CLUSTAL format seed alignment for MF_00282

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYFA_THEAC      --------MHIPIPMVQISEAEYRVLRAIQSR--GATAIESELSVEGLSDREIASAISWL
SYFA_THEVO      --------------MSEISKNEALILKYLASK--NQEIEESNIEIKGLSRQDIASATSWL
SYFA_SACS2      -------------MISMLSENEAKILFFLKDL--KKTNSVELAIKMGIPESSVLSLIELL
SYFA_SULTO      ----------------MLSENEIKILEYLSKK--REASAEDISKQLNIPIESVFSISQLL
SYFA_AERPE      -------------MEVTLSQGEYRLLKLMAERGFREGTLEEASKILGVDKSSLASLSNLL
SYFA_PYRAE      --------------MLVLPLPLYEIIRHAPEW----KPLEEVARELGSSVDSLMRYVEEG
SYFA_METJA      ---------------MELHIDEKRLLKIFQDN--NRDEFNLNELEKFMPKEKILRVSLWL
SYFA_METAC      -----------MSAQDNLTINEKKVLLALEELGS--AAPDKLEEKSGLQVDAAMQAAFML
SYFA_METMA      --------MTVMSIQDNLTINEKKVLLALEELRS--AVPDKLEEKSGLQIDAAMQAAFML
SYFA_ARCFU      ----------------MLSKIELMLLRSLETGKT--YTPEEAAELSGLSKDAVLKAAYML
SYFA_METKA      --------MDPRELAERLTERDLRILIHLAESGE--ATPEELAESLDVDLGPVMRSLYWL
SYFA_METTH      -------MMDLDRIIDQLHIYEKKVLKAFEGSDKP-LKPEEIAESQKIDIKSVMSASGAL
SYFA_PYRAB      ---------------MTLGYNEKLVLLTIAKL--EKASVEEIVKETRLDQVAVMRAILTL
SYFA_PYRFU      ----------------MLGYNEKLVLLKLNEV--KKARIEELVKLTGLEQVAIMRALLTL
SYFA_PYRHO      ---------------MRLGYNEKLVLLKLAEL--KNATVEELIEKTNLDQVAVMRALLTL
SYFA_BORBU      -MKVIFMKADLN-LIKTLHPLEIKVIVNNEEE--DDISASIIIEKLGFNEGQANKTIEWL
SYFA_TREPA      MMPRMTGKADLNTLVHKLHPLEIKVLKNCAMD--EILSTSLLISRLGFKEGHANQAFSWL
SYFA_HALSA      ---------------MQLPTQQVAVLDAASTD--DPQRIEALAADTDYPPETIAGAALAL
                                 :      ::                                  

SYFA_THEAC      EVKGLLDVE-RREIKTYALSSEGKRYLREGLPELVLYRKLKER-G--E------------
SYFA_THEVO      QVKGLIDVK-TREEVAYVLTDEGKRYAENGLPELRAYSILKRK-G--K------------
SYFA_SACS2      REKGYVKTE-VKSEKHYVLTEEGRKRKESGLPEDILINTLNGQ----E------------
SYFA_SULTO      KEKGYIEVE-EKKVIKYELTDEGKRRLKEGFPEEKLVKLLDGK----E------------
SYFA_AERPE      AEKGVVEVE-ERVEEHYVLTERGRDALERGLPEEKLVLFLAGRGG--E------------
SYFA_PYRAE      RAKGVLRVE-RKVIEFYELTEEGRQRAAEGLPEYKLLKSAVCREGRCT------------
SYFA_METJA      KGKNLVETE-EKVKKIIKLIKE------EEFPERKIANYLKQHNIKEI------------
