CLUSTAL format seed alignment for MF_00281

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYFA_CHLMU      --MTIQEELEAVKQQFSCDLSLVHS--SKDLFDLKVKYLGKKGIFRGFADQLRECPV-EQ
SYFA_CHLTR      --MTIQEELEAVKQQFSCDVSLAHS--SKDLFDVKVKYLGKKGIFRGFADQLRKYPI-EQ
SYFA_CHLPN      --MEMKEEIEAVKQQFHSELDQVNS--SQALADLKVRYLGKKGIFRSFSEKLKQCT---D
SYFA_HELPY      ------------MHTLIERLEKVTN--SKELEEARLNALGKKGVFADKFNQLKHLNG-EE
SYFA_HELPJ      ------------MHTLIERLEKVTN--SKELEEARLNALGKKGVFADKFNQLKNLNG-EE
SYFA_CAMJE      ------------MQNFIEQIQKCEN--LNDLEAIRISVLGKKGILTEGFTKLKELED-EA
SYFA_AQUAE      -----MEKLDKILEELKLLLSSVSS--LKELQEVRSKFLGSKGVIKELLKKIKEVPS-EE
SYFA_ECOLI      -----MSHLAELVASAKAAISQASD--VAALDNVRVEYLGKKGHLTLQMTTLRELPP-EE
SYFA_VIBCH      -----MQHLQEIIANATSAINAAES--LVALDEVRVQYLGKKGELTVQLQSLGKLPP-EE
SYFA_HAEIN      -----MQHLNELVEKAKLAIESIQDKSLTALDEIRVEYFGKKGHFTQLMQELRNVSA-EE
SYFA_BUCAI      -----MLNLNKLFEIIEIDIQNSKK--ISELDKIRIKYLGKKGVLTAFMKKLKDFSY-ED
SYFA_NEIMA      -----MENVNRIVAEGIAAVEAAQD--FNALEQIKARYLGKTGELTGLLKTLGQMSP-EE
SYFA_NEIMB      -----MENVNRIVAEGIAAVEAAQD--FNALEQIKARYLGKTGELTGLLKTLGQMSP-EE
SYFA_XYLFA      ---MVINDIESLTDQALADVAAAQN--LDHLEVLRVALLGKNGSITLQLKQLGKLPV-EQ
SYFA_RICPR      -----MKNIETILKLAEEKIVLVHN--LKDLQEYKVEFLGRNGIVTSELKKLGSLINGQK
SYFA_THEMA      ------MEIEAVEKEAIEKLSKISN--VQELESFRIEFLGKKGKITGLMKNLKNLPP-EE
SYFA_MYCTU      --MLSPEALTTAVDAAQQAIALADT--LDVLARVKTEHLGDRSPLALARQALAVLPK-EQ
SYFA_STRCO      ---MKPEEIERMRDEALAAFAAADS--LDALQEAKVAHTGGASPLALANREIGALPP-QA
SYFA_DEIRA      -----------MQDTAIQEIQGAET--LEALQAVKTKYVGKSGLVTKELGSLGKLPP-EE
SYFA_THETH      -----------MLEEALAAIQNARD--LEELKALKARYLGKKGLLTQEMKGLSALPL-EE
SYFA_BACHD      ----MREQLEALRDDAIKKIEQAQE--KKVVQEIRVKYLGKKGPVTEVLRGMGKLSP-EE
SYFA_BACSU      ----MEEKLKQLEQEALEQVEAASS--LKVVNDIRVQYLGKKGPITEVLRGMGKLSA-EE
SYFA_SYNY3      MTISLEADLKSLQQSAQAAISGCDD--LDGLDKLRVQYLGKKGELSLILKGMGKLSA-EE
SYFA_MYCGE      -----MIDQNKLITKWKKAFAKAKN----LTTLVNLKNTLHNSDLKPLLQKIKTATKLSE
SYFA_MYCPN      -----MIDQSKLIERWKTTFETAQN----PTELLAFKNSFRNADLKPLLSQIKETTDIET
SYFA_UREPA      ------MDVINLIKNLKQILRTANN----ERHLIELKNIFVKQHLLPLYDELKKSAN---
