEDVCLVPEKREELTTEGGLDVASQKAWLTDYCAQLAENKTRVSLFID--ADDAQIH
PDXJ_NITEU      --KPHDICLVPERREELTTEGGLDVIRHFQQVSVACKRLAEAGIRVSLFVD--AQAGQID
PDXJ_NITMU      --KPHDICLVPERREELTTEGGLDVARHFEQVQRACHRLAEAGIRVSLFVD--AEPAQID
PDXJ_BORBR      --KPSDVCLVPEKRTELTTEGGLDVAGAQAAVTDAVQLLAEAGIRVSLFID--PDARQIE
PDXJ_BORPA      --KPSDVCLVPEKRTELTTEGGLDVAGAQAAVTDAVQLLAEAGIRVSLFID--PDARQIE
PDXJ_BORPE      --KPSDVCLVPEKRTELTTEGGLDVAGAQAAVTDAVQLLAEAGIRVSLFID--PDARQIE
PDXJ_BURL3      --RPHDACLVPEKREELTTEGGLDVAGHFEAVRAACKQLADVGVRVSLFID--PDETQIR
PDXJ_BURP1      --RPHDACLVPEKRSELTTEGGLDVVGHFDAVRAACKQLADAGVRVSLFID--PDEAQIR
PDXJ_BURMA      --RPHDACLVPEKRSELTTEGGLDVVGHFDAVRAACKQLADAGVRVSLFID--PDEAQIR
PDXJ_BURPS      --RPHDACLVPEKRSELTTEGGLDVVGHFDAVRAACKQLADAGVRVSLFID--PDEAQIR
PDXJ_CUPPJ      --RPQDVCLVPERREEVTTEGGLDVAGRFGQVSSACKQLAAAGIRVSLFID--ADADQIA
PDXJ_RALSO      --GPQDVCLVPERRQEVTTEGGLDVVGGFAKVQAACQQLAGAGIRVSLFID--PDPAQIE
PDXJ_THIDA      --RPSDVCLVPEKREELTTEGGLDVAGQQAKMRDACARLGDAGIRVSLFID--ADFAQLD
PDXJ_PHOLL      --KPEFCCLVPEKRQEVTTEGGLDVIGQKDKVAAAVKRLSDAGILVSLFID--AEHRQID
PDXJ_SALCH      --RPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACARLAAAGIQVSLFID--ADEAQIN
PDXJ_SALPA      --RPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACARLAAAGIQVSLFID--ADEAQIN
PDXJ_SALTY      --RPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACARLAAAGIQVSLFID--ADETQIN
PDXJ_SALTI      --RPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACARLAAAGIQVSLFID--ADERQIN
PDXJ_ECOL6      --KPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDACKRLADAGIQVSLFID--ADEDQIK
PDXJ_SHIDS      --KPHFCCLVPEKRQEVTTEGGQDVAGQRDKMRDACKRLADAGIQVSLFID--ADEEQIK
PDXJ_ECOLI      --KPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFID--ADEEQIK
PDXJ_ECO57      --KPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFID--ADEEQIK
PDXJ_SHIBS      --KPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDACKRLTDAGIQVSLFID--ADEEQIK
PDXJ_SHISS      --KPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDACKRLTDAGIQISLFID--ADEEQIK
PDXJ_PECAS      --KPHFCCLVPEKRQEVTTEGGLDVAGQQEKIDNAVARLSQANILVSLFID--ADKRQID
PDXJ_YERPE      --KPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLAVGRLADVGILVSLFID--ADFRQID
PDXJ_YERPS      --KPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLVVGRLADVGILVSLFID--ADFRQID
PDXJ_PHOPR      --KPEFVCLVPEKREELTTEGGLDVAGQLEKIKAATQKLTDAGIKVSLFID--ADRAQID
PDXJ_ALIF1      --KPEFVCLVPEKREELTTEGGLNVSGQLEKVKAATQKLTEAGIKVSLFID--ADKEQID
PDXJ_VIBPA      --KPEFVCLVPEKREELTTEGGLDVVGQLDKVKAATQKLTEAGIKVSLFID--ADRQQIE
PDXJ_VIBCH      --QPEYVCLVPEKREELTTEGGLDVLGQLERVKAATEKLTAAGIKVSLFID--ADREQID
PDXJ_VIBVU      --QPEYVCLVPEKREELTTEGGLDVAGHLDKIKAATEKLTAAGIKVSLFID--ADREQID
PDXJ_VIBVY      --QPEYVCLVPEKREELTTEGGLDVAGHLDKIKAATEKLTAAGIKVSLFID--ADREQID
PDXJ_COLP3      --KPVFCCLVPEKREELTTEGGLDVVGQLDKITKATEQLTAAGIAVSLFID--ADKAQID
PDXJ_PSET1      --KPEYVCLVPEKREELTTEGGLDVAGNLEKITAATKTLSDAGIKVSLFID--ADKAQLD
PDXJ_SHEON      --KPTYVCLVPEKRQEVTTEGGLDVAGQLDKITAAVSRLAANGIQVSLFID--ADKTQID
PDXJ_AROAE      --RPEMAMLVPEGRHEVTTEGGLDVLAQEGRLKDVVARLADAGIVTSVFID--AELGQVE
PDXJ_DECAR      --KPEMAMLVPEGRHEVTTEGGLDILAQEARLKGVISRLADAGIVTSVFID--ADPEQIE
PDXJ_PROM9      --LPDYVTLVPEKREEVTTEGGLDLKSNAQYLKNFVENLKHSNIEVSAFID--PLGEQIN
PDXJ_PROMP      --LPDYVTLVPEKRKEITTEGGLDVKNNEKYLKNYVNSLKSSNIEVSAFID--PANDQIN
PDXJ_PELCD      --RPDAVTLVPEKRKELTTEGGLNVALLRQTLKKHIDLLKQGGISVSLFID--PDLEQVK
PDXJ_GEOMG      --KPDMCTLVPEKRQELTTEGGLDVRIAMQGIAEAVERLQNGGIAVSLFVD--PDPDQVK
PDXJ_GEOSL      --KPDMCTLVPERRQELTTEGGLDVRVGMQALADAIGRLQDGGIVVSLFID--PDADQVK
PDXJ_PROMT      --KPDIVTLVPEKREEVTTEGGLDVIKNKRKLKEIIQRLSGEDIPVSLFVD--PVQAQLE
PDXJ_THEEB      --RPDYVTLVPERREEVTTEGGLDVVSQQEPLTQVVQTLQGAGIPVSLFID--ADPTQLA