SYFA_METAC      QEKGLASVS-EKVLERYSLTKEGEEYTKTGLPERQIIDALKAPA----------------
SYFA_METMA      QEKELASVS-EKVLERYSLTKEGEEYKKTGLPERQIIDALKNPV----------------
SYFA_ARCFU      QERGYVRVI-ENVRTHYSLTEEGERYLKEGLPEEKLYSLVKSGVN---------------
SYFA_METKA      EERGLIESE-EETHEVYELGDEGKEYAEEGLPELRIVEVLRKIGG--E------------
SYFA_METTH      ESRGFVRVM-KDADEVVSLTEDGESCAREGLPERRLIEALKGEE---E------------
SYFA_PYRAB      EKEGLIKLH-ERKEKIIVLTDIGKEYSKIGLPEIRALRVLREKK---K------------
SYFA_PYRFU      EKEGLAKIS-ERKERIIRLTDLGRKYIQMGLPEIRALNVLKSKK---K------------
SYFA_PYRHO      QSQGLAKVH-EERRRMIKLTETGKRYIEIGLPEIRALKILKEKG---K------------
SYFA_BORBU      NSKGIIEEIYRKLNVFYKATERGLGALRDGFVEEKIINLVSQKAVLAS------------
SYFA_TREPA      RAKRIIEEHQREQMRSFELTPCGYAAASDGTAEERMLTFLSSPPSLTAIADAAEHLHPRP
SYFA_HALSA      EAEGLVAVT-ETTTTTVSLTDEGHAYATDGLPEVRLYRAALDAGADDA-----------P
                  .                             *                           

SYFA_THEAC      -----MTMDEIRDLMP---DTYRIALAQLAKFGITPKEGK--------------LIYRNS
SYFA_THEVO      -----LSLRDLQEAMP---DEYKIVLAQLAKFGITPKNGV--------------LEYSDG
SYFA_SACS2      -----KDLNEIKNILN---KDFNIAISWAKRKG-LIDIKE--------------GKVIPK
SYFA_SULTO      -----KKIHELKDKLG---RDFEISIGWAKRKG-LVKIDG--------------DTVIPL
SYFA_AERPE      -----ASVEEVRRALG---EEAGIALGQAARKG-LVVIAG--------------GVVRLA
SYFA_PYRAE      -----AHLSQHPEAQI---ALANLAKLGVKPRGNVVELDE--------------ETYKKI
SYFA_METJA      -----EIKNLKDILPK---EEINAALGAIKRKG-IARIEK--------------GKIIFD
SYFA_METAC      ------PLEELRSRFSP--KTVGIATGWLIKKG-WAKVEN----GVMVPSGNAPAGRDEE
SYFA_METMA      ------SLEELRSCFSP--QTVGIATGWLVKKG-WAKVEN----GIMVPSGEASEGKDEK
SYFA_ARCFU      ------SMDELRKRMG---REFQIALGWLRRKG-AVEVEG----DKVVP-------KREP
SYFA_METKA      -----GRLEEVLDRAGVPRKLAGPVLGWLRRKG-LAEIKREDGETSLVLLEEEPEDVDQS
SYFA_METTH      -----LEMSELSRRAGLDKKEAGIGIGWLMRKG-WGRISQ--GMVSAVSDETPERGADER
SYFA_PYRAB      -----AYLDELKDVLRE--DELKAIVGILRREG-LANVRK--------DEKGLVLEITEK
SYFA_PYRFU      -----VKLDELRGVLTE--DELKPIVGILRKEG-WVKVEK--------TPEGLVLEITER
SYFA_PYRHO      -----VTLNDLKDVLSD--EELKAIVGVLRKEG-WAEVSK--------TKEGLTLKLSEK
