CLUSTAL format seed alignment for MF_00283

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYFB_HELHP        ---MIFSKHLLSHFVDISHL-------------------DIEQMCMRLSSMGLEVESAYP
SYFB_HELPJ        ---MKLSVNDLNVFVNTPK--------------------DIAKLCEDLSRLGLEVESCIP
SYFB_DEHMC        ---MKIPLKWLKEYLPTDI--------------------QPAELAERMTMAGTEVAVLNS
SYFB_DEHM1        ---MKIPLKWLKEYLPTDM--------------------SPAELAERMTMAGTEVTVLNS
SYFB_PARUW        ---MRIPLSWLKEYIDLNL--------------------EPVEIAKILTMAGLEVDGYEE
SYFB_DESVH        ---MLLSLKWLREFVPFEG--------------------TAAELGDRLTMLGLELEEIIR
SYFB_DESAG        ---MLLSLNWLREFVPYTG--------------------TAQELGDRLTMLGLELEEIIR
SYFB_SYNPX        ---MRVSLSWLKQLVQVTD--------------------SVEALAHRLSMAGFEEEEIED
SYFB_GLOVI        ---MRVSFNWLQEYVEFDF--------------------TPSELAEKLTMAGFEVEHVED
SYFB_THETH        ---MRVPFSWLKAYVPELE--------------------SPEVLEERLAGLGFETDRIER
SYFB_DEIRA        ---MKLPYSWLKELIPDLP--------------------PVADLEPTFAHLGLPLEGVED
SYFB_MYCTU        ---MRLPYSWLREVVAVGASG---------------WDVTPGELEQTLLRIGHEVEEVIP
SYFB_CORGL        ---MLIAQNWVTGLLGHANEG---------------WKVPSSDLDSGYVRVGFETEGYWP
SYFB_CUTAK        ---MKVPMSWLQAMVNLPDGT---------------TTDKVAKALTNHTATVEKVEVVG-
SYFB_BIFLO        -----MPMIDIDWLKDHVEVP---------------EGLTYEQLAKDLVKVGLEEEEIHS
SYFB_ECOLI        ---MKFSELWLREWVNPA--------------------IDSDALANQITMAGLEVDGVEP
SYFB_PECAS        ---MKFSELWLREWVNPA--------------------VDSETLSEQITMAGLEVDGVEP
SYFB_MANSM        ---MKFSEQWVREWVNPA--------------------VNTEQLCDQITMLGLEVDGVEA
SYFB_ALIF1        ---MKFSESWLREWVKPA--------------------INSEELAHQITMAGLEVDEVAP
SYFB_PHOPR        ---MKFSESWLREWVKPA--------------------INSEELAHQITMAGLEVDEVAP
SYFB_IDILO        ---MKFSEQWLREWVNPD--------------------ISSHELSEQLSMAGLEVDAVEP
SYFB_PSEPK        ---MKFSEQWLRGWVNPQ--------------------VSRDELVARLSMAGLEVDSVTP
SYFB_PSEPF        ---MKFSEQWLRGWVSPQ--------------------VDRDALVARLSMAGLEVDSVTP
SYFB_LEGPL        ---MKVSKLWLREWVNFS--------------------LTEQELAEQLTMAGLEVDAVNP
SYFB_LEGPA        ---MKVSKLWLREWVNFS--------------------LTEQELAEQLTMAGLEVDAVNP
SYFB_XYLFT        ---MKFSENWLRNHAPIQ--------------------ANRDVLVATLTAIGLEVENVAV
SYFB_XYLFA        ---MKFSENWLRNHVPIQ--------------------ANRDVLVATLTAIGLEVENVAV
SYFB_XANC8        ---MKFSENWLRSHVPIQ--------------------ASREELAATLTAIGLEVEAVTP
SYFB_XANOR        ---MKFSENWLRSHVPIQ--------------------ATRDELAATLTAIGLEVEEVIP
SYFB_BURPS        ---MQFPESWLRTFVDPQ--------------------LTTDELSHALTMAGLEVESLRP
SYFB_CUPNJ        ---MQFSESWLRTFANPEK-------------------ISTDALSHSLTMAGLEVEEVGP
SYFB_BORBR        ---MQFPESWLRSLVNPS--------------------IGTDELAHRLTMAGLEVEETEP
SYFB_THIDA        ---MQFSEAWLRKLVNPA--------------------LDTTELAHALTMAGLEVEALTA
SYFB_NEIMB        ---MQFSYSWLKTQADTE--------------------LSSDKLEHLLTMSGLEVEEAET
SYFB_LACJO        ---MLVSYNWLKDFLD-LD-----------------EDPKD--LGEKITRTGVEIASVDH
SYFB_LACSS        ---MKVSYNWLKDYLD-LT-----------------TAPEA--LAEKITRTGIEVADVAQ
SYFB_STRP3        ---MLVSYKWLKELVD-ID-----------------VTPAA--LAEKMSTTGIEVEGIEV
SYFB_STRP8        ---MLVSYKWLKELVD-ID-----------------VTPAA--LAEKMSTTGIEVEGIEV
SYFB_STRPN        ---MLVSYKWLKELVD-ID-----------------VPSQE--LAEKMSTTGIEVEGVES
SYFB_STAAC        ---MLISNEWLKEYVT-ID-----------------DSVSN--LAERITRTGIEVDDLID
SYFB_LISIN        ---MLVSYNWVKEFFQDFP-----------------LTAEE--LGEAITRTGIEIEGVEE
SYFB_OCEIH        ---MLVSYNWLKNYVNLDA-----------------VTPEE--LAAKITKSGIEVEGVEY
SYFB_SYNAS        ---MQVSLRWLKDYVDID------------------LTPAE--VSDRLTMAGLEVDAVRE
SYFB_MOOTA        ---MRVPYKWLQQYVDVT------------------LPPAE--LADKLTMAGLAVEGVED
SYFB_DESPS        ---MKFTLNWLQKYVDTTG-----------------LTPTE--IADKLTMLGLEVDSVAP
SYFB_CARHZ        ---MNISYNWLQEFCEIP------------------YTAQE--LGEKLTSVGIAVEKVTY
SYFB_FUSNN        ---MLISLNWLKQYVDIKE-----------------SIDE---IANALTMIGQEVEAIDI
SYFB_BDEBA        ---MKISLKWLHDYVDVTE-----------------FFQKPEVLAEALTRGGLEVEEITN
SYFB_THEMA        ---MRVPESWLREFVDL--------------------DWDIEQIAERLTFSGTSVEDILR
SYFB_AQUAE        ---MKVPYSWLSEFVELS-------------------DVSPEEIAEKLSLRSVEATVETF
SYFB_LEPIC        ---MKLSLDWMNDFTPLKE-------------------VGLDAILKKIAISVCEIDDATE
SYFB_LEPBL        ---MKLSLDWMNDFTPLKE-------------------VGLDVILKKIAVSVCEIDGVVP
SYFB_RICTY        ---MKFTLSWLKQFLEISAS--------------------VTEIAEALTDIGLEVEEVID
SYFB_RICPR        ---MKFTLSWLKQFLEISAS--------------------VTEIAEALTDIGLEVEEVID
SYFB_BRUSU        ---MKFTLSWLKDHLETDAT--------------------LDEIVEKLTDIGLEVESVDD
SYFB_BRUME        ---MKFTLSWLKDHLETDAT--------------------LDEIVEKLTDIGLEVESVDD
SYFB_PELUB        ---MKITTAWLKDHLDTKLN--------------------ENQIIDKLTDIGLEVEGVDS
SYFB_WOLTR        ---MRFTLSWLLEHLETNAS--------------------LEEITDKLTHIGLEVKDVVD
SYFB_EHRCJ        ---MKFTFSWLRRYLDTDVS--------------------LDVIIKKLSDIGIEVNNVDY
SYFB_BLOPB        ---MKFSEMWIREWINPPI--------------------SSIELADQLTMAGFKVNELKP
SYFB_BLOFL        ---MKFSESWIREWVNPPI--------------------DHDQLIDQFTLAGLNVEESRK
SYFB_WIGBR        ---MNLSEIWLREYLSINL--------------------DLNEIINRITKIGLEVEKIIP
SYFB_BUCAP        ---MKFNENWLREWINPKI--------------------TSVSLRNQIVESGIEIESIHE
SYFB_BUCBP        ---MEFSEKWLLDWLGFSI--------------------SNV-FYEQMTKSGIEVEAIAK
Q057Y9_BUCCC      ---MKFGEEWLREWINPSI--------------------SVPDLCEQLTNFGCEVEYFKK
SYFB_MYCGA        ---MLLSKKVIANFIPTIT------------------KIEDKKIVEALNAIGAEVESIKT
SYFB_MYCPN        ---MLISKKTLAVLIPEIT------------------HVSNNEICEKLQQIGIEVEAIRA