                                   .                        .      :        

SYFA_CHLMU      KATIGASINACKQYIEEVLLEKSQVILAKEEAEEFLKEKVDVSLPG-EDAPLGGKHIIKK
SYFA_CHLTR      KATVGASINACKQYVEEVLLERGKAVLAKEEAEEFLKEKIDISLPGSEEAALGGKHVIKK
SYFA_CHLPN      KAKLGSLINDFKTYVEDLLQEKSLVLLASEQAEAFSKEKIDSSLPG-DSQPSGGRHILKS
SYFA_HELPY      KNAFAKEIHHYKQAFEKAFEWKKKAIIELELEERLKKEKIDVSLFN--AIKTSSSHPLNY
SYFA_HELPJ      KNAFAKEIHHYKQAFEKAFELKKKAIMELELEERLKKEKIDVSLFN--AIKTSSSHPLNY
SYFA_CAMJE      KKEFAAKLNAQKEIFNEAYLAKFKDLENLALEERMKQDALNFNYFD-ESITTGALHPVMS
SYFA_AQUAE      RKEYGKRVNLLKEEAEKLIKEKEEELKERELEEKLKGEWVDLSIPP--ARTVGSLHPITV
SYFA_ECOLI      RPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPG-RRIENGGLHPVTR
SYFA_VIBCH      RRTAGQEINVAKEAVQKALAERKDALQSAELEAKLAAETIDVTLPG-RRIENGGLHPVTR
SYFA_HAEIN      RPAMGAKINEAKQAALEFLNAKKTEWEQAELNSKLEKERVDVSLPG-RKVETGGLHPVTM
SYFA_BUCAI      KKKHSIIINKKKQEIISKINIKKQKLSVYILEQRIKSETIDISLPG-RRTEHGGFHPITN
SYFA_NEIMA      RKTIGAHINECKNRFQTAFNAKRDALNEAKLQARLAAEALDITLPG-RAQEGGSLHPVTL
SYFA_NEIMB      RKTIGAHINECKNRFQTAFNAKREALNEVKLQARLAAEALDITLPG-RAQEGGSLHPVTL
SYFA_XYLFA      RKAIGEKVNCVRDLISVALMDRKAALESAALSKRLIDERVDVTLPG-RRGERGGLHPVTR
SYFA_RICPR      RKEFGLKINTLKDKIHDIIKAKAQNLEAEELHLKLAADKIDLTIPA-RRYKQGSIHPITQ
SYFA_THEMA      RPAYGKRVNELREKIEKLFEEKRQQIQRILEQEKMEKMRIDVTVPG-ARRKLGHSHPVLK
SYFA_MYCTU      RAEAGKRVNAARNAAQRSYDERLATLRAERDAAVLVAEGIDVTLPS-TRVPAGARHPIIM
SYFA_STRCO      KAEAGKRVGMARGAVNKALAARQEELEAERDARVLVEEAVDVTLPH-DRVPAGARHPLTT
SYFA_DEIRA      RKACGAEINVVRAAIQAALDEKESALKRAALDAKLASEAIDVTLPG-LPLPAGGLHPISR
SYFA_THETH      RRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPG-ASLFSGGLHPITL
SYFA_BACHD      RPVIGQLANDVREAIGKAIESKMEALEQAEIHRKLQEETIDVTLPG-RPVLKGGAHPLTA
SYFA_BACSU      RPKMGALANEVRERIANAIADKNEKLEEEEMKQKLAGQTIDVTLPG-NPVAVGGRHPLTV
SYFA_SYNY3      RPKFGAIANEVKEALQHDLESRKANLQNAAIEAQLAAETLDVTMAG-SYRPQGRRHPLNS
SYFA_MYCGE      KSSLGKLYQSLDIQLTDLLTSYKKTFEINN--QVSQKPSLDVMLPA-TEFTNGSNNALYQ
SYFA_MYCPN      KRHLGQLYKQLESTLQTLHDTQLQVFTQAQ--SSSVLTHGDVMLLA-TSFAPGSSNIIYQ
SYFA_UREPA      KKEMGLLINNFKQQIEFVTDQILKELNDKDD-QVDLKKWTNKTLFA-PFINNGHHHILNS
                :   .                                   :           .  : :  