SYFA_BORBU      ---------NLALELDIDVKEVRKAFGNLLKEGILSLDLD-----------KQIIINCLD
SYFA_TREPA      PLCNGLSLPELAHALTLAPKDVGSAFGILAQEGILRMDGE-----------KRIHIVSPH
SYFA_HALSA      -----VEMGSVIGAAGLDGPQVDIALSNYARKGYGTIDSG--------------ALAADP
                                                *                           

SYFA_THEAC      GIEAAIEERQRFLQSMD----------------------PKNTAMIDHFRHRS-------
SYFA_THEVO      HIEAEISRRQRFLSDLN----------------------TDDQEMIEHFKRRK-------
SYFA_SACS2      VKTYMSSEYL-ALSNL----------------------ERADSNTINLLKKR--------
SYFA_SULTO      VKDYEAKEEKEALINP----------------------EKANKDILQQLLNR--------
SYFA_AERPE      VDQAEALKTITPLKKLLENV-------------ASGSKPTVGDELLREALSR--------
SYFA_PYRAE      VAMLEEKQK--ALAAP----------------------HSAPPEVLKEFIKR--------
SYFA_METJA      NLDYKDVEEQ-LLQKIKENK-------------YLDDFSEEEKKIIDILKKR--------
SYFA_METAC      VLAAFAGK-AKTLEELA--------------------ADE---GTVKELLKRK-------
SYFA_METMA      ALSAFAGK-AKTLEELG--------------------ADE---GTVKDLLKRK-------
SYFA_ARCFU      SFDERAAL-QAIKEGRG--------------------VDE---GTLKTLMKRK-------
SYFA_METKA      VLEALAAEGSASVEELARK---------------LEMDEEEVEKALKRLSERG-------
SYFA_METTH      LLELLLERGSVRIRELP---------------------DE-LRGALKDLKGRK-------
SYFA_PYRAB      GEKLGERPIDIALKLLSEKG-------------EVSVDEISRIIDVKDLKRR--------
SYFA_PYRFU      GENPEERPIDKALKILSEKE-------------YATSEEISKIVPINELKRR--------
SYFA_PYRHO      GKKAEKRAIDIALEVLS-KG-------------EVSVEEIEKIISVKELKRR--------
SYFA_BORBU      GTETNYQKVRVLLERAKNSD------------LLRESLTTEELLLISNFAKKKGADSVFF
SYFA_TREPA      VSDRMSLTRTLLQRAAARVASPSEASDTPPGTLFESELSDDERRVMERIAKKRGASDSLF
SYFA_HALSA      DADPENDPEADALATLTDG------------------DSVDDDAVVDQLASR--------
                                                             :     :        

SYFA_THEAC      GVIDEKIRTERIVRLNDSAYEAIAEFGG-EGLI--GSLDPSIIASGEWKTKNFRKYDLNS
SYFA_THEVO      NVIEEKKRSVRIVSINSKGLEQLNNFDQ-FEAI--GEIDSGIITSQAWKTAPFRKYDLDA
SYFA_SACS2      GLIEEKERKIVSVELIKEPKES-------EIGI--SNLNRELIISGEWKKYKLKKYNVEA
SYFA_SULTO      KLLIKKEEKILNIRLIREPLEI-------KPAL--IFLTPELLASGEWKKYALREYNVEA