SYFB_MYCMO        ---MIFSYKHLKKLANLN-------------------EISFEDVIKAFNLIGFEVEETKE
SYFB_MYCPU        ---MLFSINKLRDLANLDK------------------QITNDQIIDAINKIGFEVESVKN
C4XE68_MYCFP      -MNMIISLRELNKFMPKI--------------------KLDETIEKVINNLGYEVESMTK
D3VQ30_MYCAA      ---MIISLREINKYMPEI--------------------NLDSSIEKSINNLGYEVESIKQ
SYFB_MYCS5        ---MIYSLKHLNKYLPEI--------------------KLDQSVTKALESLGFEVEFFEK
SYFB_MYCHJ        ---MLFSLRRLKKLANLE-------------------AFSDQKVIDSLINLGFEVDQITK
SYFB_MYCH2        ---MLFSLRRLKKLANLE-------------------AFSDQKVIDSLINLGFEVDQITK
SYFB_MYCH7        ---MLFSLRRLKKLANLE-------------------AFSDQKVIDSLINLGFEVDQITK
SYFB_PORGI        ---MNISYKWLLEYLPCTLS--------------------PQEIADTLTSIGLETGGVEE
SYFB_CHLTE        ---MKISVNWLKEFVPSLS-------------------FDCSGLVDYLTFLGLEVEDVFE
SYFB_SULDN        ---MIVTRSWLNEWIDIST-------------------ISTDKLVKTLNSIGLEVDSISS
SYFB_RHOBA        ---MLVSWKWLSRYVDMTL--------------------SHDELVDRLSLSGLNHEGSET
SYFB_TROW8        MAVLRVPVSWLLEYVHTQTGFVGETGIRSDTRRTHTDCPVAEDILESLLSVGFEGEILDR
SYFB_CHLPN        ---MRIPITLLQTYFSEPL--------------------STKEILEACDHIGIEAEIENT
SYFB_UREPA        ---MILSLNLLHKISPKLKK------------------IPLNELCAALMDLGCEVETINS
SYFB_ONYPE        ---MQGTPPTMKIIENILKN------------------HFSQPLSQNISALTNNYITEVQ
SYFB_MYCPE        ---MLLSRKLLNTLFPIFNK------------------VSNQELETMLNSIGVEVENIIK
B5Y860_COPPD      ---MKFSFNQLKKFWQEKDQ-------------------VTWQQVKSYLEKHLEVEVEEE
SYFB_PORPU        ----------------------------------------MNFLNKSLIRDSVVLQNRWK
SYFB_PHATC        ---MQISLKWIKELIDIEN-------------------VDLDDLIEKLTLGGFEVEEILE
SYFB_GRATL        ---MKFSLRWLQQIVDLNN-------------------IKFSTLVDKLSVSGFEVEDISR
C7LJX7_SULMS      ---MKISFNWLKLYLDTEV--------------------SIKFICKILTDIGLLVENLKK
SYFB_MESFL        ---MIITRKWLEKYLDLSN-------------------ITNEQISVCLNSLGFEVEQEID
                                                                              

SYFB_HELHP        L----KMPQKVVVGKILSLTPHPDA--DKLNVCKVSIGSQE-------------------
SYFB_HELPJ        C----IAPKNVVVGKVLEKAPHKNA--EKLSVCQVDVGKEV-------------------
SYFB_DEHMC        H---KDKWPNVYVGQIMEVNRHPNA--DRLVLVKVDWGQGQ-------------------
SYFB_DEHM1        R---KDKWPNVYVGQIMEVNRHPNA--DRLVLVKVDWGQGQ-------------------
SYFB_PARUW        I---GKGFSGVIVGDVLEVEKHPNA--DKLLIALVSDGKEI-------------------
SYFB_DESVH        P---FDAIEPIVVGHVVSRERHPEA--DKLSVCKVDVGQG--------------------
SYFB_DESAG        P---FDAIADIVVGHVLECGRHPEA--DKLSVCRVDVGT---------------------
SYFB_SYNPX        L---SARAKGVVVGFVKDREKHPNA--DKLSVCQVDIGSE--------------------
SYFB_GLOVI        R---RTWAAGVVVGRVLECAPHPQA--DRLHVCRVDIGTG--------------------
SYFB_THETH        V---FPIPRGVVFARVLEAHPIPGTRLKRLVLDAGRTVE---------------------
SYFB_DEIRA        V---PAPVGGVLLVAVKAAEPMEGTQLTKLTLDTGENGEK--------------------
SYFB_MYCTU        L---GPVDGPVTVGRV-ADIEELTGYKKPIRACAVDIGDR--------------------
SYFB_CORGL        I---PETTGPLVFGRV-ETIEELTEFKKPIRHCHVNVGDANGTG----------------
SYFB_CUTAK        ----GELTGPIVIGHILSSVPEPQKNGKVINWCRVDVGPRYNAE----------------
SYFB_BIFLO        ----SQVTGPIVVGYVVDATPEPQKNGKTINWCHVDCGDEWNET----------------
SYFB_ECOLI        V---AGSFHGVVVGEVVECAQHPNA--DKLRVTKVNVGGDR-------------------
SYFB_PECAS        V---AGAFHGVVVGEVVECGQHPNA--DKLRVTKVNVGGER-------------------
SYFB_MANSM        V---AGEFNGVVVGEVVECAQHPDA--DKLRVTKVNVGGER-------------------
SYFB_ALIF1        V---AGEFTGVKVGKVVECGQHPDA--DKLRVTKIDIGEEE-------------------
SYFB_PHOPR        V---AGEFTGVKVGKVVECGQHPDA--DKLQVTKIDIGEEA-------------------
SYFB_IDILO        V---ADEFHTVVVGEVIECGPHPDA--DKLQVTKVNVGEDE-------------------
SYFB_PSEPK        A---AGQFSGIVVGEILATEQHPDA--DKLRVCQVSSGQE--------------------
SYFB_PSEPF        A---AGVFSGVVVGEVLSTEQHPDA--DKLRVCQVSNGAE--------------------
SYFB_LEGPL        V---AGQFTHVIVAEVLNTKPHPDA--DKLTLCEVNINKDK-------------------
SYFB_LEGPA        V---AGQFTHVIVAEVLNTKPHPDA--DKLTLCEVNINKDK-------------------
SYFB_XYLFT        L---GEALDLILVARIVNVVPHPES--DLLQICQVDVAQDT-------------------
SYFB_XYLFA        L---GEALDLIVVARIVNVVPHPES--DRLQICQVDAAQDT-------------------
SYFB_XANC8        L---GDALGQVVVARIIAAVRHPEA--DRLQVCSVDAGQGE-------------------
SYFB_XANOR        L---GESLGQVVVARIVEAMRHPEA--DRLQVCSVDAGQGE-------------------
SYFB_BURPS        A---APPTEKIVVGRVLEVVKHPDA--DKLNVCQVDAGTGA-------------------
SYFB_CUPNJ        V---APPFDKIVVAHVLSTERHPNA--DRLNVCQVDAGTGE-------------------
SYFB_BORBR        A---APPFTGVVVAHIVDIAPHPDA--DKLRVCQVDDGSGA-------------------
SYFB_THIDA        A---APPFNDVVVAEILSAQKHPDA--DRLRVCQVDIGEAA-------------------
SYFB_NEIMB        A---APAFAGVVIAEVKSVEKHPDA--DRLNVTRVDAGTGG-------------------
SYFB_LACJO        P---AEGLKKIVVGHILECEDI-EG--THLHKCQVDVGEEEP------------------
SYFB_LACSS        M---SAGLKKIVVGHVLSCEPHPDS--DHLHVCEVDVGEEEP------------------
SYFB_STRP3        P---AEGLSKLVVGHVLSCEDV-PE--THLHLCQVDTGDETP------------------
SYFB_STRP8        P---AEGLSKLVVGHVLSCEDV-PE--THLHLCQVDTGDETP------------------
SYFB_STRPN        P---AAGLSKIVVGEVLSCEDV-PE--THLHVCQINVGEEEE------------------
SYFB_STAAC        Y---TKDIKNLVVGFVKSKEKHPDA--DKLNVCQVDIGEDEP------------------
SYFB_LISIN        L---SASLKNVVVGEVLSCERHPDA--EKLNKCLVQTDEEEP------------------
SYFB_OCEIH        I---AEKNENIVVGYVETCEKHPDA--DKLNVTQVSVGEET-------------------
SYFB_SYNAS        V---GPSFSNVVVARIIALRRHPNA--DKLSLCEVTTGDET-------------------
SYFB_MOOTA        L---TPGFQKVVAGKIKTITPHPDA--DHLVICNVDAGRE--------------------
SYFB_DESPS        I---FEELAALKTGLVISCEKHPDA--DKLSLCQVQVGDDT-------------------