PDXJ_SYNP6      --RPDYVTLVPERREEVTTEGGLNVVGQRDRLALVVDQLQSAGIPVSLFID--AEPDQIA
PDXJ_SYNE7      --RPDYVTLVPERREEVTTEGGLNVVGQRDRLALVVDQLQSAGIPVSLFID--AEPDQIA
PDXJ_NOSS1      --KPDYVTLVPEKREEVTTEGGLDIVGQIARIGEVVSKLQNAAIPVSLFID--AEPSQIE
PDXJ_TRIV2      --KPDYVTLVPEKREEVTTEGGLDIVGQIARIGEVVSKLQNAAIPVSLFID--AEPAQIE
PDXJ_SYNY3      --KPDYVTLVPERREEVTTEGGLDVAGNLNYLLGVVEQLQSRHIPVSLFID--PDVAQLK
PDXJ_GLOVI      --RPDYVTLVPERREEVTTEGGLDVGGQIASVGLAVEQLQCAGIPVSLFVD--PDAAQLQ
PDXJ_PROMA      --KPDMITLVPERREEITTEGGLDVASNAKSLKEIVTKMESCCIPTSLFVD--ANSKQLE
PDXJ_PROMM      --QPDMVTLVPERRQEVTTEGGLDVAAQQGSLKGMVDQLQVAGIPVSLFVD--PVSQQLE
PDXJ_SYNPX      --EPDMVTLVPEKREEVTTEGGLDVAAQLSGLTPMVERLQQRGIPVSLFVD--AETTQLE
                   *    :**:     *:: *         :              : *           

PDXJ_RHILO      AARDTGA--DRIELYTGPYGSYHS----------------DSAKA-------DKELERLG
PDXJ_BRUAB      RAKAIGA--DRVELYTGPYGATHD----------------DPAAA-------ARELDRLE
PDXJ_BRUA2      RAKAIGA--DRVELYTGPYGATHD----------------DPAAA-------ARELDRLE
PDXJ_BRUME      RAKAIGA--DRVELYTGPYGATHD----------------DPAAA-------ARELDRLE
PDXJ_BRUSU      RAKAIGA--DHVELYTGPYGATHD----------------DPAAA-------ARELDRLE
PDXJ_AGRFC      LAAETGA--ARIELYTGPYGGCFD----------------DTQKA-------DLLVEKLG
PDXJ_RHIME      LAKETGA--DRIELYTGPYGGCYD----------------DPEKA-------ERIAIELG
PDXJ_XYLFA      DAAIWGV--DRIELYTGPYAEMHH----------------AGCSD--------AVLREFA
PDXJ_XYLFT      DAAIWGV--DRIELYTGPYAEMHH----------------AGCSD--------AVLREFA
PDXJ_XANCP      QAAALGA--DRIELYTGPYAEAHH----------------HGQSQ--------PSLALFA
PDXJ_XANC8      QAAALGA--DRIELYTGPYAEAHH----------------HGQSQ--------PSLALFA
PDXJ_XANOR      GAAALGA--DRVELYTGPYAHAHA----------------SGQTD--------TALALFA
PDXJ_XANOM      GAAALGA--DRVELYTGPYAHAHA----------------SGQTD--------TALALFA
PDXJ_XANAC      RAATLGA--DRIELYTGPYAHAHA----------------SGQAD--------TALALFA
PDXJ_XANC5      RAAALGA--DRIELYTGPYAHAHA----------------SGQAD--------ATLALFA
PDXJ_PORGI      WAAKTGT--DRIELYTEPYAAAYH----------------KDMAA---------AVQPYV
PDXJ_BACFR      YAAKAGA--DRVELYTEPYATAYP----------------KDPAA---------AVAPFV
PDXJ_BACFN      YAAKAGA--DRVELYTEPYATAYP----------------KDPAA---------AVAPFV
PDXJ_BACTN      YAAKAGA--DRVELYTEPYATAYP----------------KNPEA---------AVAPFV
PDXJ_PELUB      IAKELNA--TCVELHTGKISNLIK----------------ENKSY-------KNEYLKIK
PDXJ_HELPY      FAREHQV--KQVEFHTGVYANLHNALYSNANNQIHAISVLKDKSPKELKEELHNAFLQLR
PDXJ_HELPJ      FAKEHQV--KQVEFHTGVYANLHNALYSNANNQIHAISTLKDKCPKELKEELHNAFLQLR
PDXJ_BDEBA      ASYEIGA--DAVEFHTGKWVMLKG----------------ARKAA---------EWKRLC
PDXJ_WOLPM      YLEKLGTKPDIIEIHTGDYCDNPS--------------------E--------KKLQLIT
PDXJ_ANAMM      YAKKLCA--DKVELHVGAYCLSKS--------------------Q--------GELERIA
PDXJ_EHRCJ      LAKKLHA--NNVELHTGKYCNNAT--------------------Q--------NELSKII
PDXJ_EHRRG      YAKKLSV--DNIELHTGVYCNHNT--------------------Q--------NELNRIL
PDXJ_EHRRW      YAKKLSV--DNIELHTGVYCNHNT------------------QN----------ELNRIL
PDXJ_CAMJE      KSKILKA--QFIELHTGHYANLHNALFSNISHTAFALKELDQDKK-TLQAQFEKELQNLE
PDXJ_CAMJR      KSKILKA--QFIELHTGHYANLHNALFSNISHTAFALKELNQDKK-TLQAQFEKELQNLE
PDXJ_HELHP      LARELGA--QAVELHTGRYANLMLMAYSNLSRTHRALEEFAFPTQ-EINEEISRTLDDIA
PDXJ_SULDN      KSKELGA--EMVELHTGAFANLYAMLSSSLPHSNHSIKELELPRH-ELSIRLEKSILAID
PDXJ_WOLSU      LSKELGA--DMVELHTGTFANLHLMLRSNLPKTPHAIPALEMDRR-SLSLAYRESLLTLQ
PDXJ_WIGBR      SSSEINA--DCIEINTGKYSEQDK----------------KENKE---------EINLIK
PDXJ_RHOBA      AAAKLQV--DAVELHTGPYALARG----------------AAVQH---------ELRRLA
PDXJ_CHLTE      LAAEAGA--NIVEFHTGTYSLCTS----------------DKQTA--------YELERIR
PDXJ_CHLCH      LAAQAGA--DIVELHTGLYALKAG----------------EAQEE---------ELTRIG
PDXJ_PELLD      LAAEAGS--DLVELHTGSYALKSG----------------EEQTA---------EFERIR