SYFA_AERPE      GLIRREARRSIVLRLKVNPAEALARA---RVEA--AVLTRDMLKSGEWRRLRFKPYNVKA
SYFA_PYRAE      KLVRKIEKTQVYVKAAV-PLELV-KP---AEVK--TVITSEDIATGRWRNYTLKPFDLNI
SYFA_METJA      GYVDFDEEKEIKIKLTEKGKEFIKNPIEIEEEI--TQLTRDIIISGKWKKAYIRPYDVKV
SYFA_METAC      -LVIKHEEKSRTVSVTGAGSALAAEGIVLEEEI--AQLTPELLKSGAWKGKKFRPYRLDI
SYFA_METMA      -LVVKHEEKFRTVSITDAGSELASQGLVLEEEI--AQLTPELLKSGAWKEKKFRPYRLDI
SYFA_ARCFU      -LVTKSETKQVYIEVMK------KPEIELEDII--TDLTPEMLLEGTWRGKQFLKYDITI
SYFA_METKA      DVLRAREETVKKVRLTERGEEVAEHAPEVLERDWITELKPEHLREGTWKEKEFKPYDVKA
SYFA_METTH      GIVDIRKIKRHTIELTTEGRKLLERGIEIVEEA--TQVTHEHLKSGAWRKLHYRGYNIDA
SYFA_PYRAB      KIAREDERVERTVEITEKGKKLVSKGIELKREV--TRLTPELIASGKWREVELKPFNIKA
SYFA_PYRFU      KVAQEEEVVERIAEITEKGVELVKKGIELKREV--TSLTPELIASGKWREVEFKPFNIKA
SYFA_PYRHO      KIAEEEEKVIRNVEITDKGLELVEKGIELKREV--SILTPELIVTGKWREVEFKPFNIKA
SYFA_BORBU      KIIEKLDLKFRLSSFGLEVKNFLMKSKLTGDEL--TKLTPEILKNKTYENKKFRAYNIHI
SYFA_TREPA      KVSVRERVTFTFTPTARAVQEALHTAGLTGNEI--GALTVECLKSGAWKTQHLRRYNVHI
SYFA_HALSA      DLVTVSERTVRSVTLTEAGVTELMAGVEATDEV--GELTPELLASGEWADVEFADYNVAA
                                                     :    :    :       : :  

SYFA_THEAC      PSSVIRSSLKHPMTYLIEEIREIFLNMGFTEMG-GHYIESTLWDMDSLFIPQDHPARDMQ
SYFA_THEVO      PVSPTKSYAKHPLVYFINEIRRIFLDMGFTEMS-GHYIESALWDMDALFIPQDHPARDMQ
SYFA_SACS2      FPPYYTISKKHYFREFLEKVKDIMISLGFKEIN-TGYIEMEFYNFDLLFQPQDHPAREIH
SYFA_SULTO      YPPFYPIGKKHFFKEFLERLRDLMRDLGFKEVY-SDYVEIEFYNFDLLFQAQDHPAREIH
SYFA_AERPE      EPPRVLPARRHFLAEFIERLRDILRELGFREVR-GPLVELELFNFDVLFQAQDHPAREIH
SYFA_PYRAE      EPPEYPAPVPHFFNEFLDYVREVMIGLGFEEVR-GPVLEVEFWNFDALFQAQDHPAREVH
SYFA_METJA      PTKPIYPAKVHPLTRIIREVKEILLAMGFKEVK-SPIVETEFWNFDMLFEPQDHPAREMQ
SYFA_METAC      APNPLYGVKIHPYRRLIEQMRQIFLEMGFTEIK-GGIIQSSFWNFDALFQPQDHPARDMQ
SYFA_METMA      TPKPLYGTKIHPYRRLIEQMRQIFLEMGFTEIK-GGIIQSSFWNFDALFQPQDHPARDMQ
SYFA_ARCFU      PAKEIYGGKIHPYERIIEECRKVFLEMGFTEIK-GHYVQPAFWNFDALFQPQDHPARDMQ
SYFA_METKA      PTSPTFPGKRHPLKEVINEIRRIFLEMGFVEVS-GPLVESSFWNFDALFQPQDHAAREMQ
SYFA_METTH      EYPLVYPGKMHPLRRIIDEIRSIFLKLGFTESR-GPIVESAFWNFDCLFQPQDHAAREMQ
SYFA_PYRAB      PVKRIYPGKKQPYRVFLDKIRRRLIEMGFIEMTVDSLIETQFWNFDALFQPQNHPAREWT