SYFA_CHLMU      VLDDVVDIFVRFGFCVREAPNIESEKNNFSLLNFEEDHPARQMQDTFYLDP---------
SYFA_CHLTR      VLDDVVDIFVRFGFCVREAPNIESEKNNFSLLNFEEDHPARQMQDTFYLDP---------
SYFA_CHLPN      ILDDVVDIFVHLGFCVREAPNIESEANNFTLLNFTEDHPARQMHDTFYLNA---------
SYFA_HELPY      TKNKIIEFFTPLGYKLEIGSLVEDDFHNFSALNLPPYHPARDMQDTFYFK----------
SYFA_HELPJ      TKNKIIEFFTPLGYKLEIGSLVEDDFHNFSALNLPPYHPARDMQDTFYFK----------
SYFA_CAMJE      TMDKIIEYFIALNFSIEKGPLIEDDFHNFEALNLPKSHPARDMQDTFYFD----------
SYFA_AQUAE      TLERIVTIFRGMGFEVEEGPEVEREEYNFDMLNIPKEHPARDMQDTFYVNR---------
SYFA_ECOLI      TIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDT---------
SYFA_VIBCH      TIERIESFFGELGFTVESGPEIEDDFHNFDALNIAADHPARTDHDTFFFNP---------
SYFA_HAEIN      TINRVTKFFSELGFSVENGPEIESDYYNFDALNIPKHHPARADHDTFWFNP---------
SYFA_BUCAI      TIDYIKNFFLKLGFQSINSPEIEDEYHNFDALNISKYHPARDSHDTFWFDR---------
SYFA_NEIMA      TLQRVVELFHGMGFEVADGPEIEDDFHNFQALNIPANHPARAMQDTFYVEN---------
SYFA_NEIMB      TLQRVVELFHGMGFEVADGPEIEDDFHNFQALNIPANHPARAMQDTFYVEN---------
SYFA_XYLFA      TLERITEIFARLGYELVEGPEIEDDWHNFEALNFPLHHPARAMHDTFYFGD---------
SYFA_RICPR      CMDELIQVFSQFGFTIENGPNIENDFYNFTALNFEYDHPARQMHDTFYLKG---------
SYFA_THEMA      VMEEIERIFVSMGFDVVEGPEIETTWHNFDALNTPEWHPARDEHDSFYITD---------
SYFA_MYCTU      LAEHVADTFIAMGWELAEGPEVETEQFNFDALNFPADHPARGEQDTFYI--------APE
SYFA_STRCO      LSERIEDIFVAMGYEVAEGPEAEAEWFNFDALNIGPDHPARGEADTFFVQ-------GPE
SYFA_DEIRA      VLDDLIGIYRQMGYAVIEGPEVEEEHYNFEALNVPWYHPARDLQDTFWLE----------
SYFA_THETH      MERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGPL
SYFA_BACHD      TITEVEDLFIGLGFSVAEGPQIETDYYNFEALNLPKDHPARDMQDSFYFT----------
SYFA_BACSU      VIEEIEDLFIGMGYTVEEGPEVETDYYNFESLNLPKEHPARDMQDSFYIT----------
SYFA_SYNY3      TVDRVLDIFVGLGYTVATGPQVETDYYNFEALNIPADHPARDMQDTFFLK----------
SYFA_MYCGE      VIDNLVEYFKSFLFTINFDSELTSISDCFDLLNIPKDHSSRNESDSFYIDK---------
SYFA_MYCPN      VIDELVNYFKKFLFTVNYDSELTTIADCFDLLNIPKDHPSRNLTDTFYLDK---------
SYFA_UREPA      IIDDIASFFKKLNFEIVSGSEVVSPIYNFDHLNIDENHPARASADSFFINS---------
                    :   :  : :     .        *  **    *.:*   *:*:.           