SYFB_CARHZ        I---G-NYEKVVVGEVLEVENLPGT--E-LFKTKVSTGKEI-------------------
SYFB_FUSNN        Q---GKDLDNVVIGQIVEFDKHPNS--DRLTLLKVNVGGEEP------------------
SYFB_BDEBA        R---AKDFNHVVIGHILEKDKHPNA--DKLSLCRVSTGEGVV------------------
SYFB_THEMA        P---FNVSGEIITARVIERFDHPAS--EKLIVCKVDTGKRIY------------------
SYFB_AQUAE        G---IDLDG-VVFGKVVEVKEHPTK--KKLAVVKVQVQEHIFI-----------------
SYFB_LEPIC        F---RPELDFVKIVRIESLEKHPSA--DKLQIAQVFDGSSK-------------------
SYFB_LEPBL        F---RPELDFVKIVRIESLDKHPSA--DKLQIAEVFDGSSK-------------------
SYFB_RICTY        K---ATELQKFEVAYIRNIKPHPSA--DKLKLCDVETKNGI-------------------
SYFB_RICPR        K---SKELQKFEVAYIRNIKPHPSA--DKLKLCDVETKNGI-------------------
SYFB_BRUSU        R---AA-FRAFTIARVLTATRHPDA--DKLQVLSVDTGDGKP------------------
SYFB_BRUME        R---AA-FRAFTIARVLTATRHPDA--DKLQVLSVDTGDGKP------------------
SYFB_PELUB        Q---SGELDQFVIAKILKAEKHPDA--DRLRVCDVDIGSGKS------------------
SYFB_WOLTR        N---TK-LAGFIVAKVLEVTPHPNV--DKLKLCKVDN-GSKI------------------
SYFB_EHRCJ        C---EH-LKTFVIAEVLEVNPHHSA--NKLKICKVSD-GKQI------------------
SYFB_BLOPB        V---TNIFYGVVIGEIVECKMHPNL--HNVWITKVNNG-DNKLL----------------
SYFB_BLOFL        LN--SNKFYGIVIAKIIECQVHPSL--ADTWIMTVNSG-GGNII----------------
SYFB_WIGBR        V---SMKFSGIKIGKVISCKQHPKC--KKLKIFLIKIN-NKNII----------------
SYFB_BUCAP        F---NPIFDGFLVGKIVECINPCKG--NNLKILKVDVGYKKLL-----------------
SYFB_BUCBP        I---SKNFERVIVGEVVERLYVNTM--HNIVFLRVKLSEKKMIF----------------
Q057Y9_BUCCC      K---YKTISSVVIGQIISKEKYFLN--KKFLIYNILINKNKKIY----------------
SYFB_MYCGA        F----SMIDYLIIGKIFTIKKHPHA--EKLNICSIQISDNKF------------------
SYFB_MYCPN        F----KNPDYLQLGILRAVTPHPHD--NHLYVCQVQIDKNKQ------------------
SYFB_MYCMO        I----RHVENIKYGKVLKIYKNENS--DNLTVCEIQFKDK--------------------
SYFB_MYCPU        F----LNVSKIKFGLIKKVYKNPNA--SNLNVCEIEFEDK--------------------
C4XE68_MYCFP      F----SDVKGIKFARIIDVKPNPKS--NGLTIVEVETDKG--------------------
D3VQ30_MYCAA      F----SDVKGIKFGYVLDVFKNENS--KNLNVVSIKTNRG--------------------
SYFB_MYCS5        F----SSSKGLLFAKVLNVFDNPNS--TKLQVVELDTKLG--------------------
SYFB_MYCHJ        L----NEISGIKFGQILEIRKNPEA--DNLWICKVQFADK--------------------
SYFB_MYCH2        L----NEISGIKFGQILEIRKNPEA--DNLWICKVQFADK--------------------
SYFB_MYCH7        L----NEISGIKFGQILEIRKNPEA--DNLWICKVQFADK--------------------
SYFB_PORGI        IETIRGGLRGLVIGHVLTCEEHPNS--DHLHITTVDVGADAP------------------
SYFB_CHLTE        Q---KLPDQKVIVGKIVEVRPHPNA--DRLRICMVDTGEGE-------------------
SYFB_SULDN        Y----EVPQKIVFGRVLECKKHPDA--DKLNICQVDIGVSTR------------------
SYFB_RHOBA        V-----------------------------------------------------------
SYFB_TROW8        P----ELSGPIVVGRVLDFTEEVHSNGKTIRWCKVRVCAPVQPNNTPLSKDCNPSTQTGN
SYFB_CHLPN        T---LYSFASVITAKILHTIPHPNA--DKLRVATLTDGEKE-------------------
SYFB_UREPA        I----KPSTNLVFAKVLEKTRHPNA--NHLNLVKVKANQKVY------------------
SYFB_ONYPE        NFFPLSKNTNLVVGQILNFQKIQGS--QKLNLVEVNTGTKV-------------------
SYFB_MYCPE        F----PRTENLIVGEIKKVEKHPNA--DKLNICEVFFENKIH------------------
B5Y860_COPPD      VP--IDIPDSWWLKEVAPANEKNSR--AEVHLENGSVIP---------------------
SYFB_PORPU        I------IMKVSLNWLKELAKIEII-----------------------------------
SYFB_PHATC        L-----------------------------------------------------------
SYFB_GRATL        N-----------------------------------------------------------
C7LJX7_SULMS      I-----------------------------------------------------------
SYFB_MESFL        Y---SKLNTKLVIGHIEESDPIEGT---KLKKTKTRIGENK-------------------
                                                                              

SYFB_HELHP        ------------LQIVCGANNVKANQ----YVAVALEGAVIPHTK--SGEIVIKQTNLRG
SYFB_HELPJ        ------------LPVVCGAKNVAPNQ----FAPVALKGAIIGST-------TIAKTELRG
SYFB_DEHMC        ------------ETVVTGAPNCKVGD----KVVFARTGAVLIDG-HNGKEIVLKPAVLRG
SYFB_DEHM1        ------------ETVVTGAPNCKAGD----KVVFARTGAVLIDG-HNGKEMVLKPAVLRG
SYFB_PARUW        ------------HQVVCGASNCRKGL----KTAFAPVGASLID---EGKEFKIKKGKLRG
SYFB_DESVH        ----------EPLDIVCGAPNVAAGQ----RVPVALVGTTMPG------GMVIKKAKLRG
SYFB_DESAG        ----------EVLDIVCGAPNVAAGQ----KVPVAKVGVTMPS------GLKIKKAKLRG
SYFB_SYNPX        ----------ESIQIVCGAKNVRAGL----HVPVAMVGAELPAV-----NLTIKSGELRG
SYFB_GLOVI        ----------RLLNIVCGAPNARAGI----YAPVAPVGTYLPIK-----DLKLRAASIRG
SYFB_THETH        --------------VVSGAENARKGI----GVALALPGTELPGLGQKVG-----ERVIQG
SYFB_DEIRA        ------------TIASGAPNAVGLPA----GTMVALVTPGTTLGGITYG-----VRPMQG
SYFB_MYCTU        ----------QYREIICGATNFAVGD----LVVVALPGATLP-GGFTIS-----ARKAYG
SYFB_CORGL        ----------ELQSIVCGARNFKEGD----TVVVSLPGAVLP-GDFAIS-----ARETYG
SYFB_CUTAK        GHPKNIEEGVEGRGIICGAPNAVEGA----WVVVSLPGAVLP-GGFAIS-----ARKTYG
SYFB_BIFLO        DEDGN----KVPRGIICGAPNMKAGE----KVVVTLPGAVLP-GDFKIE-----PRKTYG
SYFB_ECOLI        -----------LLDIVCGAPNCRQGL----RVAVATIGAVLPGD------FKIKAAKLRG
SYFB_PECAS        -----------LLDIVCGAPNCRQGL----KVAVATVGAVLPGD------FKIKAAKLRG
SYFB_MANSM        -----------LLDIVCGAPNCRQGL----KVACAIEGAVLPGD------FKIKKTKLRG
SYFB_ALIF1        -----------LLDIVCGASNCRLGL----TVAVATVGAVLPGN------FKIKKAKLRG
SYFB_PHOPR        -----------LLDIVCGASNCRLGL----TVAVATVGAVLPGN------FKIKKAKLRG
SYFB_IDILO        -----------PVDIVCGASNCRLGI----KVAVAKVGAVLPGD------FKIKKAKLRG
SYFB_PSEPK        -----------TFQVVCGAPNARPGI----KIPFAMIGAELPGD------FKIKKAKLRG