SYFA_PYRFU      PVKKIYPGKKQPYRVFLDKIRRKLIEMGFIEITVDSLIETQFWNFDALFQPQNHPAREWT
SYFA_PYRHO      PVKKIYPGKKQPYRVFLDKIRRRLIEMGFIEMTVDSLIETQFWNFDALFQPQNHPAREWT
SYFA_BORBU      PSAKTFIGRANSYLDYISKIKDKLVGLGFQEFD-GPLVETEFFNNDALFMPQFHPSRDIK
SYFA_TREPA      PPARIIPGRSNAYADFLEHIKDRLVALGFQEFD-GPLVETDFWNADALFMPQFHPARDIH
SYFA_HALSA      DAADHTPGKTHVLRQAAERVTDVLVGMGFQEMA-GPHVDADFYINDCLFMPQDHPARNHW
                          :            :  :** *      ::  ::  * ** .* *.:*:  

SYFA_THEAC      DTFYVEA---DSFDIDHPEISKKIRKIHEKGF-DGYSGWGYRWSDAEARKLVLRTHTTVS
SYFA_THEVO      DTFYVKD---SNFTIEHPEIEKRIKRIHERGF-DGYSGWGYRWSSDDGKKLILRTHTTVT
SYFA_SACS2      DSFSVEG--SGKIED--KDLLNNVKEIHEKF-------WKYEWKQDITLRLMLRSQTTAT
SYFA_SULTO      DSFAISG--KGKLTD--EKLIQRVKQIHERG-------WKYNWDVNISMRLMLRSQTTAT
SYFA_AERPE      DSLWIKSPRRGDLSGY-SDLVERVASVHERG-------WKYRWSPEVASRYILRSQTTAV
SYFA_PYRAE      DTFYVQW--SGPLETPPEHLMESVGRVHEEK-------WRYKWDRKKALNPVLRTQTTAT
SYFA_METJA      DTFFLKYPNEGDIPE---DLLSKVKEVHERC-------WKYKFDENVSRRLILRTHTTAS
SYFA_METAC      DTFHLGSICQLPA-----EYSDKVAAMHESGGDIDSCGWGGIWDRELARRNVLRTHTTSV
SYFA_METMA      DTFHLGSTCQIPA-----EYSGKVAAMHENGGDIDSCGWGGIWDRELAGRNVLRTHTTSV
SYFA_ARCFU      DTFYLDRYIDLEG-----EIVERVKATHENGWITGSTGWGGEWSLEKARQLVLRTHTTAI
SYFA_METKA      DTFYLKEPAEAELPD--EEVVEKVRAVHEDGGDTGSRGWGYEWDEGVARKTVLRTHTTAV
SYFA_METTH      DTFYVKNPAVTDLPC--EDLVRAVQDAHETGGSTGSEGWQYEWDRDVARQSVLRTHTTCV
SYFA_PYRAB      DTYQLKYPEKGYLPD--ESLVSRVKEAHERGLAG-SRGWGYVWSPERAMLLMPRAHATAL
SYFA_PYRFU      DTYQLKYPEKGYLPN--RELVERVKEAHERGLAG-SRGWGYVWSPERAMFLMPRAHATAL
SYFA_PYRHO      DTYQLKYPEKGYLPD--ENLVSKVKEAHERGLAG-SRGWGYVWSPERAMLLMPRAHATAL
SYFA_BORBU      DVYYISDP--SMQESLPEPYFSNVKLAHETGYATGSRGWRYSFSEDLSKRLVLRTHGTVL
SYFA_TREPA      DVYYLKHP--THAPTIPEPFLSRVAATHERGADSGSLGWRYSFDRDFTRRLLLRSQGTAL
SYFA_HALSA      DRFALSNP--ARIDELPDALVERVERAHREGAGDDGDGYHSPWDEDFARALALRGHTTSL
                *   :                  :   *.         :   :.         * : *  

SYFA_THEAC      TARYLYENNEP----PQAIFSVEKVFRHESVDWKHLAEFYQIEGAVYSKDVSVSTLKWIL
SYFA_THEVO      TARYLYEHNTY----PQAIFSVEKVFRHESVDWKHLAEFYQIEGAVYDKNVSVATLKWIL