PDXJ_AQUAE      ASVEVGA--DAIEIHTGRYANLWN----------------EHRFE-----EAKEELNRIK
PDXJ_DESAG      AARNVGS--EYVELHTGHFADAAT----------------QDEMR--------RERDKIV
PDXJ_DESVH      AAARVGV--THVELHTGHFADAPD----------------AAERK--------RQRDAIV
PDXJ_NITWN      AAAKLRA--PVIEIHTGGWCDAVV----------------EGDSG-----KADAEWRRIV
PDXJ_BRADU      MAARLRA--PVIEIHTGAWCDAVV----------------DGHTE-----KADAEWKRIV
PDXJ_RHOPA      MAAKLKA--PAIEIHTGAWCDAIT----------------DGDAA-----KANTEWQRIF
PDXJ_GLUOX      TAAALGA--PVVELHTGAYALGGS-----------------------------EELERLR
PDXJ_ZYMMO      AAKALNA--PVIELHTGHYANSVN----------------EELAA---------ELIRIE
PDXJ_CAUVC      ACVTAGA--QVVELHTGAYCDAAR----------------AGETA-----RAEAILKRLK
PDXJ_RHORT      AARALGA--PVVELHTGAYCDAAA----------------GPARE--------AQFLRID
PDXJ_RHOS4      ASAEIGA--AVVELHTGHYCDLVA----------------EGRTA-----EAARELEALR
PDXJ_RUEPO      AAHRIGA--QVIELHTGAYCDAHA----------------EGDFA-----TRDRELEALR
PDXJ_BLOFL      ASYKIGV--RCIELNTGKYAESKN----------------KEDRI--------LEYRRIE
PDXJ_BLOPB      VAYNIGA--PYIELHTGMYSHATD----------------ATTQN--------LEYKRIK
PDXJ_PSYA2      AAVTCGA--DAIELHTGSYAEAGL----------------AGDIE-----KGSVELERIK
PDXJ_METCA      AAARAGA--PVIELHTGRYADARN----------------DQERS--------IELEKLR
PDXJ_NEIMA      AARDVGA--PVVELHTGAYADARS----------------HAEQI--------RQFERIQ
PDXJ_NEIMB      AARDVGA--PVVELHTGAYADARS----------------HAEQI--------RQFERIQ
PDXJ_NEIG1      AARDVGA--PVVELHTGAYADAQS----------------HAEQI--------RQFERIQ
PDXJ_COXBU      AAKAAGA--PVIEIHTGHYANAKT----------------DHEHN--------QQLKRIA
PDXJ_NITOC      AAAQANA--PVIEIHTGHFADARD----------------ERNRR--------KEFQRIV
PDXJ_LEGPA      AAVDVGA--PVIELHTGCYADATS----------------EEKQH--------YELQRIK
PDXJ_LEGPL      AAVDVGA--PVIELHTGCYADATS----------------EEKQH--------YELQRIK
PDXJ_LEGPH      AAVDVGA--PVIELHTGCYADATS----------------EEKQH--------YELQRIK
PDXJ_PSEAE      ASARVGA--PAIELHTGRYADAED----------------PEEQA--------RELQRVR
PDXJ_PSEPK      ASRRVGA--PAIELHTGRYADAET----------------PTEVA--------EELKRIV
PDXJ_PSEU2      ASKRVGA--PAIELHTGRYADAQT----------------PTEVA--------EELQRVA
PDXJ_PSE14      ASKRVGA--PAIELHTGRYADAQT----------------PTEVA--------EELQRVA
PDXJ_PSESM      ASKRVGA--PAVELHTGRYADAQT----------------PTEVA--------EELQRVA
PDXJ_PSEPF      ASKRVGA--PAIELHTGRYADAET----------------PSEVA--------EELKRVA
PDXJ_PSEF5      ASKRVGA--PAIELHTGRYADAQT----------------PSEVA--------EELQRIV
PDXJ_IDILO      AAKKAGA--PIVELHTGQYAEAET----------------EEQRT--------VELARLM
PDXJ_ACIAD      AAIACGA--PTIELHTGAYADAET----------------EEQQQ--------AELQRII
PDXJ_CHRVO      KAFDAGA--RVIELHTGAYADAPH----------------ASERE--------AELARIR
PDXJ_HYDCU      AAKEVGA--PVIEIHTGTYAELTD----------------PAAIK--------TELERIR
PDXJ_NITEU      AAVEAGA--PVIELHTGRYADAAT----------------PEMQQ--------VELETIR
PDXJ_NITMU      ASVEAGA--PVIEIHTGHYADAQT----------------TDEQQ--------GELERVR
PDXJ_BORBR      AAARAGA--PVIELHTGAYAEARD----------------DAAVQ--------AELARVR
PDXJ_BORPA      AAARAGA--PVIELHTGAYAEARD----------------DAAVQ--------AELARVR
PDXJ_BORPE      AAARAGA--PVIELHTGAYAEARD----------------DAAVQ--------AELARVR
PDXJ_BURL3      AAHEAGA--PVIELHTGRYAEAHD----------------EAEQQ--------REYERIV
PDXJ_BURP1      AAHETGA--PVIELHTGRYADAHD----------------AAEQQ--------REFERIA
PDXJ_BURMA      AAHETGA--PVIELHTGRYADAHD----------------AAEQQ--------REFERIA
PDXJ_BURPS      AAHETGA--PVIELHTGRYADAHD----------------AAEQQ--------REFERIA
PDXJ_CUPPJ      AAAACGA--PVIELHTGRYADAHT----------------PDELA--------IEFRRVA
PDXJ_RALSO      AAAATGA--PVVELHTGRYAEATD----------------DAEVK--------AELVRIE
PDXJ_THIDA      AAHAAGA--PVVEIHTGHYADAAS----------------DAARA--------AEFERIR
PDXJ_PHOLL      AANEVGA--PFIEIHTGAYADAKN----------------EVEQE--------KEFHRIK