SYFA_CHLMU      ---------VTVLRTHTSNVQSRELA-RN--KP-PVRVVAPGECFRNEDISARSHVTFHQ
SYFA_CHLTR      ---------TTVLRTHTSNVQSRELA-RN--KP-PVRIVAPGECFRNEDVSARSHVIFHQ
SYFA_CHLPN      ---------TTVLRTHTSNVQARELK-KQ--QP-PIKVVAPGLCFRNEDISARSHVLFHQ
SYFA_HELPY      ----DH----KLLRTHTSPVQIHTMQ-EQ--TP-PIKMICLGETFRRD-YDLTHTPMFHQ
SYFA_HELPJ      ----DH----KLLRTHTSPVQIHTMQ-EQ--TP-PIKMICLGETFRCD-YDLTHTPMFHQ
SYFA_CAMJE      ----DK----RLLRTQTSPVQIRTML-AQ--KP-PIRMIAPGAVFRRD-FDITHTPMFHQ
SYFA_AQUAE      ----EG----YLLRTHTSPVQIRTML-KK--KP-PIQIIAPGKVYRRD-DDPTHSPMFHQ
SYFA_ECOLI      ----TR-----LLRTQTSGVQIRTMK-AQ--QP-PIRIIAPGRVYRND-YDQTHTPMFHQ
SYFA_VIBCH      ----KL-----MLRTHTSGVQIRTLE-ER--QP-PLRFIAPGRVYRND-YDQTHTPMFHQ
SYFA_HAEIN      ----EL-----LLRTQTSGVQIRTME-KM--QP-PIRIMAPGRVYRND-YDQTHTPMFHQ
SYFA_BUCAI      ----NR-----LLRTQTSSMQIRIMK-QE--KP-PIRFIFPGKVYRND-YDITHTPMFHQ
SYFA_NEIMA      ----GD-----VLRTHTSPIQIRYMLDKK--EP-PVRIIAPGRVYRVD-SDATHSPMFHQ
SYFA_NEIMB      ----GD-----VLRTHTSPIQIRYMLDKK--EP-PIRIIAPGRVYRVD-SDATHSPMFHQ
SYFA_XYLFA      ----GR-----LLRTHTSGVQVRYMS-DH--RP-PLRMIAAGKVYRSD-SDQTHSPMFHQ
SYFA_RICPR      ----HENDKPLLLRTHTSTVQIRAMK-NG--KP-PFRFIAPGRTYRSD-SDMTHTPMFHQ
SYFA_THEMA      ----DL-----LLRTHTSPVQIRTML-ER--KP-PIAIISPGKVYRRD-YDATHLPMFHQ
SYFA_MYCTU      ----DSRQ---LLRTHTSPVQIRTLLARE--L--PVYIISIGRTFRTDELDATHTPIFHQ
SYFA_STRCO      GG-AESGV---VLRTHTSPVQIRSALTRE--L--PVYVICPGRVYRTDELDATHTPVFHQ
SYFA_DEIRA      ----DGR----LLRTHTSPMQIRYMVDHE--P--PFKIVVRGKVYRYEATDATHEAMFHQ
SYFA_THETH      GEEVEGRL---LLRTHTSPMQVRYMVAHT--P--PFRIVVPGRVFRFEQTDATHEAVFHQ
SYFA_BACHD      ----DEL----LLRTQTSPVQARTMEKYK--GKGPIKIICPGKVFRRDDDDATHSHQFMQ
SYFA_BACSU      ----EET----LMRTQTSPVQTRTMEKHE--GKGPVKIICPGKVYRRDNDDATHSHQFMQ
SYFA_SYNY3      ----DGR----LLRTHTSPVQIRYMEKHD--P--PIRIVAPGRVYRRDTVDATHSAVFHQ
SYFA_MYCGE      ---------TSLLRTHCTATTLKAVRTSKKTNNPDIRVVSLGAVFRNDSDDATHSHQFTQ
SYFA_MYCPN      ---------NRLLRTHCTAATLRAVKETKKSNNPDIRIASFGAVFRKDDDDATHSHQFNQ
SYFA_UREPA      ---------IKMLRTHCTTTTAQFLENNV--NK-DIRIMSFGNVYRKDDDDATHSHQFNQ