SYFA_SACS2      TARVLASRPKA----PQKVFTLGKVFRPDAIDATHLIEFHQLDGVIIDNNFTFKELLGVL
SYFA_SULTO      TARVLASRPKP----PIRVFTIGKVFRPDSIDATHLIEFHQLDGLVIEDNFTFRDLLGTL
SYFA_AERPE      SARILATRPNP----PARFFTVGKVFRSDAVGPTRLPEFHQLDGIEGDEGYTFRDLLGRL
SYFA_PYRAE      TIRALAERGDG----EYKVFTIGRVFRPEKLDPKHSMEFHQLDGIVVGPGLTFKHLLGQL
SYFA_METJA      SIRYLASLSDEEKNKPHKVFCIDRVFRNEAIDYKHLPEFYQCEGIIMDDNVNFNNLIGVL
SYFA_METAC      TIKYLADNPEP----PVKAFCIDRAYRRETIDPTHTPEFEQLEGVVMDKDMSFADLLGLL
SYFA_METMA      TIKYLADNPEP----PVKAFCIDRAYRRETIDPTHTPEFEQLEGVVMDKDMSFADLLGLL
SYFA_ARCFU      TIHYLAENPEP----PQKAFCIDRVYRRETIDATHLPEFDQLEGVVLDRDVGFKHLLGLL
SYFA_METKA      SVRKLYEVEGP----PLKAFSIGRVYRRETVDYKHLPEFHQCEGIVLAKDVSFRDLLGIL
SYFA_METTH      SARFLSENE-P----PLKMFSVGRVFRRETITYKHLPEFHQVEGIVAGDEVNFRNLLGIL
SYFA_PYRAB      SARQLAKGIEI----PGKYFTIQRVFRPDVLDRTHLIEFNQIDGFVAGEDLTFRHLLGIL
SYFA_PYRFU      SARQLAKGIEI----PGKYFTIQRVFRPDVLDRTHLIEFNQIDGFVAAEDLTFRHLLGIL
SYFA_PYRHO      SARELAKGIEI----PGKYFTIQRVFRPDVLDRTHLIEFNQIDGFVASEDLTFRHLLGIL
SYFA_BORBU      SAKQLINAKNP-----SRYFGVIRCFRYDQVDATHGVDFYQTEGIVIEDGVSIKTLLGLL
SYFA_TREPA      SARHLPTAHIP-----GKYFGIARCFRHDQVDATHLADFYQTEGIVLGTDVNVCTLLGML
SYFA_HALSA      TARHLAGLADADVEAPARYFSVEKAYRNDTLDATHLLEFFQIEGWVLADDLSVRDLMGTF
                : : *              * : : :* : :  .:  :* * :*        .  *   :

SYFA_THEAC      RDFYAKLGFND-IKLIPSYYPYTEPSLDVVVRVNGK--EVELGGSGLFRPEVLKILGLK-
SYFA_THEVO      RTFYGKLGFEK-IRLVPSYYPYTEPSLDVVVEVDGK--EMELGGSGIFRPEVGKILGLK-
SYFA_SACS2      KEIFYRLGIKE-VKFKPAYFPFTEPSVEAYGYLEKLG-WVEMCGAGLLRPEILSSVGID-
SYFA_SULTO      KEIFNGIGIKE-IRFKPAYFPFTEPSVEVYGKIEGLG-WVEMAGAGLLRPEILEAVEIS-
SYFA_AERPE      DEIASMLGLK--LKFKPAYFPFTEPSVEGYVKLPNGR-WLELFGAGMFRPEVLEAVGVD-
SYFA_PYRAE      EEIAKALGMTK-VKFRPAYFPFTSPSVEVYAQHPKLG-WVEFGGAGIFRPEVTEPLGVKK
SYFA_METJA      KEFLNRLGFEK-VRFRPAYFPFTEPSLEAEVYLEGKG-WLEILGAGIFRPEVLEPIGIE-
SYFA_METAC      AEFYHRMGFEE-VRFRPGYFPYTEPSVEPEVYVDGLG-WVELGGAGVFRKEVTEPFGIKE
SYFA_METMA      AEFYHRMGFEE-VRFRPGYFPYTEPSVEPEVYVDGLG-WVELGGAGVFRKEVTEPLGIKA
SYFA_ARCFU      KEFFTKMGFED-VRFRPGYFPYTEPSVEPEVYVEGLG-WVELGGAGVFRKEVTEPLGIRG