PDXJ_SALCH      AAAEVGA--PFIEIHTGCYANAET----------------DAEQA--------KELARIA
PDXJ_SALPA      AAAEVGA--PFIEIHTGCYANAET----------------DAEQA--------KELARIA
PDXJ_SALTY      AAAEVGA--PFIEIHTGCYANAET----------------DAEQA--------KELARIA
PDXJ_SALTI      AAAEVGA--PFIEIHTGCYANAET----------------DAEQA--------KELARIA
PDXJ_ECOL6      AAAEVGA--PFIEIHTGCYADAKT----------------DAEQA--------QELARIA
PDXJ_SHIDS      AAAEVGA--PFIEIHTGCYADAKT----------------DAEQA--------QELARIA
PDXJ_ECOLI      AAAEVGA--PFIEIHTGCYADAKT----------------DAEQA--------QELARIA
PDXJ_ECO57      AAAEVGA--PFIEIHTGCYADAKT----------------DAEQA--------QELARIA
PDXJ_SHIBS      AAAEVGA--PFIEIHTGCYADAKT----------------DAEQA--------QELVRIA
PDXJ_SHISS      AAAEVGA--PFIEIHTGCYADAKT----------------DAEQA--------QELVRIA
PDXJ_PECAS      AAVASGA--AYIEIHTGAYADAPD----------------DETRQ--------HEFERIR
PDXJ_YERPE      AAVAAGA--PYIEIHTGAYADAST----------------VLERQ--------AELMRIA
PDXJ_YERPS      AAVAAGA--PYIEIHTGAYADAST----------------VLERQ--------AELMRIA
PDXJ_PHOPR      ATLACGA--PFVELHTGHYADAET----------------EEAQQ--------AELEKIA
PDXJ_ALIF1      AAVECGA--PFIELHTGAYADAET----------------EEAQQ--------DELKKIA
PDXJ_VIBPA      AAKQCGA--PFIELHTGHYADAET----------------EEEQQ--------AELKKIA
PDXJ_VIBCH      AAKACGA--PFIELHTGHYSDAKS----------------DVDQQ--------NELKKIA
PDXJ_VIBVU      AAKACGA--PFIELHTGHYADAAT----------------EADQL--------DELKKIA
PDXJ_VIBVY      AAKACGA--PFIELHTGHYADAAT----------------EADQL--------DELKKIA
PDXJ_COLP3      AAVASKA--PYIEIHTGHYADLSS----------------EEEQL--------IELERLT
PDXJ_PSET1      AAKATGA--PYVEIHTGAYADATT----------------DEAIS--------KELEHIR
PDXJ_SHEON      AAVASGA--PLIEIHTGCYADAKT----------------ADEEA--------KELERIR
PDXJ_AROAE      AAARIGA--RVCEIHTGPYAHAFH----------------AAGRD-PQSAAVVDEIDKVR
PDXJ_DECAR      AAARIGA--SVCEIHTGPYAHAFY----------------DKGRD-AEAPAVLAEIAKIR
PDXJ_PROM9      YSKEIGF--DFIELHTGKYAELSG-----------------SEQY--------KELQRII
PDXJ_PROMP      SSGEIGF--DFIELHTGKYAGLKG-----------------QDQY--------VELQKII
PDXJ_PELCD      ASHRIGA--DAIEIHTGAYCDAAC----------------AATRS--------KELDKLT
PDXJ_GEOMG      ASSKVGS--DYIEIHTGAFADAKD---------------WKSEQD---------ELERIG
PDXJ_GEOSL      ASSKVGA--DYIEIHTGTFAEARE---------------WKKEQA---------ELERIE
PDXJ_PROMT      NCAEVKA--AWVELHTGKYAITKK----------------KARDL---------ELSILK
PDXJ_THEEB      AAAKTTA--QFIELHTGRYAEAKG----------------EVAQQ--------RELAILA
PDXJ_SYNP6      ASAAIQA--QWIELHTGRYAEAET----------------EAAQA--------QELAALR
PDXJ_SYNE7      ASAAIQA--QWIELHTGRYAEAET----------------EAAQA--------QELAALR
PDXJ_NOSS1      ASVKVQA--KFIELHTGRYAEATD----------------ETSRQ--------QELAFLA
PDXJ_TRIV2      ASVKVQA--KFIELHTGRYAEATD----------------ETSRQ--------QELAFLA
PDXJ_SYNY3      ASAQTGA--KFIELHTGKYANAPT----------------ADDQA--------RELGSLA
PDXJ_GLOVI      ASARTGA--KFVELHTGRYAEARG----------------EQAQR--------SELAQLA
PDXJ_PROMA      ASSKIGA--TWVELHTGPYARASW-----------------KNQP--------LEFAKIS
PDXJ_PROMM      AAFKSGA--RWVELHTGAYAEACW-----------------ADQS--------FELARLT
PDXJ_SYNPX      ACRNSGA--HWVELHTGTYADASW-----------------ADQP--------GQLARIT
                            *: .                                            

PDXJ_RHILO      KTADAAFAA--G--LQVNAGHDLTVGNLPALAKRIPA-LAEVSIGHGLTADALEYGMAGT
PDXJ_BRUAB      KAARAATAL--G--LAVNAGHDLTVDNLPALVKRIPQ-LAEVSIGHGLTADALMYGIPVT
PDXJ_BRUA2      KAARAATAL--G--LAVNAGHDLTVDNLPALVKRIPQ-LAEVSIGHGLTADALMYGIPVT
PDXJ_BRUME      KAARAATAL--G--LAVNAGHDLTVDNLPALVKRIPQ-LAEVSIGHGLTADALMYGIPVT
PDXJ_BRUSU      KAARAATAL--G--LAVNAGHDLTVDNLPALVKRIPQ-LAEVSIGHGLTADALMYGIPVT
PDXJ_AGRFC      QTADHAAAL--G--LAVNAGHDLTVANLPKLMKRIPN-LAEVSIGHGLTADAMEYGMAET
PDXJ_RHIME      RTAEIAIGL--G--LAVNAGHDLTVANLPLLVEHIPE-LAEVSIGHGLTADALEYGMAET