                           ::**: :    :            . .   *  :* :  .      * *

SYFA_CHLMU      VEAFHVDR--DVSFSDLTSMLSGFYHIFFG-RKVELRYRHSYFPFVEPGIEVDISCECRG
SYFA_CHLTR      VEAFCVDK--DISFSDLTSMLAGFYHIFFG-RKVELRFRHSYFPFVEPGIEVDISCECHG
SYFA_CHLPN      VEAFYVDH--NVTFSDLTAILSAFYHSFFQ-RKTELRFRHSYFPFVEPGIEVDVSCECCG
SYFA_HELPY      IEGLVVDQKGNIRFTHLKGVIEDFLHYFFG--GVKLRWRSSFFPFTEPSAEVDISCVFCK
SYFA_HELPJ      IEGLVVDQKGNIRFTHLKGVIEDFLHYFFG--GVKLRWRSSFFPFTEPSAEVDISCVFCK
SYFA_CAMJE      VEGLVVEEGQKVSFANLKSVLEDFLRYMFG--DVKVRFRPSFFPFTEPSAEVDISCVFCK
SYFA_AQUAE      VEGLVVNE--YANFRHMKYVIEEFLKKFFET-DLPVRFRTSYFPFTEPSAEVDIGCVICH
SYFA_ECOLI      MEGLIVDT--NISFTNLKGTLHDFLRNFFE-EDLQIRFRPSYFPFTEPSAEVDVMGKNG-
SYFA_VIBCH      VEGMLVDE--NVNFAQLKGILHDFLCNFFE-EDLEVRFRPSYFPFTEPSAEVDVKGKNG-
SYFA_HAEIN      IELLYVDK--KANFTELKGLLHDFLRAFFE-EDLQVRFRPSYFPFTEPSAEVDVMGKNG-
SYFA_BUCAI      IEGLIVDK--NINFSNLKWIIYKFLYDFFG-KEVLIKFRPSYFPFTVPSAEVDIIDHNG-
SYFA_NEIMA      AEGLWVEE--GVTFADLKAVFTDFIRRFFERDDLQVRFRPSFFPFTEPSAEIDIMGENG-
SYFA_NEIMB      AEGLWVEE--GVTFADLKAVFTDFIRRFFERDDLQVRFRPSFFPFTEPSAEIDIMGENG-
SYFA_XYLFA      IEGLLIDK--HATFVHLKGTLSEFLRAFFE-RDFEVRFRPSYFPFVEPGAEVDIAWQQSD
SYFA_RICPR      IEGLVIDK--NINMGHLKYVIITFIRSFFENSNIELRFRPSFFPFTEPSAEVDIRMNKND
SYFA_THEMA      VEGLHVDR--DLSVAHLKFTLEEFARRMFG-EGAKVRLRPSFFPFTEPSFEVDVYLSGY-
SYFA_MYCTU      VEGLAVDR--GLSMAHLRGTLDAFARAEFG-PSARTRIRPHFFPFTEPSAEVDVWFANKI
SYFA_STRCO      VELLAVDE--GLTMADLKGTLDHMVQSLFG-AEMKTRLRPNFFPFTEPSAEMDMLCYVCK
SYFA_DEIRA      LEGLVVGD--GISMSDLKGTIAEMARGLYG-ASAKARFQPSYYPFVEPGADFAVYWENPR
SYFA_THETH      LEGLVVGE--GIAMAHLKGAIYELAQALFG-PDSKVRFQPVYFPFVEPGAQFAVWW--PE
SYFA_BACHD      IEGLYVDH--GVRMSDLKGVLQAFAKSFFG-EERSIRLRPSFFPFTEPSVEVDVSCGICH
SYFA_BACSU      IEGLVVDK--NISMSDLKGTLELVAKKMFG-QDREIRLRPSFFPFTEPSVEVDVTCFKCG
SYFA_SYNY3      VELLAIDK--GLAFTHLKGTIQAFIKQMFG-EALPIRFRASYFPFTEPSAEVDVQW----
SYFA_MYCGE      LDFMWIKK--GLSLANLKWFINNMITHFFG-ENTFTRFRLSHFPFTEPSFEIDIRCWLCQ