SYFB_PSEPF        -----------TFQVVCGAPNVRPGL----KIPFAMIGAELPGD------FKIKKAKLRG
SYFB_LEGPL        -----------PLKIVCGAANVRPGL----RVALAMIGAHLPGG------LQIKESKLRG
SYFB_LEGPA        -----------PLKIVCGAANVRPGL----RVALAMIGAHLPGG------LQIKESKLRG
SYFB_XYLFT        -----------LLQIVCGASNVRPGL----VVPLALLGAKIGAL-------TIKSTTLRG
SYFB_XYLFA        -----------LLQIVCGASNVRPGL----VVPLALLGAKIGAL-------TIKSTTLRG
SYFB_XANC8        -----------LLQIVCGAPNARAGL----VAPLALVGAQIGEL-------TIKAAKLRG
SYFB_XANOR        -----------LLQIVCGAPNARPGL----VAPLALVGAKIGEL-------TITAAKLRG
SYFB_BURPS        -----------TLQIVCGAPNVAPGI----KVPVALVGAKLPPAEEGGAPFAIKLSKLRG
SYFB_CUPNJ        -----------TLQIVCGAPNVKPGI----KVPCALVGAVLPPAEAEGKPFEIKVGKLRG
SYFB_BORBR        -----------LLQIVCGAPNAAAGL----TVPLARVGAELPGG------MKIGVAKMRG
SYFB_THIDA        -----------PATIVCGAPNAAAGL----KVPCARPGAKLPGI-------EIKVAKVRG
SYFB_NEIMB        -----------LVQIVCGAPNVKAGI----KVPCSLPGAVLPGN------FKIKPTKMRG
SYFB_LACJO        ------------IQIVCGAPNVAAGE----DVIVALHGARIAGN------EKIKRGKIRG
SYFB_LACSS        ------------FQIVCGAPNVAAGQ----YVIVALPNSRIADN------VKIKKGKMRG
SYFB_STRP3        ------------RQIVCGAPNVKAGI----KVIVAVPGARIADN------YKIKKGKIRG
SYFB_STRP8        ------------RQIVCGAPNVKAGI----KVIVAVPGARIADN------YKIKKGKIRG
SYFB_STRPN        ------------RQIVCGAPNVRAGI----KVMVALPGARIADN------YKIKKGKIRG
SYFB_STAAC        ------------VQIVCGAPNVDAGQ----YVIVAKVGGRLPGG------IKIKRAKLRG
SYFB_LISIN        ------------VQIICGAPNVAAGQ----KVIVAKVGARLPGG------LKIKRAKLRG
SYFB_OCEIH        ------------LQIVCGAPNIAKGQ----KVAVAKPGAVLPGN------MKIKKVKLRG
SYFB_SYNAS        ------------LPIVCGAPNIHVGD----VVPLARIGAEIPGG------YTIKRSKIRG
SYFB_MOOTA        ------------LQLVTGAPNVHEGQ----MVAVALEGARLPGG------REIHRATFRG
SYFB_DESPS        ------------HQIVCGAPNVREGL----AVTVALPGAVLPGN------FKIKKSKVRG
SYFB_CARHZ        ------------FEVVTGAKNVFAGF----KYPFALPGAKLPNG------ITIEERRIRG
SYFB_FUSNN        ------------LQIICGAKNHKLND----KVVVAKIGAVLPGN------FKIKKSKIRD
SYFB_BDEBA        ------------HQIVCGAQNHKAGD----RVIVALPGAVLPGN------FAIKKSAVRG
SYFB_THEMA        -------------TVITADKTVNEGD----YVILALEGATLNNG------LKIEPREFKG
SYFB_AQUAE        -------------DVVTVDKSVREGD----GVIVALPNAKVGNM------CVTE-REFDG
SYFB_LEPIC        ------------SQIVTGVTNVKIGD----LVPLAIPGAKLGDK-------EILESELRG
SYFB_LEPBL        ------------SQIVTGATNVKVGD----LVPLAIPGAKLGDR-------EILESELRG
SYFB_RICTY        ------------LQIVCGASNVRADI----KVVLANIGIEIPKG-----NFKIKESIIRG
SYFB_RICPR        ------------LQIVCGASNVRADI----KVVLANIGIEIPKG-----NLKIKESVIRG
SYFB_BRUSU        ------------VQVVCGAPNARAGL----VGVLGRPGDYVPGL-----DVTLSVGKIRG
SYFB_BRUME        ------------VQVVCGAPNARAGL----VGVLGRPGDYVPGL-----DVTLSVGKIRG
SYFB_PELUB        ------------VKVVCGAPNAKEGL----LTIYAPPGAVVPKS-----QMKLVVSKIRG
SYFB_WOLTR        ------------LQIVCGANNVREGL----KTVLASLGSTLPES-----NFTIKPTKIRG
SYFB_EHRCJ        ------------LQVVCGASNVKVGM----KSVLACVGSIMPTD-----QSIIEVVKLRG
SYFB_BLOPB        -------------NIVCNAPNCRKNI----RVAVAQIGAMLPDG------RKIKLKTIQG
SYFB_BLOFL        -------------NIITNNMNYNKNT----KVVVANIGAILPNG------NIIKQINIQG
SYFB_WIGBR        -------------NVISDYDKSLINK----KIAVAVNGSILPNR------TIVEKKFLYG
SYFB_BUCAP        -------------NIVCGASNCRNNI----KVVVATIDSILPNG------SKIKIKKIKE
SYFB_BUCBP        -------------SISSNDIEFSRGT----KIAIATQDSKLFNN------RLISMLRFKE
Q057Y9_BUCCC      -------------VVYFKKKYLSIGN----KIPIILGKNCIKKN------IKNLSLNNIN
SYFB_MYCGA        -----------INIISDSPNLFDQTKVLNKYVIVAMEGAELPNG------ITVINRDIRG
SYFB_MYCPN        -----------LNVVTGAVNIVDPNN-LNKHVIVAKKGAELLNG------LIIKTKNIKG
SYFB_MYCMO        -----------IRIIQTTAKNVEINK-----YVMAFIPGSKLAN------NLIESKLLKG
SYFB_MYCPU        -----------MRIIQTTAQNVEQNK-----YIVAFVENSTFGK------IKIEAKEIKG
C4XE68_MYCFP      -----------KLTIQTKAQNAQKNK-----IAVIFVKGSQKGD------FVFQDKEMAG
D3VQ30_MYCAA      -----------IITIQTTATNVKKNH-----WIVAFVEGASKGE------IVFGKKEMAG
SYFB_MYCS5        -----------ELTIQTTNKVLSKGD-----LTICYPVGSSYQG------KEFQEVTMQG
SYFB_MYCHJ        -----------IREIQTAAKNVIENK-----QVLAFIPGSKSGN------TTFLAKKLRG
SYFB_MYCH2        -----------IREIQTAAKNVIENK-----QVLAFIPGSKSGN------TTFLAKKLRG
SYFB_MYCH7        -----------IREIQTTAKNVIENK-----QVLAFIPGSKSGN------TTFLAKKLRG
SYFB_PORGI        ------------LQIVCGAPNVAAGQ----KVVVATVGTTLYHG---EEEFAIKKSKIRG
SYFB_CHLTE        -----------LRQIVCGAPNVEAGM----MVPVATIGAVLTAV--SGETFTIKPAKIRG
SYFB_SULDN        -------------QIVCGASNVRAGL----DVVVATIGAVMPDG------TIIKPVTLRG
SYFB_RHOBA        ------------------------------------------------------------
SYFB_TROW8        FSNADTNSALETRDIVCGASNFSKGD----LVVVTLPGSNLPGG------FHVTARKVYG
SYFB_CHLPN        ------------HQVVCGAPNCEAGL----IVALALPGAKLFDS--EGQAYTIKKSKLRG
SYFB_UREPA        -------------EIVCGANNFSVHN----WVVLAKLNAELANG------LKITPRELRG
SYFB_ONYPE        ------------VKIVCGASNLQNGK----KVIVASEGSFLEGI-----NATLKNKKIYG
SYFB_MYCPE        -------------VIICGAQNVRPGL----KVIVAKVGTKMLDG------RLIEAKDLLG
B5Y860_COPPD      ------------VYLPEEVSHSNSSGTSICVLVDTKSGTLLSRG---------DLGPLQE
SYFB_PORPU        -------------DAHSLA------------NKLTQAGFEVEDVE---------------
SYFB_PHATC        ------------------------------------------------------------
SYFB_GRATL        ------------------------------------------------------------
C7LJX7_SULMS      ------------------------------------------------------------
SYFB_MESFL        -----------YATILSTSRNIEEDK----FAIVALPGAKLANG------LELENREILG
                                                                              