PDXJ_XYLFA      TTARLAQDV--G--LGVNAGHDLSQTNLGVFLGAVPD-VLEVSIGHALISEALYEGLVPT
PDXJ_XYLFT      TTARLAQDV--G--LGVNAGHDLSQTNLGVFLGAVPD-VLEVSIGHALISEALYEGLIPT
PDXJ_XANCP      DAARRAHAA--G--LGINAGHDLSQHNLADFLAGVPD-VLEVSIGHALVGEALYQGLEPT
PDXJ_XANC8      DAARRAHAA--G--LGINAGHDLSQHNLADFLAGVPD-VLEVSIGHALVGEALYQGLEPT
PDXJ_XANOR      DAGRRASAA--G--LGINAGHDLSQANLGDFLAAVPG-VLEVSIGHALIGEALYQGLEAT
PDXJ_XANOM      DAGRRASAA--G--LGINAGHDLSQANLGDFLAAVPG-VLEVSIGHALISEALYQGLEAT
PDXJ_XANAC      NAAQRASAA--G--LGINAGHDLSQANLGDFLAAVPG-VLEVSIGHALISEALYQGLDAS
PDXJ_XANC5      DAAQRASAA--G--LGINAGHDLSQANLGDFLAAVPG-VLEVSIGHALISEALYQGLDAS
PDXJ_PORGI      KASVHAHSL--G--LGINAGHDLNLDNLRYFAERLPY-LDEVSIGHALIADALYLGLEET
PDXJ_BACFR      EAAKAARRL--G--IGLNAGHDLSLLNLNYFYKNIPW-LDEVSIGHALISDALYLGLERT
PDXJ_BACFN      EAAKAARRL--G--IGLNAGHDLSLLNLNYFYKNIPW-LDEVSIGHALISDALYLGLERT
PDXJ_BACTN      EAAKTARKL--G--IGLNAGHDLSLVNLNYFYKNIPW-VDEVSIGHALISDALYLGLERT
PDXJ_PELUB      KCSELGVKL--G--IEVHAGHGLDYKTTSI-LSKIKE-ITEFNIGHFIIGESLTHGLKKT
PDXJ_HELPY      RMSKEAFFM--G--ITACAGHGLNYTNVKE-LLKIPS-LRELNIGHSVVSKAVLVGLEKA
PDXJ_HELPJ      RMSKEAFFM--G--IVVCAGHGLNYSNVKE-LLKIPS-LRELNIGHSVVSKAVLVGLEKA
PDXJ_BDEBA      DAAEWAHYL--G--LNVHAGHGLDYEHSKL-INKLPH-LQEVNIGHSLVCYALEHGMEES
PDXJ_WOLPM      NAAEYVNKL--G--IECHAGHGITYKHAKK-MTRIPH-ISALNIGHYLISEAVFYGLHSV
PDXJ_ANAMM      NAAAYSHEQ--G--MECHAGHGIDYGTAAT-IATIRH-VSALNVGHFLICESLLHGVGSA
PDXJ_EHRCJ      KAAEHCHHQ--N--ITCHAGHGLNYQSAAT-IAKVPY-ISALNIGHFLICEAVLHGIGKS
PDXJ_EHRRG      EAAKHCYTN--K--IECHAGHGLDYQSAAT-IARVPY-ISALNIGHFLICEAVLHGIGTS
PDXJ_EHRRW      EAAKHCYTN--K--IECHAGHGLDYQSAAT-IARVPY-ISALNIGHFLICEAVLHGIGTS
PDXJ_CAMJE      LCAKKGLEL--G--LKVAAGHGLNYKNVKP-VVKIKE-ICELNIGQSIVARSVFTGLQNA
PDXJ_CAMJR      LCAKKGLEL--G--LKVAAGHGLNYKNVKP-VVKIKE-ICELNIGQSIVARSVFTGLQNA
PDXJ_HELHP      QCAKLATSTIDTRPLECFAGHGLNYQNVGA-IAQIPQ-ISELNIGHSIIARSVFVGLERA
PDXJ_SULDN      EAAKHAKKI--G--LEVAAGHGLNYHNVHE-MMKIAE-ITELNIGQSIVARSIFSGLGEA
PDXJ_WOLSU      KAAQKANTL--G--IEVAAGHGLNYQNVSE-IVKIPE-IIELNIGHSLIARSIFTGFEAA
PDXJ_WIGBR      LCAKYANKL--G--LEVHAGHGLNYFNVRS-IVNIKE-IKELNIGHSIISRSLIVGMQNA
PDXJ_RHOBA      DTGKMIRDA--G--MRLHAGHGLNYVNVRP-VAAIDG-MAELNIGHSIVSRSVMVGMREA
PDXJ_CHLTE      NSARIAREM--G--LTVVAGHGLSVLNIAP-FKELHD-IEEVSIGHAIISRAVFIGLPAA
PDXJ_CHLCH      NAAAFARNI--G--LKVVAGHGLNYSNIAP-FRNIVE-IEEVSIGHAIITRAIFSGLEGA
PDXJ_PELLD      HAAKYAVDR--G--LKVVAGHGLNYRNIQP-FRQIPE-IEEVSIGHALIARAAFVGIPEA
PDXJ_AQUAE      EAAIYAKEK--G--LKVYAGHGLTYHNVKDFVRELKGYVEELNIGHSIVANAVIFGFERA
PDXJ_DESAG      RGVELARTL--G--LKVNLGHGLNYTNIYE-FKNVSG-ISEYSIGHSIVSRAVLTGMEKA
PDXJ_DESVH      AGIGLARTL--G--LKVNLGHGLNYDNIFD-FEAVPG-ICEFSIGHSIVSRAVLTGFGPA
PDXJ_NITWN      EGAALARSV--G--LEVHAGHGLDYATAET-IAALPE-ITELNIGYFMMGEALLVGIAET
PDXJ_BRADU      AGAKLAKDA--G--LEVHAGHGLDYATAET-IAALPD-IMELNIGYYMIGEALFVGLAET
PDXJ_RHOPA      AGAALARSA--G--LEVHAGHGLDYATAET-ISELPQ-IVELNIGFYMIGEALFVGLGET
PDXJ_GLUOX      SAAGTVAAC--G--LELHAGHGLTYDNVGA-IADLTG-LAELNIGHFLIGQAIFDGLGPV
PDXJ_ZYMMO      QAAKLAKSL--N--IEVHAGHGLTYENVIP-IAALEE-IAELNIGHFLIGEAIFIGLEAS
PDXJ_CAUVC      AGAALAHEL--G--LEVHAGHGIDYATVKP-VAAIPQ-IAELNIGHFLIGEAIFVGLPEA
PDXJ_RHORT      KAARHAQAL--G--LECHAGHGLTYDTVEP-VAALPA-IAELNIGHFLIGEAIFVGLHQA
PDXJ_RHOS4      EGAALAHSL--G--LEVHAGHGISYDTVAE-IAAFPQ-VMELNIGHFLIGEAIFRGLGSA
PDXJ_RUEPO      EMSAFAHSL--G--LEVHAGHGLTYDTVQP-VAAFPE-VMELNIGHFLIGEAIFRGLHPA
PDXJ_BLOFL      KSIKHALSY--G--LMINAGHGLNYDNVKF-IAMLSQ-IRELNIGHAIVSRAVFCGLPKA
PDXJ_BLOPB      KSVQYAVNK--G--LKVNAGHGLNYYNVRP-IAMLPG-IQELNIGHAIISRSIFCGLPKA
PDXJ_PSYA2      TAVITAKRI--DSKLLVNAGHGLTHDNVNA-IAQIDG-IYELNIGHALIADALFVGIEQA
PDXJ_METCA      HAASVAEAL--G--LQVNAGHGLTYANVGA-ICRIPQ-IVELNIGHAIVARAFFSGLKEA
PDXJ_NEIMA      NGAHFASDL--G--LVVNAGHGLTIHNVTP-IAQILA-IRELNIGHSLISQALFLGLPEA