SYFA_MYCPN      LDFMWIKK--DFSLTNLKWFMQNMINHIFG-ENTSARFRLSHFPFTEPSFEIDIRCWLCQ
SYFA_UREPA      VDFVWVKE--GLTVANLKWLIDSLIKYLFG-QNLKTRYRLSFFPFTEPSFEVDVQCFKCD
                 : . :       . .:   :  .    :       : :  .:**. *. :. :      

SYFA_CHLMU      AGCS--------LCKHSGWLEVAGAGMIHPNVLRQANIDPEEY---------SGYALGMG
SYFA_CHLTR      AGCS--------LCKHAGWLEVAGAGMIHPNVLRKASIDPEEY---------SGYALGMG
SYFA_CHLPN      KGCA--------LCKHTGWLEVAGAGMIHPQVLRNGNVDPEIY---------SGYAVGMG
SYFA_HELPY      QEGC-------RVCSHTGWLEVLGCGMVNNAVFEAIGYEN--V---------SGFAFGMG
SYFA_HELPJ      QEGC-------RVCSHTGWLEVLGCGMVNNAVFEAIGYEN--V---------SGFAFGMG
SYFA_CAMJE      GKGC-------RVCKHTGWLEVLGCGIVDPNVYNFVGYEN--V---------SGYAFGLG
SYFA_AQUAE      QEGC-------RVCKHTGWLEVMGCGMVHPKVLENCGIDTDFY---------QGFAFGMG
SYFA_ECOLI      -----------------KWLEVLGCGMVHPNVLRNVGIDPEVY---------SGFAFGMG
SYFA_VIBCH      -----------------KWLEVLGCGMVHPNVLRSVGIDPEKY---------SGFAFGMG
SYFA_HAEIN      -----------------KWLEVLGCGMVHPNVLRNVGIDPNEY---------SGFAVGMG
SYFA_BUCAI      -----------------KSLEILGCGMVHPNVLKNVNIDSKIY---------SACAFGLG
SYFA_NEIMA      -----------------KWLEVGGCGMVHPNVLKNVNIDPEKY---------TGFAFGIG
SYFA_NEIMB      -----------------KWLEVGGCGMVHPNVLKNVNIDPEKY---------TGFAFGIG
SYFA_XYLFA      S--------------SVRWLEVLGCGMVHPNVLKNVGIDSECY---------TGFAFGLG
SYFA_RICPR      -----------------KWLEVLGCGMVHPNVLKNIDINRSEY---------QGFAFGLG
SYFA_THEMA      -----------------GWLEILGAGMVDPNVFLNVGYDPEEW---------TGYAFGMG
SYFA_MYCTU      GGAA--------------WVEWGGCGMVHPNVLRATGIDPDLY---------SGFAFGMG
SYFA_STRCO      GASVGNPDRPCRTCSSEGWIELGGCGMVNPRVLTACGIDPEKY---------SGFAFGFG
SYFA_DEIRA      GESK--------------WLELGGCGMVHPNVFKAVDDLREAAGKDRVYEGKTGFAFGLG
SYFA_THETH      G-GK--------------WLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFGLG
SYFA_BACHD      GDGC-------RVCKQTGWIEILGAGMVHPRVLEMSGFNPNEY---------SGFAFGMG
SYFA_BACSU      GNGC-------SVCKGTGWIEILGAGMVHPNVLKMAGFDPKEY---------QGFAFGMG
SYFA_SYNY3      ---------------QGKWLEVMGCGMVDPNVMEAVGYDPEVY---------TGFAAGFG