SYFA_METKA      EEFYRRMGFEE-VRFRPAYFPYTVLSVEPEVYFEEKGDWVELGGAGIFRPEVLQPLGFDP
SYFA_METTH      REFYRKLGFE--VRFRPAYFPYTYLSTECEIYLPEKKSWIELGGAGMFRPEVLEPLGVET
SYFA_PYRAB      KRFAIEIAGAKKVKFFPDYYPFTEPSVQLSAYHPELG-WVEFGGAGVFREEMTEALGIKV
SYFA_PYRFU      KKFAIEIAGAKKVKFFPDYYPFTEPSVQLSAYHPELG-WVEFGGAGVFREEMTKALGIDV
SYFA_PYRHO      KRFAIEIAGAKKVKFFPDYYPFTEPSVQLSAYHPELG-WVEFGGAGIFREEMTEALGIKV
SYFA_BORBU      EIFAKELAGATEIKYVPAYFPFTEPSIEIHVKHPVLG-WFELGGSGIFRPEVTKPLGIDL
SYFA_TREPA      KILATEIAGAQEVRYVGGYFPFTEPSIELHALHPALG-WFELGGAGLLRPEVTDPLGVHV
SYFA_HALSA      REFYSQFGIHD-LQFKPTYNPYTEPSFELFGRHPETGELIEIGNSGIFRPEMLDPLDVDG
                  :   :.    ::    * *:*  * :           .*: .:*::* *: . . .  

SYFA_THEAC      APV-MAWGMGLERLAMMYYGLTDVRDLYNTDFEFLSSFRFNISRNGRNNYGKA-----
SYFA_THEVO      APV-MAWGMGLERLAMLYYGLTDVRDLYNTDFSFLEGYKIKY----------------
SYFA_SACS2      STA-GAWGIGIERLAMSFLNISDIRLLYSNNIEYIRDTKVKIE---------------
SYFA_SULTO      SSA-GAWGLGIDRLAMLLLGLKDIRLLYATDIEYLRNRKVEINADN------------
SYFA_AERPE      YPV-GAWGFGIERLAMAFYGVSDIRKLYTRNVDEVREMRVRWL---------------
SYFA_PYRAE      SRV-LAWGWGLDRIAMILLGIDDIRELFTKDLEKLKEYYARWARYKASVGAVGTLFTL
SYFA_METJA      KPV-LAWGIGFSRLAMLRYGLTDIRDLHKNDLDWLKRV--------------------
SYFA_METAC      PVL--AWGLGVSRLAMLKLGLKDLRLLYQSDIDWLRKSEVCRI---------------
SYFA_METMA      PVL--AWGLGVSRLAMLKLGLKDLRLLYQSDIDWLRKSEVCKI---------------
SYFA_ARCFU      KVL--AWGLGIGRLAMLKIGLKDLRRLYLPDLGWLRSMPVARK---------------
SYFA_METKA      DVVCLAWGLGVERLAMLKLGIDDIRDLYMSDLKTLLELPTARARR-------------
SYFA_METTH      PVA--AFGLGIERLAMIRFDIKDIRMLYQSDLGWLRGLPVTGDLEL------------
SYFA_PYRAB      PVI--AWGIGIDRLAMFKLGIDDIRYLFSYDLRWLREAKLIW----------------
SYFA_PYRFU      PVI--AWGIGIDRLAMFRLGIDDIRYLFSYDLKWLREAKLIW----------------
SYFA_PYRHO      PVI--AWGIGIDRLAMFKLGVDDIRYLFSYDLKWLRESKLIW----------------
SYFA_BORBU      PVI--AWGIGIDRMALMHLGLNDLRDLFTYDIGDVILRRGKIDAKVRNL---------
SYFA_TREPA      PVM--AWGLGVDRMALLALGISDVRELFSPDIESVRLRV-------------------
SYFA_HALSA      DVM--AWGLALERLLMLMTGFEDIRDVHGTLCDVGFLRNAEVVY--------------
                     *:* .. *: :   .. *:* :.