PDXJ_NEIMB      NGAHFAGDL--G--LVVNAGHGLTIHNVTP-IAQILA-IRELNIGHSLIAQALFLGLPEA
PDXJ_NEIG1      NGAHFAGDL--G--LVVNAGHGLTIHNVTP-VAQILA-IRELNIGHSLIAQALFLGLPEA
PDXJ_COXBU      DAAAYADSL--G--LTVNAGHGLTIHNVQS-IAAIPV-INELNIGHSIISRGVLIGLAEA
PDXJ_NITOC      EAVKRGREV--G--LQVNAGHGLNYQNVAA-IAALSD-IVELNIGHAIIARALFTGMQSA
PDXJ_LEGPA      EAAEFAASL--N--LVVNAGHGLHYHNVKP-IAAIRE-LNELNIGHAIIARALFCGLKEA
PDXJ_LEGPL      EAAEFAASL--N--LVVNAGHGLHYHNVKP-IAAIRE-LNELNIGHAIIARALFCGLKEA
PDXJ_LEGPH      EAAEFAASL--N--LVVNAGHGLHYHNVKP-IAAIRE-LNELNIGHAIIARALFCGLKEA
PDXJ_PSEAE      EGVALGRSL--G--LIVNAGHGLHYHNVEP-VAAIDG-INELNIGHAIVAHALFVGFRQA
PDXJ_PSEPK      EGVAFGVGH--G--LIVNAGHGLHYHNVEA-VAAIKG-INELNIGHALVAHALFVGFKAA
PDXJ_PSEU2      DGVAFGLAQ--G--LVVNAGHGLHYHNVEA-VAAIKG-INELNIGHALVAHALFVGFKAA
PDXJ_PSE14      DGVAFGLAQ--G--LIVNAGHGLHYHNVEA-VAAIKG-INELNIGHALVAHALFVGFKAA
PDXJ_PSESM      DGVAFGLAQ--G--LIVNAGHGLHYHNVEA-VAAIKG-INELNIGHALVAHALFVGFKAA
PDXJ_PSEPF      DGVAFGLAQ--G--LIVNAGHGLHYHNVEA-VAAIKG-INELNIGHALVAHALFVGFKSA
PDXJ_PSEF5      DGVAVGLAQ--G--LIVNAGHGLHYHNVEA-VAAIKG-INELNIGHALVAHALFVGFKGA
PDXJ_IDILO      EASEYAHSI--G--LQVNVGHGLHYHNTLE-VAEIPQ-VCELNIGHSIIARAVLVGLDQA
PDXJ_ACIAD      EGVEYAASK--G--LVVNAGHGLNLDNITP-IAAIPQ-IHELNIGHSIIADSVFVGLAQA
PDXJ_CHRVO      EAAEFGASL--G--MVVNAGHGLNYHNVKP-IAAIPQ-IAELNIGHAIVAHALFVGFPQA
PDXJ_HYDCU      KATDLAVSL--G--LTVNAGHGLHYHNVQA-IAAIKE-IEELNIGHAIIAQAIFSGLPDA
PDXJ_NITEU      TMAAYAFGR--G--LQVNAGHGLHYENTVQ-IAAIPE-LSELNIGHAIVARALFVGFAEA
PDXJ_NITMU      AAVSKGLNH--G--LTVNAGHGLHYLNVQA-IAAIPG-VSELNIGHAIVARALFVGFERA
PDXJ_BORBR      AAVAEGLRH--G--LRVNAGHGLHYGNVQA-VAALDG-IAELNIGHAIVAQSIFDGWDKA
PDXJ_BORPA      AAVAEGLRH--G--LRVNAGHGLHYGNVQA-VAALDG-IAELNIGHAIVAQSIFDGWDKA
PDXJ_BORPE      AAVAEGLRH--G--LRVNAGHGLHYGNVQA-VAALDG-IAELNIGHAIVAQSIFDGWDKA
PDXJ_BURL3      AGVQAGAQL--G--LKVNAGHGLHYTNVQQ-IAAIDG-IVELNIGHAIVAHAIFAGWDNA
PDXJ_BURP1      TGVDAGIAL--G--LKVNAGHGLHYTNVQA-IAALPG-IAELNIGHAIVAHAVFVGWDNA
PDXJ_BURMA      TGVDAGIAL--G--LKVNAGHGLHYTNVQA-IAALPG-IAELNIGHAIVAHAVFVGWDNA
PDXJ_BURPS      TGVDAGIAL--G--LKVNAGHGLHYTNVQA-IAALPG-IAELNIGHAIVAHAVFVGWDNA
PDXJ_CUPPJ      DGVDAGIRH--G--LVVNAGHGLHYTNVQP-IAALAG-IKELNIGHAVVAHAVFVGWQNA
PDXJ_RALSO      RAVEEGIRW--G--LRVNAGHGLHYTNVQP-IAAMAG-IHELNIGHAIVAHAVFAGWQNA
PDXJ_THIDA      RAVAYGRSL--G--LTVNAGHGLTYHNVQP-IAALPG-IHELNIGHAIVAQALFVGWKEA
PDXJ_PHOLL      AAATYAASK--G--LTVNAGHGLTYHNVQR-IAALPE-IYELNIGHAIIGRAVFSGLTAA
PDXJ_SALCH      SAATLAARL--G--LKVNAGHGLTYHNVKA-IAALPE-MHELNIGHAIIGRAVMTGLKEA
PDXJ_SALPA      SAATLAARL--G--LKVNAGHGLTYHNVKA-IAALPE-MHELNIGHAIIGRAVMTGLKEA
PDXJ_SALTY      SAATLAARL--G--LKVNAGHGLTYHNVKA-IAALPE-MHELNIGHAIIGRAVMTGLKEA
PDXJ_SALTI      SAATLAARL--G--LKVNAGHGLTYHNVKA-IAALPE-MHELNIGHAIIGRAVMTGLKEA
PDXJ_ECOL6      KAATFATSL--G--LKVNAGHGLTYHNVKA-IAAIPE-MHELNIGHAIIGRAVMTGLKDA
PDXJ_SHIDS      KAATFAASL--G--LKVNAGHGLTYHNVKA-IAAIPE-MHELNIGHAIIGRAVMTGLKDA
PDXJ_ECOLI      KAATFAASL--G--LKVNAGHGLTYHNVKA-IAAIPE-MHELNIGHAIIGRAVMTGLKDA
PDXJ_ECO57      KAATFAASL--G--LKVNAGHGLTYHNVKA-IAAIPE-MHELNIGHAIIGRAVMTGLKDA
PDXJ_SHIBS      KAATFAASL--G--LKVNAGHGLTYHNVKA-IAAIPE-MHELNIGHAIIGRAVMTGLKDA
PDXJ_SHISS      KAATFAASL--G--LKVNAGHGLTYHNVKA-IAAIPE-MHELNIGHAIIGRAVMTGLKDA
PDXJ_PECAS      DAATYAAAK--G--LKVNAGHGLTYHNVLP-IAALPE-MHELNIGHAIIGRAVISGLKDA
PDXJ_YERPE      KAATYAAGK--G--LKVNAGHGLTYHNVQP-IAALPE-MHELNIGHAIIGQAVMTGLAAA
PDXJ_YERPS      KAATYAAGK--G--LKVNAGHGLTYHNVQP-IAALPE-MHELNIGHAIIGQAVMTGLATA
PDXJ_PHOPR      SAATYAHGL--G--IKVNAGHGLTYHNVKP-IAALPE-LYELNIGHSIISRAAFDGLNKA
PDXJ_ALIF1      AGASYAASK--G--LIVNAGHGLTYHNVEA-IAALPE-IYELNIGHSIMGRAMFDGLEKA
PDXJ_VIBPA      AGASYADDL--G--IIVNAGHGLTYHNVAP-IAALPE-IYELNIGHSIIGRAVFDGLEKS
PDXJ_VIBCH      AAAAYAHDL--G--ITVNAGHGLTYHNVAA-IAAIPE-IYELNIGHAIIGRAVFDGLAKA