SYFA_MYCGE      --------NGCSICKQTKWIEILGAGIIHPQVMNNMGIGDTEN--------ITGIAAGIG
SYFA_MYCPN      --------NGCGVCKKTRWIEVLGAGILHPQVMANMGFSDTDN--------IRGIAAGIG
SYFA_UREPA      L-------KGCAVCKKSTWIEIMGTGMLHENVLKAANINDIR----------TGMAFGVG
                                   :*  * *::.  *    .                . * *.*

SYFA_CHLMU      IERLAMLKYGISDIRLFSENDLRFLRQFS---------------
SYFA_CHLTR      IERLAMLKYGISDIRLFSENDLRFLRQFS---------------
SYFA_CHLPN      IERLAMLKYGVSDIRLFSENDLRFLQQFS---------------
SYFA_HELPY      IERLAMLTCQINDLRSFFETDLRVLESF----------------
SYFA_HELPJ      IERLAMLTCQINDLRSFFETDLRVLESF----------------
SYFA_CAMJE      VERFAMLLHQIPDLRSLFEGDLRLLEQFR---------------
SYFA_AQUAE      VERLAMLLFGIDNIKLFYENDLRFIKQFF---------------
SYFA_ECOLI      MERLTMLRYGVTDLRSFFENDLRFLKQFK---------------
SYFA_VIBCH      VERLTMLRYGVNDLRAFFENDLRFLKQFK---------------
SYFA_HAEIN      VERLTMLRYNVTDLRSFFENDLRFLKQFK---------------
SYFA_BUCAI      IERIAMLRYGITDIRSFFENDIRFLKQFKYN-------------
SYFA_NEIMA      LDRFAMLRYNVNDLRLFFDNDLNFLKQFVK--------------
SYFA_NEIMB      LDRFAMLRYNVNDLRLFFDNDLNFLKQFAK--------------
SYFA_XYLFA      VERFAMLRYGVDDLRAFFENDVRFLRQFS---------------
SYFA_RICPR      VERFAMLKYNIKDLRRFFEGDIRWLKHYNFESFDIPNLAGGLTK
SYFA_THEMA      VERIAMLKYGIADIREFVRNDVRFLSSY----------------
SYFA_MYCTU      LERTLQFRNGIPDMRDMVEGDVRFSLPFGVGA------------
SYFA_STRCO      IERMLMFRHNVEDMRDMVEGDVRFTRPFGMEI------------
SYFA_DEIRA      LERIAMLKYGIPDIRYFYANDPRVIGQFRGELG-----------
SYFA_THETH      VERLAMLRYGIPDIRYFFGGRLKFLEQFKGVL------------
SYFA_BACHD      VERLSMLKYGIDDIRHFYTNDRRFLAQFKRV-------------
SYFA_BACSU      VERIAMLKYGIDDIRHFYTNDVRFISQFKQA-------------
SYFA_SYNY3      VERFAMVLHQIDDIRRLYNSDLRFLRQF----------------
SYFA_MYCGE      IERLAMLKYGIDDIRDFYDNNFKFLTQFTD--------------
SYFA_MYCPN      IERLVMLKHGISDIRDLYDNNFKFLAQFTD--------------
SYFA_UREPA      IDRIAMLKYEIDDIRYLYSNNFKFNAQIK---------------
                ::*   .   : ::: :     .