SYFB_HELHP        IESCGMLCSSVE-LGLPKI------NDGIMVLDSTAGHLE-----LGVELGNLPLFNDYV
SYFB_HELPJ        VESHGMICSSIE-LGFPKI------NDGILELDESVGELV-----LGKELHEYAPFNTHV
SYFB_DEHMC        VESCGMVCSERE-LGLSDE------HEGILVLPADALV----------GMLASEYLGEVI
SYFB_DEHM1        VESCGMVCSERE-LGLSDE------HEGILILPADAPV----------GMLASEYLGEII
SYFB_PARUW        IESNGMLCSAKE-LQISNE------DDGIMELSEHLQA----------GTALNTLYSDTI
SYFB_DESVH        QPSHGMICSERE-LGLGED------HDGI----MVLPESF----RIGARLVDELDLDREV
SYFB_DESAG        QPSCGMICSESE-LELSDE------SDGI----MVLPQDS----VPGVRLVDLLQLDDTV
SYFB_SYNPX        VSSNGMICSLSE-LGLATE------SDGIAELDALTDELP----ALGAPVAPMLGLDDTV
SYFB_GLOVI        MPSEGMLCSLEE-LGLEKA------SEGI---HIFPEASL----PLGLDVGPLLGLDDAI
SYFB_THETH        VRSFGMALSPRE-LGVG-EY-----GGGLLEFPEDALP--------PGTPLSEAWPEEVV
SYFB_DEIRA        VESWGMAASAKE-LGIG-ES-----NAGILTFPAGTAA--------PGTPLRELWPADSV
SYFB_MYCTU        RNSDGMICSAAE-LNLG-AD-----HSGILVLPPGAAE-------PGADGAGVLGLDDVV
SYFB_CORGL        RMSAGMICSASE-LGLADKQ-----NSGIITLDPSYGE-------PGEDARQALGLEDTV
SYFB_CUTAK        HMSDGMLCASDE-LGIG-VD-----DAGIITLPPSVEGHQ---LVPGEDALPILGVPEEV
SYFB_BIFLO        HISNGMCASERE-LGLGDNH-----NGIILLRQYGFSEAEYEALKPGQDAMHLLHLDQPL
SYFB_ECOLI        EPSEGMLCSFSE-LGISDD------HSGIIELPADAPI--------GTDIREYLKLDDNT
SYFB_PECAS        EPSEGMLCSFSE-LGISDD------HDGIIELPADAPI--------GTDIRDYLKLDDNA
SYFB_MANSM        QPSEGMLCSYRE-LGMSED------HSGIIELPADAPV--------GKDFREYLILDDKE
SYFB_ALIF1        VPSHGMLCSFSE-LGIDVE------SEGILELPEGTTL--------GADVRDILELNDVA
SYFB_PHOPR        VPSHGMLCSFSE-LGIDVE------SDGILELPEGTAL--------GMDVRELLELNDVA
SYFB_IDILO        QPSNGMLCSFKE-LGLIDE------HDGIIELPADAPV--------GEDYRKYLQLDDNS
SYFB_PSEPK        VESFGMLCSAAE-LQISEE------NDGLLELAADAPV--------GEDIRTYLSLDDAS
SYFB_PSEPF        VESNGMLCSQAE-LQIGEG------NDGLMELPADASV--------GEDFRVYLDLEDAS
SYFB_LEGPL        ELSQGMLCSATE-LGLAEH------SEGIMELSDEAPI--------GMDLREYLALDDHV
SYFB_LEGPA        ELSQGMLCSATE-LGLAEH------SEGIMELSDEAPI--------GMDLREYLALDDHV
SYFB_XYLFT        IESNGMLCSAKE-LGLDTE------ASGLMELPEDAPI--------GTPLADYLALPDAS
SYFB_XYLFA        VESNGMLCSAKE-LGLDTE------ASGLMELPDDAPI--------GTPLADYLALPDAS
SYFB_XANC8        VASNGMLCSAKE-LGLDSD------ASGLFELPDDAPV--------GQALAEYLGLPDAS
SYFB_XANOR        VASNGMLCSAKE-LGLDSD------AAGLFELPDDAPV--------GQALAEYLGLPDAS
SYFB_BURPS        VESQGMLCSARE-LKLSED------HSGLMILPEGTPV--------GQDIREALNLDDTV
SYFB_CUPNJ        VESYGMLCSARE-LKLSED------HGGLLVLPEDAPV--------GQNIREYLDLDDQV
SYFB_BORBR        VQSSGMLCSARE-LGLSQD------HAGLLELPAALRP--------GTDIRAALDLDDTL
SYFB_THIDA        VESFGMLCSTKE-LGLEGA------ADGLMVLPDDAPV--------GEDLRGWLNLDDTL
SYFB_NEIMB        EVSDGMLCSTDE-LGLPDDG-----VNGLHILPEDAPV--------GTNIREYLDLDDTL
SYFB_LACJO        IKSNGMICGLQE-IGFEDKVVPAKYADGIFVFPKDADVKP------GEEVYKALGMDDYI
SYFB_LACSS        VVSMGMICGLQE-IGFADSVVPKEYVDGIFVFPE--AIAP------GTDVYEALGMTDYI
SYFB_STRP3        MESLGMICSLQE-LGLSDSIIPKEFSDGIQILPD--EAVP------GDAIFKYLDLDDHI
SYFB_STRP8        MESLGMICSLQE-LGLSDSIIPKEFSDGIQILPE--EAVP------GDAIFKYLDLDDHI
SYFB_STRPN        LESLGMICSLGE-LGISDSVVPKEFADGIQILPE--DAVP------GEEVFSYLDLDDEI
SYFB_STAAC        ERSEGMICSLQE-IGISSNYIPKSFESGIYVFSE--AQVP------GTDALQALYLDDQV
SYFB_LISIN        EVSEGMICSLAE-LGFESKVVPKAYADGIYVLPE--HVET------GVSAITLLGLDDAI
SYFB_OCEIH        VESNGMICSLQE-LGLEEKYIPTDIAEGIFVFPEDEDIEV------GSKVDEWLNLTDAV
SYFB_SYNAS        ELSEGMLCSEEE-LGIG------EDTTGVMILPP--NLPL------GEDLADVLDLKDTV
SYFB_MOOTA        VVSEGMLCSAQE-LGLDVSLVSPEDREGIITLPP--DASP------GADAAEVLGLKDVV
SYFB_DESPS        IASAGMLCSERE-LGIG------EDHDGIMELPE--GMAH------GQRFIDAMELSDTF
SYFB_CARHZ        VVSQGMLLSAEE-LGLLER---KGAEPGLMLLPP--EAPV------GEKIEKVLELDDYL
SYFB_FUSNN        VESYGMLCSEAE-LGFTKE------SEGIIILPE--DAPI------GTEYREYMNLNDVI
SYFB_BDEBA        VDSAGMLCSLKE-LGLATE------SEGIAILPA--DAPV------GKAYAEYGGYDDVT
SYFB_THEMA        VISEGMLCSLEE-LGLEEK------SDRVYRFPDPVEL--------GVNVVEEYGLNERV
SYFB_AQUAE        VVSKGLLLSAQE-LGLEEK------SEGVLKIHEDFKP--------GTDANEILGFGEKI
SYFB_LEPIC        VKSSGMLCSEKE-LFLSEE------GNGVWILNGLDQAEV------GKTIRSFLYYNDII
SYFB_LEPBL        VKSSGMFCSEKE-LSLSEE------SSGVWILNGIEGAEI------GKTIRSFLYYEDII
SYFB_RICTY        EKSYGMLCSEEE-LLLSSDSN------GIIELPEYAVVGD-------NFTRYY-GLDDPI
SYFB_RICPR        QKSYGMLCSEEE-LLLSSNSD------GIIELPKDAVVGD-------NFTKYY-GLDDPI
SYFB_BRUSU        VESFGMMCSERE-LELSDEHN------GIIDLAENAPVGT-------SFAAYM-GLDDPI
SYFB_BRUME        VESFGMMCSERE-LDFSDEHN------GIIDLAENAPVGT-------SFAAYM-GFNDPI
SYFB_PELUB        VTSYGMLCSESE-LNLSNESD------GITELLPEKYNKK-------VGENYFPKKNLNV
SYFB_WOLTR        VLSEGILCSASE-LMLAQEKS-----KGIIELSDDYKVGN-------KFFNCD-----PV
SYFB_EHRCJ        VESYGMLCSNDE-LGIVDHRNS---KNGIIELPNTYNVGD-------TFFPCD-----PI
SYFB_BLOPB        KQSEGILCTFSA-LGI--TS---HTV-GIIELPINAPIGE-------NFYNYLRLN-DNI
SYFB_BLOFL        RKSEGVLCTFSM-LGL--NY---YTQKGIIELPIDAPIGC-------NFYDYLHFN-DNI
SYFB_WIGBR        YESCGIFCTYDQ-LKIFGLK---ETSKDIIVLDKNAIIGE-------DIKNYFFLN-DNI
SYFB_BUCAP        KLSEGMICSFFE-LGLF------NFCKDIIELPEDIPIGK-------KINDLFLLKKDTF
SYFB_BUCBP        KISEGMVCSFKD-LGIL------NIKNKIVEICSEVPVGT-------DISKFLWFDDDRI
Q057Y9_BUCCC      NNFCHHFGSYHL-LDIQ------KNNHKIIVLSKYVTVGL-------NFNDFFYKN-DYL
SYFB_MYCGA        MNSSGLLCSYADLNPQSSEYLSEYDSKNIIILDKANLGDT-------EVY-KYLNIDDTI
SYFB_MYCPN        IISDGMLCSYVDINPFSKHLIADGDDTHAIVLDNINRDEF-------GDYLSFLNLDDVV
SYFB_MYCMO        IISEGMLVGFDEMLGFEIKLVPKELSKNVIVL--DEANLN-------EDPIANLELHDYL
SYFB_MYCPU        TFSQGMLCSLEE-LGFDKSLIRDEFQDKIFLL--DKADLK-------QDPIDFFDLDDQI