PDXJ_VIBVU      AGASYAADL--G--ITVNAGHGLTYHNVAP-IAALPE-IYELNIGHAIIGRAVFDGLHKA
PDXJ_VIBVY      AGASYAADL--G--ITVNAGHGLTYHNVAP-IAALPE-IYELNIGHAIIGRAVFDGLHKA
PDXJ_COLP3      VGIKYAHNL--G--LKVNAGHGLNYFNVKP-IAAIKE-IIELNIGHAIIARAAIDGLDKA
PDXJ_PSET1      QGVKYAASI--G--LIVNAGHGLHYHNVKP-IAAMEE-IYELNIGHAIIARAAIDGLDKA
PDXJ_SHEON      EMAKYAHGK--G--LIVNAGHGLHYHNVKP-IAAIPE-LYELNIGHAIVARAAIDGLATA
PDXJ_AROAE      RAGEAIRAL--G--MRFNAGHALNYYNVQP-IARLPE-VRELHIGHAIVSRSVFTGLRDA
PDXJ_DECAR      KAGQTIRHL--G--MRFNAGHALNYYNVQP-LARLAG-IRELHIGHAIVSRAVFVGLREA
PDXJ_PROM9      ESTHLANDL--G--LVVNAGHGLNYNNVKK-IASINN-MNELNIGHSIVARALAIGLEKS
PDXJ_PROMP      ESSYYAVDI--G--LIVNAGHGLNYQNVKK-IASINN-MNELNIGHSIVSRALAVGLERA
PDXJ_PELCD      NAVKAGNKL--G--LLVHAGHGLTYFNIQP-VAAIGG-IREFNIGHSIISRAVLVGMDRA
PDXJ_GEOMG      NAIKLGAKL--G--LGINAGHGLNYTNIRK-VAALGG-IEEYNIGHSIISRAVLVGLDRA
PDXJ_GEOSL      NAIKLGTKL--G--LGINAGHGLNYTNVRK-VAALGG-IEEFNIGHSIISRAVFTGLDRA
PDXJ_PROMT      ESTAKAKSY--G--LRVNAGHGLTYQNVEP-IAAIEG-IEELNIGHTIISRALSVGLSQA
PDXJ_THEEB      DGVQQAKAL--G--LRVNAGHGLTYSNVGA-IARLEG-IEELNIGHTIISRAVLVGMVQA
PDXJ_SYNP6      QGCEQAIAA--G--LRVNAGHGLTYWNVYP-VAQLPG-MEELNIGHTIISRAVLVGLERA
PDXJ_SYNE7      QGCEQAIAA--G--LRVNAGHGLTYWNVYP-VAQLPG-MEELNIGHTIISRAVLVGLERA
PDXJ_NOSS1      AGCEQAIKA--G--LRVNAGHGLTYWNVYP-VAALPG-MEELNIGHTIISRAALVGIERA
PDXJ_TRIV2      TGCEQAIKA--G--LRVNAGHGLTYWNVYP-VAALPG-MEELNIGHTIISRAALVGIERA
PDXJ_SYNY3      IACDIALEL--G--LRINAGHGLTYWNVRP-VAELPG-MEELNIGHSIMSRAILVGMERA
PDXJ_GLOVI      AACDEAQAL--G--LRVNAGHGLTYWNVAP-VARLSG-MEELNIGHSIIARAVLVGLERA
PDXJ_PROMA      EGVARARNL--G--LRVNAGHGLTYQNVEP-IASITE-MEELNIGHTIIARAIAIGLKEA
PDXJ_PROMM      EATARARSL--G--LRVNAGHGLTYQNVEA-VAAIEG-IEELNIGHTIVARSIAVGLKEA
PDXJ_SYNPX      EGAATARHL--G--LRVNAGHGLTYQNVEP-IAAIPG-MEELNIGHTIVARAVAVGLQQA
                              :    ** :           .   :    :*  :   .   *    

PDXJ_RHILO      VGRFLRACGW-----------------
PDXJ_BRUAB      VSRYITALAG-----------------
PDXJ_BRUA2      VSRYITALAG-----------------
PDXJ_BRUME      VSRYITALAG-----------------
PDXJ_BRUSU      VSRYITALAG-----------------
PDXJ_AGRFC      VRRFCQACGQRNS--------------
PDXJ_RHIME      VRRFRRACGETA---------------
PDXJ_XYLFA      VRRYLDILDSVNPAVSMR---------
PDXJ_XYLFT      VRRYLDILDSVNPAVSMR---------
PDXJ_XANCP      VRAYLAIIAGGATTAA-----------
PDXJ_XANC8      VRAYLAIIAGGATTAA-----------
PDXJ_XANOR      VRAYVDILRGSQVGA------------
PDXJ_XANOM      VRAYVDILRGSQVGA------------
PDXJ_XANAC      VRAYVDILRSGHVSA------------
PDXJ_XANC5      VRAYVDILRGSHVSA------------
PDXJ_PORGI      IRQYRDQLAL-----------------
PDXJ_BACFR      IQEYKNCLR------------------
PDXJ_BACFN      IQEYKNCLR------------------
PDXJ_BACTN      IQEYKNCLR------------------
PDXJ_PELUB      ITIFKEITNK-----------------
PDXJ_HELPY      ILEMAQLIKR-----------------
PDXJ_HELPJ      ILEMAQLIKR-----------------
PDXJ_BDEBA      VRKMRKILK------------------
PDXJ_WOLPM      VKTMKMTMSN-----------------
PDXJ_ANAMM      VRNMKKIILEQRHNA------------
PDXJ_EHRCJ      IYKMKQVIASTD---------------
PDXJ_EHRRG      IYKMKKVITNPL---------------
PDXJ_EHRRW      IYKMKKVITNPL---------------
PDXJ_CAMJE      ILEMKELIKR-----------------
PDXJ_CAMJR      ILEMKELIKR-----------------
PDXJ_HELHP      IIQMREAMCQK----------------
PDXJ_SULDN      VKEMKRLTSR-----------------
PDXJ_WOLSU      VREMVELLGRGD---------------
PDXJ_WIGBR      VKEMKDIIYSEKIKWQ-----------
PDXJ_RHOBA      VAEMRRLLDSVTIAAQ-----------
PDXJ_CHLTE      IQEILDLIRR-----------------
PDXJ_CHLCH      VREMVALIR------------------
PDXJ_PELLD      VREMLDLIG------------------
PDXJ_AQUAE      VKEMLNLIKT-----------------
PDXJ_DESAG      VAQMAAIIATFSE--------------
PDXJ_DESVH      VRDMVDIINRFPG--------------
PDXJ_NITWN      VRTMRAAMDRGRATLKTRTA-------