C4XE68_MYCFP      VVSQGMFSGYSE-LGYDPNKLPFDKDDIILLNPNRYTSLK-------TDPMEYFGLNDYI
D3VQ30_MYCAA      VVSNGMLASYSE-LGYDSSLLPFDPNGVILLD-DSSINED-------LDPIKYFNLDDYI
SYFB_MYCS5        YKSQGMLASFSE-IGYDNSLLTD--KDQILVLPKNFASLN-------DDASEKLELNDYI
SYFB_MYCHJ        HISEGMLISAVE-LGFNKHLLNSELDQGVLVF-DPIFDLE-------SNPLKVLELDDLI
SYFB_MYCH2        HISEGMLISAVE-LGFNKHLLNSELDQGVLVF-DPIFDLE-------SNPLKVLELDDLI
SYFB_MYCH7        HISEGMLISAAE-LGFNKHLLNSELDQGVLVF-DPIFDLE-------SNPLKVLELDDLI
SYFB_PORGI        VESFGMICSEVE-IGVGSS------NDGTIVLPSDAPVGM-------PAAEYYHVESDYC
SYFB_CHLTE        EHSSGMICAADE-LGLSDD------HDGVMVLDEACEIGQ---------PLARYLETDTV
SYFB_SULDN        IESEGMICSAKE-IGLADI------NSGIIEIDSSIGKYK-----IGEEVSQNHLFSDDI
SYFB_RHOBA        -------------------------------------------------------DGDVV
SYFB_TROW8        HLSDGMIASEKE-LGVGDN------HDGILRLAEVFQGDELSKIREGDNALELLALTDSA
SYFB_CHLPN        VESQGMCCGADE-LGLDELQI---QERALLELPEATPLGE----------DLATVLGNTS
SYFB_UREPA        YVSNGMLCAYSEINPQATSFLTSTDLDGILVLDDNYDHYK--------TPNQIFNLDDVI
SYFB_ONYPE        VFSEGMLCALEE-LGISTKFLTPQEQEGIYLFDDPNDQIA-----LGSNALIPLGLDCFI
SYFB_MYCPE        VKSNGMICAYAE-LTTKTDVCSYDEIENIIELDNDAKLND-------IDPLKYIGLDDEI
B5Y860_COPPD      LLGFATVSSNGSEAGSPKEAGTSAGRDDLSDLVLLRNAPE-------GPLKEVLELPDML
SYFB_PORPU        -------------------------------------------------MVNIDGHKDYI
SYFB_PHATC        ---------------------------------------------------EINNEKQIA
SYFB_GRATL        -----------------------------------------------------SSNDDMI
C7LJX7_SULMS      -------------------------------------------------KNLNSFQEDYL
SYFB_MESFL        ILSEGMFCGFNE-IGLPNSVLTEDEQQDVYYIDSIYKNMDE---MVGREISEVLNFDDYT
                                                                              

SYFB_HELHP        IEVG--ITPNR-GDCLSVLGIARELATSYDLRLKHEVDMD---------NVVTLGLGRVL
SYFB_HELPJ        LEIS--LTPNR-GDCLSVLGIAREISAFYHTPLKPIKALN---------FTPTSDL---I
SYFB_DEHMC        LDLE--LTPNR-GDLMCVTGVARELGALIDRLPAISDPDF---------KATGPDIKEKI
SYFB_DEHM1        LDLE--LTPNR-GDLMCVTGVARELGALIDRLPSISTPDF---------KATGKDIKDKI
SYFB_PARUW        FEIS--LTPNL-GHCASIVGVARELSAATSHPLRYPHLVF---------KEEGNLINNSL
SYFB_DESVH        CDIA--ITPNR-ADCLSVLGLAREVALAFGLPLTMPALDL---------KEEGADASNAL
SYFB_DESAG        LDIS--ITPNR-ADCLSVLGLAREVALAFDLPLTMPQLEL---------REQGEDAGSDV
SYFB_SYNPX        LELA--ITANR-PDGLSMVGIAREVAALTGSALTLPVLTL---------K-PAHELLQAS
SYFB_GLOVI        LEVA--STANR-ADALSMVGIAREVAALTGGILRLPLVDA---------P-LVPR--GDL
SYFB_THETH        LDLE--VTPNR-PDALGLLGLARDLHALGYALVEPEAALK---------AEALPLPFALK
SYFB_DEIRA        LDVE--VTPNR-ADVLSALGLARDLAAYLNLELKEPQIPA---------APTQPGEIRVS
SYFB_MYCTU        FHLA--ITPDR-GYCMSVRGLARELACAYDLDFVDPASNS--------------RVPPLP
SYFB_CORGL        FDVN--VTPDR-GYALSARGLTRELASAFSLTFTDPAIEP---------AVAGIEVKVPA
SYFB_CUTAK        LDVD--VTPDI-GYCMSMRGIAREVAHAMSVHFRDPYDEE----------------PIGP
SYFB_BIFLO        LEIN--ITPDR-GYTLSYRGVAREYHHSTGAAYTDPAVAL---------NEKA-PEPADY
SYFB_ECOLI        IEIS--VTPNR-ADCLGIIGVARDVAVLNQLPLVQPEIVP---------VGATIDDTLPI
SYFB_PECAS        IEIS--VTPNR-ADCLGIIGVARDVAVLNQLALNEPTIEP---------VAATIQDTFPI
SYFB_MANSM        IEIS--LTPNR-ADCLSIAGVAREIGVVNQLAVTEPAINP---------VPVTSDEKVAI
SYFB_ALIF1        IDVD--LTANR-ADCFSIRGLAREVGVLNRADVTEPTIAA---------VATSIEDAVSI
SYFB_PHOPR        IDVD--LTANR-ADCFSIRGLAREVGVLNRADVTEPVIDA---------VAPSIDDTVSV
SYFB_IDILO        IDID--LTPNR-GDCLSIRGIAREVGVLNRLDVTVPESNE---------VTASIEDTLSI
SYFB_PSEPK        IEIG--LTPNR-GDCLSIAGLARDVSALYDTPVTRPVVPA---------VAAAHDEVRPV
SYFB_PSEPF        IEVD--LTPNR-GDCLSLAGLAREVGALYDAPVTRPVVMA---------VPAAHDEVRSV
SYFB_LEGPL        FDID--LTPNR-ADCFSILGVAREVAVLNKLPLIEQPIVT---------VPPAIDDGLRV
SYFB_LEGPA        FDID--LTPNR-ADCFSILGVAREVAVLNKLPLIEQPIVT---------VAPAIDDGLRV
SYFB_XYLFT        IEIK--LTPNR-ADCFSVRGIAFDVAAACASEVTPFHIDE---------IPAVSARTLPV
SYFB_XYLFA        IEIK--LTPNR-ADCFSVRGIAFDVAAACASEVTPLHIDE---------IPAVSARTLPV
SYFB_XANC8        IEIK--LTPNR-ADCFSVRGIAFDVAAACASEVAAFDAAA---------VAPVSTRTLAV
SYFB_XANOR        IEIK--LTPNR-ADCFSVRGIAFDVAAACASEVVAFDAGA---------VAPVSTRTLAV
SYFB_BURPS        FEIK--LTPNK-ADCLSVFGIARETAAITGAPLAAPDIRP---------VLAELTETLPV
SYFB_CUPNJ        FIIK--LTPNK-ADCLSIHGVAREVSALTGATLTLPDMKP---------VAVTIDDKLPV
SYFB_BORBR        FTLK--LTPNR-ADCLSILGVAREVAALTGTPLTAPAAEP---------VPVTIDHRLPV
SYFB_THIDA        VTLK--LTPNR-ADCLSLVGIAREVGAITGAEVRIPQASP---------VAPRIADTVEV
SYFB_NEIMB        FTLK--ITPNR-ADCLSIKGIAREVSALTGCAFRQPEIHT---------APITGSRKQPV
SYFB_LACJO        LDFD--ITPNR-ADTLSMEGAAYEVGAIVDEKPKVEPVVL---------KEDGPDWTNEL
SYFB_LACSS        IDLD--LTANR-ADALGIHGVAHEVAAIESLTPHFEDVAV---------SESDVQTKNQL
SYFB_STRP3        IELS--ITPNR-ADALSMRGVAHEVAAIYGKSVSFPEKNL---------QESDKATSEAI
SYFB_STRP8        IELS--ITPNR-ADALSMRGVAHEVAAIYGKSVSFPQKNL---------QESDKATSEAI
SYFB_STRPN        IELS--ITPNR-ADALSMCGVAHEVAAIYDKAVNFKKFTL---------TETNEAAADAL
SYFB_STAAC        MEFD--LTPNR-ADALSMIGTAYEVAALYNTKMTKPETTS---------NELDLSANDEL
SYFB_LISIN        LDMA--ITPNR-ADALSMNGVAHEVGAIIHQKPAQPTEPD---------VSEKGKADDFI
SYFB_OCEIH        LDLD--VLANR-PDALSMLGVAYEVAAVLDQPIELPTKNI---------DYIDEKVSDQI
SYFB_SYNAS        FDIG--ITPNR-SDCLSIIGVAREIAAITGKPLKLPEIYV---------TENAEDIQVSA
SYFB_MOOTA        LVLE--LTPNR-ADCLSILGVAREVAAITGAPIHLPATLP---------GEDGPEITGLA
SYFB_DESPS        IEVD--LTPNR-PDCASVIGTAREIAGKIGRPLQIPVKDR---------QIEAE--SRDF
SYFB_CARHZ        LELD--LTPNR-GDCLSVLGVAREVAALTGHRLKLAEPEL---------PLDNG--SCPV
SYFB_FUSNN        FELE--ITPNR-PDCLSHIGIAREVAAYYNRKVKYPMIEI---------TETIESINTMV
SYFB_BDEBA        FELK--VTANR-ADCLSHFGLAREVSTLFGKELKVPSSEL---------KTNGKSSKSEI
SYFB_THEMA        LDIE--ITPNR-PDCLSIIGVARELSALSGRPLNKPQPDV---------SFVDEDVQFDV
SYFB_AQUAE        IEID--ITPNR-GDMLSVRGVARDLSAIFRLPKKKPEE-----------PTYEETGEFFI
SYFB_LEPIC        FEVDNKSITHR-PDLWSHFGFARELASQLRLPIVFNPFES---------LWNFDLSVKLP
SYFB_LEPBL        FEIDNKSITHR-PDLWSHFGFARELASQLRLPITFNPFES---------LWNFDLSMKLP
SYFB_RICTY        FVIN--VTPNR-GDVLGVYGIARDLSAKGLGTLKKLELPE---------IKSTFFSKIKL
SYFB_RICPR        FVIN--VTPNR-GDVLGVYGIARDLSAKGLGTLKELELSE---------IKSTFFSKIKL
SYFB_BRUSU        IEIG--LTPNR-ADCTGIRGIARDLAAAGLGTLKNTLPDA---------VKGEGETPVKV
SYFB_BRUME        IEIG--LTPNR-ADCTGIRGIARDLAAAGLGTLKNTLPDA---------VKGEGETPVKV
SYFB_PELUB        IDIS--ITPNR-ADCLGVRGIARDLAAAGAGRLINQKEKK---------LDKKNKQTISV
SYFB_WOLTR        IDIN--VTTNR-GDCLSVHGIARDLAATGIGTLNSLIYSSAIPAHDTGIQDRSKSGMTRS
SYFB_EHRCJ        IEVS--ITPNR-GDCLGVYGIARDLAAAGLGKLKCI---------------GELSNHSNC
SYFB_BLOPB        IEIN--ITPNR-GDCLSVIGISREIAAINHLKLKKI-KIESII--------PTINDIIPI
SYFB_BLOFL        IDIN--ITPNR-GDCLSVIGLSREIAAINQCKLKKI-NIKSNV--------PNILDTIPI
SYFB_WIGBR        ICIK--VSHNR-CDCLNIIGLSRAISSEYNELLENK-LINKIN--------STKDYGFKI
SYFB_BUCAP        IKVA--VTPNR-PDGLSILGIARNIAAINNLKKIRL-KKRILP--------TTIEDQFPI
SYFB_BUCBP        IKVS--SAPNR-ADGMSILGIARDMSALNNLCLPTL-KEYHIN--------ITNHEKFRI
Q057Y9_BUCCC      MKFF--VPFNR-IDLRSLWGLSREIAILNKLKIPKLIRIDNIQ--------NKKKKQINC
SYFB_MYCGA        FDIS--IPSSR-PDWHGIRFLAKELAAYLNLKYVELIGRA----------KQTDFHQINF
SYFB_MYCPN        FEVT--LPTNR-SDLQSLIFLAKELAAVLK-RPVFLEQKT----------TMTLREFYRF
SYFB_MYCMO        IDLA--ILPNR-SDAISYLVMAKELAAFFGTK-------------------IDNDLICLK
SYFB_MYCPU        VDVS--ILSNR-SDANGYFIMALELSAFFETKTNF---------------EIKNEIFKIH
C4XE68_MYCFP      IDIT--TPANR-GDSNSYYVLAQEIAAYYQTPFKWFDYKK----------NYKTGIHKQI
D3VQ30_MYCAA      IDIT--TPANR-AETNSYYVLAMELAAYYKTKFVWPNLLP----------KDNYRFRSNI
SYFB_MYCS5        FELS--ITTNR-NEINSYYFLAKELAAYYNTKFSCEFLDA----------KLKQSFESSF
SYFB_MYCHJ        LDIK--LLWNR-PDGNSYLVLANELAAFFKTDFSL----------------INKEISGKF
SYFB_MYCH2        LDIK--LLWNR-PDGNSYLVLANELAAFFKTDFSL----------------INKEISGKF
SYFB_MYCH7        LDIK--LLWNR-PDGNSYLVLANELAAFFKTDFSL----------------INKEITGKF
SYFB_PORGI        IEVD--ITPNR-VDATSHYGVARDLAASLKRNGVPAELKLPEV------NLPTDIIDSRI
SYFB_CHLTE        LDIA--VTPNR-PDALSHLGVARELADCNEIVYPQAPVIE------------FTRGGGLI
SYFB_SULDN        IEVE--LTANR-GDCLSIRGVARDLSAAFDKPLRERKIQE----------DEDKRVGIGR
SYFB_RHOBA        IDLE--VTSNR-GDCLGHIGVAREIAALTDQKLKIPTIEYQ---------ESGSAVDDSL
SYFB_TROW8        VAVS--ITPDR-GYAMSIRGIAREYALANNIPFSDPLPDD-----------VLPAGGLSI
SYFB_CHLPN        LEIS--LTPNL-GHCASFLGLAREICHVTQANLVIPKEFS-----------FENLPTTAL
SYFB_UREPA        LDLS--IPSNR-NDLNGYFWIAKELCAYFDFEYVVDATIN------------HRPHKEII
SYFB_ONYPE        LELG--LTPNRVGDLLSHLGFAKDLKAVLSSQSSNNNQETKSTNYKTKNSEDQTNPDFFA
SYFB_MYCPE        LDLS--VPSNR-NELNGVIPIAYDLISLYFPKSKIDFSLK----------NIENQKKTSI
B5Y860_COPPD      IKLS--VLPNR-GDLSHLFGLAREIACGMGLTLVVPTFQH-----------KLEKRNGLV
SYFB_PORPU        LDVT--STANR-SDVLSMIGLSREVSALTQADIVKTADIP----------SAGLFDNIST
SYFB_PHATC        LEIS--STANR-SDSLSIQGISVEIASLFNKQPKVCKYFNSS-------LNWQQKIKNLT
SYFB_GRATL        FDVT--TTANR-QDILCTVGLAREISSIFNRDLKYKLYKD-----------SIAISTHCL
C7LJX7_SULMS      IELN--IPPNR-RDVMSHYGIARDLNIALKSRGFKSKMKDLPSVSLFKKDKKINFKNLKC
SYFB_MESFL        FEVD--LTLNR-SDALAAKQLVKEIANYFDLKINNNEHKV---------KFEKPTESITI
                    .                                                         

SYFB_HELHP        QILCD-----------------EKIEAHLLYRVVEVKQAYLPLDIALCLARNGSLVD-DI
SYFB_HELPJ        TLSAD-----------------ENIESHLAYYLICNHSLKTPLNIKLSLAHNNALSE-ND
SYFB_DEHMC        EIEIN--------------NSKLCTRYTASLIEGIKLGESP-DWLKERLIACGMRPI-NN
SYFB_DEHM1        NIEIK--------------NTKLCTRYTASLIEGIKIGESP-DWLKERLIACGMRPI-NN
SYFB_PARUW        TLDIE--------------AKEACSRYTCRVIKNVKVGASP-DWLKAKIEKSGLRSV-NN
SYFB_DESVH        RIDIP--------------DASLCPLFHGRVLEGA-AVRKSPAWMRYRLIAVGVRPI-SN
SYFB_DESAG        TIAIA--------------DGAQCPVYQGRIIEGI-STCPSPLWMRHRLKSVGVRPI-SA
SYFB_SYNPX        AASAE--------------AMQAGGLYGITLIEGVDGSQVSPTWVQQRLERAGINRV-NA
SYFB_GLOVI        AARIA--------------EPEACPVYTATLLEEV-AVGPAPDWLRERLEKAGMRPI-NN
SYFB_THETH        VEDPE-----------------GAPHFTLGYAFGLR-VAPSPLWMQRALFAAGMRPI-NN
SYFB_DEIRA        LPDRGRVLDRDPQGKLR----FGCDHFAARAVSGLQ-NGPAPLWMQRRVSLAGMRSI-DL
SYFB_MYCTU        IEGPAWPLTVQPE--------TGVRRFALRPVIGIDPAAVSPWWLQRRLLLCGIRAT-CP
SYFB_CORGL        VEGSLINVELREE--------TKAIRFGLRKVSGIDPAAESPFWMQRELMLSGQRPV-NA
SYFB_CUTAK        VLGPV-AVDVQSD--------ACSQFIAL-PVSGMNLGAPTPRFITDRITRAGMRPI-NL
SYFB_BIFLO        QPGTPVDIDVEIDDNNPIHGVPGCDRYYARIVKDFNPNAHTPNWMRRRLIRAGMRSI-SL
SYFB_ECOLI        TVEAP----------------EACPRYLGRVVKGINVKAPTPLWMKEKLRRCGIRSI-DA
SYFB_PECAS        QVEAP----------------QACPRYLGRVVKGINVKAATPLWMREKLRRCGIRSI-DP
SYFB_MANSM        NVLAP----------------EACPRYLLRSVKNVNVNAETPVWMKEKLRRCGIRSI-DP
SYFB_ALIF1        EVKAT----------------EACPRYLGRVIKNVNAKAETPIWMQEKLRRCGIRSI-DA
SYFB_PHOPR        EIKAT----------------DACPRYLGRVVKNINVKAESPIWMQEKLRRCGIRSI-DA
SYFB_IDILO        SLSAA----------------EQCPRYLGRVIKGVDLTRPTPVWMTEKLRRSGIRSI-DP
SYFB_PSEPK        EVSAP----------------AACPRYLGRVIRNVDLSKPTPLWMVERLRRSDVRSI-DA
SYFB_PSEPF        EVLAP----------------AACPRYLGRVIRNVDLSRPTPLWMVERLRRAEVRSI-DA
SYFB_LEGPL        NLIHS----------------EACPRYCGRIIRNLNLEAKTPLWMAERLRRGGIRTL-HP