PDXJ_BRADU      VRSMRAAMDRGRSRA------------
PDXJ_RHOPA      VRAMRAAMDRGRAKAIAA---------
PDXJ_GLUOX      VRKMKSLINS-----------------
PDXJ_ZYMMO      IKRMRYLMDAARAEDKVDFLVKHIAL-
PDXJ_CAUVC      IHRMRALMEAARVELEVLA--------
PDXJ_RHORT      IARMRAHMDAALRGGVAA---------
PDXJ_RHOS4      IEGMRRRMDAAREAAA-----------
PDXJ_RUEPO      IAEMRRLMDEARA--------------
PDXJ_BLOFL      IKDMKELLKEFRKKDDQ----------
PDXJ_BLOPB      IQDMKKLIQDSRRG-------------
PDXJ_PSYA2      VIMMKIAMHR-----------------
PDXJ_METCA      VADMVTLLHTARWG-------------
PDXJ_NEIMA      VRQMKEAMFRARLLP------------
PDXJ_NEIMB      VRQMKEAMFRARLLP------------
PDXJ_NEIG1      VRQMKEAMFRARLLP------------
PDXJ_COXBU      VKEMKTLIAGAQ---------------
PDXJ_NITOC      VGEMKRLMREARE--------------
PDXJ_LEGPA      VRHMRQLMQEARLYVND----------
PDXJ_LEGPL      VRHMRQLMQEARLYVND----------
PDXJ_LEGPH      VRHMRQLMQEARLYVND----------
PDXJ_PSEAE      VAEMKALMLAAATKR------------
PDXJ_PSEPK      VAEMKALIVAASR--------------
PDXJ_PSEU2      VAEMKALIVAAAR--------------
PDXJ_PSE14      VAEMKALIVAAAR--------------
PDXJ_PSESM      VAEMKALIVAAAR--------------
PDXJ_PSEPF      VSEMKTLILAAARH-------------
PDXJ_PSEF5      VAEMKALILAAAAKA------------
PDXJ_IDILO      VRDMRNILDKAR---------------
PDXJ_ACIAD      VQHMKAAIQAAR---------------
PDXJ_CHRVO      VREMKALMESARAR-------------
PDXJ_HYDCU      VSEMKRLMVDARQQAYLG---------
PDXJ_NITEU      VREMKALLQQARA--------------
PDXJ_NITMU      VREMKNLMLEACK--------------
PDXJ_BORBR      VRDMKALMVQARLAAVRGHA-------
PDXJ_BORPA      VRDMKALMVQARLAAVRGHA-------
PDXJ_BORPE      VRDMKALMVQARLAAVRGHA-------
PDXJ_BURL3      VREMKAIMVAARVAALHGGAR------
PDXJ_BURP1      VREMKAIMVAARVAALHGGR-------
PDXJ_BURMA      VREMKAIMVAARVAALHGGR-------
PDXJ_BURPS      VREMKAIMVAARVAALHGGR-------
PDXJ_CUPPJ      VREMKAIMVAARLGTRYPAA---GKPA
PDXJ_RALSO      VREMKAIMVAARLSATTPAAAHPGVPA
PDXJ_THIDA      VAEMKRLMVAAAG--------------
PDXJ_PHOLL      VADMKTQMRKARR--------------
PDXJ_SALCH      VAEMKRLMLEARG--------------
PDXJ_SALPA      VAEMKRLMLEARG--------------
PDXJ_SALTY      VAEMKRLMLEARG--------------
PDXJ_SALTI      VAEMKRLMLEARG--------------
PDXJ_ECOL6      VAEMKRLMLEARG--------------
PDXJ_SHIDS      VAEMKRLMLEARG--------------
PDXJ_ECOLI      VAEMKRLMLEARG--------------
PDXJ_ECO57      VAEMKRLMLEARG--------------
PDXJ_SHIBS      VAEMKRLMLEARG--------------
PDXJ_SHISS      VAEMKRLMLEARG--------------
PDXJ_PECAS      VAEMKSLMREARR--------------
PDXJ_YERPE      VTDMKVLMREARR--------------
PDXJ_YERPS      VTDMKVLMREARR--------------
PDXJ_PHOPR      VADMKVEMLDARR--------------
PDXJ_ALIF1      VADMHRIMLGARK--------------
PDXJ_VIBPA      VAEMKALMIAARK--------------
PDXJ_VIBCH      VADMKAIMVAARR--------------
PDXJ_VIBVU      VADMKAIMVAARQ--------------
PDXJ_VIBVY      VADMKAIMVAARQ--------------
PDXJ_COLP3      VRDMKQLMLEARTYNT-----------
PDXJ_PSET1      VRDMKRLMLEARA--------------
PDXJ_SHEON      VKDMKTLMLEGRRGE------------
PDXJ_AROAE      VREMKRLMREAAGVGR-----------
PDXJ_DECAR      VREMKVLMREAAERGE-----------
PDXJ_PROM9      VREMKSLITSN----------------
PDXJ_PROMP      VREMKTLISIN----------------
PDXJ_PELCD      VREMKDLVGGA----------------
PDXJ_GEOMG      VRDMVDLIKYA----------------
PDXJ_GEOSL      VRDMVDLVKYA----------------
PDXJ_PROMT      VKEMKSLIINPRKDNFLL---------
PDXJ_THEEB      VRDMKALISP-----------------
PDXJ_SYNP6      VREMKLAMQGKL---------------
PDXJ_SYNE7      VREMKLAMQGKL---------------
PDXJ_NOSS1      VREMKQAIRGE----------------
PDXJ_TRIV2      VREMKQAIRGE----------------
PDXJ_SYNY3      VREMKLAMLGLPF--------------
PDXJ_GLOVI      VREMKQAMIAG----------------
PDXJ_PROMA      VKEMKELIKNPRHEPFFGS--------
PDXJ_PROMM      VREMKRLVQNPRREPLFG---------
PDXJ_SYNPX      VREMKALIQNPRLDPLFGHALG-----
                :