SYFB_LEGPA        NLIHS----------------EACPRYCGRIIRNLNLEAKTPLWMAERLRRGGIRTL-HP
SYFB_XYLFT        ELHAG----------------ANAPRYCGCVIEGIDPAAPTPVWMAERLRRSGIRPV-SL
SYFB_XYLFA        ELHAG----------------ANAPRYCGCVIEGIDPAAPTPVWMAERLRRSGIRPV-SL
SYFB_XANC8        ELNAG----------------SEAPRYCGRVIEGIDPAATTPVWMAERLRRSGVRPV-SL
SYFB_XANOR        ELDAG----------------KDAPRYCGRVIEGIDPAAKTPVWLAERLRRSGVRPV-SL
SYFB_BURPS        KISAP----------------DLCGRFSGRVIRGVNARAKTPHWMVERLERAGQRSV-SA
SYFB_CUPNJ        KVSAP----------------DLCGRFSGRVIRGVNARAATPAWMVQRLERSGQRSI-SA
SYFB_BORBR        AIQAP----------------DLCGRFAGRVIQGVNARAATPEWMKTRLERAGQRSV-SA
SYFB_THIDA        TVAAS----------------DACSRYLGRVVRGIDAQATTPRWMAERLERGGIRPL-LA
SYFB_NEIMB        QINAP----------------ADCGRFISRVIENVNARATTPDWMKQRLERSGIRSI-SA
SYFB_LACJO        DVQV---------------DEKLAPKFYLRKISNVKIG-ESPLWMQRRLWNAGIRPI-NN
SYFB_LACSS        SAQVA--------------DEQLAPTYHLRMLQNVTVQ-PSPLWLQTRLWNAGIRPI-NN
SYFB_STRP3        EVAI---------------ASDNVLTYASRVVENVKVK-PSPQWLQNLLMNAGIRPI-NN
SYFB_STRP8        EVAI---------------ASDKVLTYASRVVENVKVK-PSPQWLQNLLMNAGIRPI-NN
SYFB_STRPN        SVSI---------------ETDKAPYYAARILDNVTIA-PSPQWLQNLLMNEGIRPI-NN
SYFB_STAAC        TVTIE--------------NEDKVPYYSARVVHDVTIE-PSPIWMQARLIKAGIRPI-NN
SYFB_LISIN        SVEVE--------------NPTETPYYAIKMVENIEIK-ESPLWLQTKLMKAGIRPH-NN
SYFB_OCEIH        EINIE--------------SKDLNPYYAAFMVKDVVIK-PSPLWMRNYLMASGIRPI-NN
SYFB_SYNAS        SVQIL--------------DPDLCPHYTARMIRDVVVG-PSPQWMRLRLEAVGLRSI-SN
SYFB_MOOTA        TVEIT--------------APDLCARYVARLVQGVRIG-PSPAWLQAFLRAAGMRPI-NN
SYFB_DESPS        SVEVE--------------SSELCPRYTAKLIKNVTVG-KSPWWLRKLLVSVGMRPI-NN
SYFB_CARHZ        SIEIQ--------------NPELCGRYMGIVIKNVKVG-PSPLWLEQRLRKAGIRPI-NN
SYFB_FUSNN        KVDIE--------------DKDRCKRYMGRVIKNVKVQ-ESPDWLKSRIRAMGLNPI-NN
SYFB_BDEBA        ALDVK--------------AFDLCPRYAGRFLKGVKVG-PSPAWLKARLESVGMNSI-NN
SYFB_THEMA        EIEDV----------------EGCPRYSARIMKGVTVK-DSPLWMKARLVAAGVRSL-NN
SYFB_AQUAE        EIED-----------------EDCKRYRGVVIEGVEIK-ESPLYIKKRLWQCGIKSI-NN
SYFB_LEPIC        KVLEN----------------QNAHSYYASSISGVSVF-PSKRKFQSRLQKCGVRVI-NN
SYFB_LEPBL        RVLEN----------------QNAHSYYASSICEVFVI-PSKRKFQSRLQKCGIRVI-NN
SYFB_RICTY        NVHDKA----------------ACPLFTFREIRNLKNK-PSPSWLQQLLKNVGIKTI-SS
SYFB_RICPR        NVHDKE----------------ACPLFTFREIRNLKNK-PSPNWLQQLLKNVGIKTI-SS
SYFB_BRUSU        ILDQDAG-------------NPFCTGFALRMVKGVKNG-PSPKWMQQRLKAIGLRPI-NA
SYFB_BRUME        ILDQDAG-------------NPFCTGFALRMVKGVKNG-PSPKWMQQRLKAIGLRPI-NA
SYFB_PELUB        KIENEK--------------NQACISFGSCLIKGVKNT-ESPEWLKDKIIALGQKPI-SA
SYFB_WOLTR        SSINVKV-------------IDGESFISGVYISNVRNK-ESPRWLKDRLESVGMRSI-SA
SYFB_EHRCJ        SSPIEVS-------------VQVDGIVKGRYIKGIKNC-ESPKWLKDYLLVCGINSI-SF
SYFB_BLOPB        SIEVP----------------DTCPQFFGRILKNIHITSPTPLWIAEKLRRCGICSV-NI
SYFB_BLOFL        IIETP----------------HDCPKFLGKVLKNIDITIPTPLKIQEKLIRCGIQPI-NI
SYFB_WIGBR        KINEP----------------EACPKYLTRKIKYINLNVNTPIWISERIRRSGFKPK-NI
SYFB_BUCAP        TINTE----------------KQSVNYFGRIIQNVNLNVDTPFWMKKKLFFCDLLSD-NI
SYFB_BUCBP        LINIP----------------DVCLNFIGRTIQSVNLNRQTPLWILERLRRSSISSE-NV
Q057Y9_BUCCC      NINIE----------------NIPIQYFFCELYKINLDSILPFKMQIRLLQSNLLTD-NI
SYFB_MYCGA        KVLDET---------------DNKAKYFGGIHLRNYQLQQSSWNTKGILINNHIKPI-ND
SYFB_MYCPN        PLNLRN---------------RAQANFFGGLFLRDVAITSSPWTTKGLLINQELRPV-NC
SYFB_MYCMO        NLRVSK---------------INSNLEGIFVKSKT---LELKLYDKYLLLKSHLKLT-NT
SYFB_MYCPU        PNLKVD---------------ETNTLDFVLIEPQKEL-KKISLKDQILIMKSNIKTF-ND
C4XE68_MYCFP      QKVDNG---------------EANALSFLECRFKHK--DTKIEDMLFLAKHNVEAKN-VW
D3VQ30_MYCAA      KVSKN----------------EATELTFFEARLKNN--KTSLKDILFLAKHGINAKG-LY
SYFB_MYCS5        KFEGNF---------------LDKNYSFTLLEAKGKV-STSFEEKLLLAKHKIDSKF-NP
SYFB_MYCHJ        YSELKI---------------INKTDSKIFALEIQKL-PKLALVDIFLLLKSEVKIG-NL
SYFB_MYCH2        YSELKI---------------INKTDSKIFALEIQKL-PKLALVDIFLLLKSEVKIG-NL
SYFB_MYCH7        YSELKI---------------INKTDSKIFALEIQKL-PKLALVDIFLLLKSEVKID-NL
SYFB_PORGI        EVKVAD--------------ATACPRYQGLVIRDITVG-ESPEWLRNRLQAIGLRPI-NN
SYFB_CHLTE        EVQDE----------------ESCPYYTATVIKGVTVG-PSPRWLARRLEQIGLRPK-NN
SYFB_SULDN        ILSLSH---------------ENNLGVNIRYKAVDFKNLTLPFIVRLRLSQLDDKKE-SD
SYFB_RHOBA        AVTNEM--------------PEACPRYTARVIRGVKVG-DSPEWLQESLKAVGIGVV-NN
SYFB_TROW8        DLRCK------------------PNAFFTLLIQEIENN-QTPQWMVRRLQLAGIRSV-CP
SYFB_CHLPN        DMGNDP---------------DICPFFSYVVITGISAQ-PSPIKLQESLQALKQKPI-NA
SYFB_UREPA        DVRIL----------------SDDVNSYGIIEVKNIQNYILKWNTKSILINNQIKVL-NN
SYFB_ONYPE        NLPQSPLKVQIE--------NDSCYEYNACILENIKIK-PSPLWLRNALLQSGINPI-NN
SYFB_MYCPE        KINID----------------KELCRFFGVIDVSNVEIKTSNWKIKSFLLNCGITPI-NT
B5Y860_COPPD      SIQTD-----------------GCLVYVGMLLENLRVE-ESPWWLKLELMRFGQRCI-NN
SYFB_PORPU        IISDDS--------------LLNCSYYVSAIMDNIVIQ-DSPKWLKNRLYSCGFISQ-NL
SYFB_PHATC        TIRTSK---------------TECLMFTAVILEGLEDL-TVPKWIQNKLVSSGIMPL-NN
SYFB_GRATL        NILNS-----------------VSLLDLSIVNVNYFYNNRSPLWLQYYLSSYNIKSL-NL
C7LJX7_SULMS      FIEKN----------------KKCIRYSYTTLSNIKVL-DSPNWLKNYLNNIGCIST-NN
SYFB_MESFL        DLNKKV--------------EDEVNTVSHTFIGLKNTNTPFDSSHDVWLKHSNVKSAQNK
                                                                              

SYFB_HELHP        MCNFLEYGTYMTGVILNAYKLYDCENKDI--------------------------VLDNG
SYFB_HELPJ        LNNFIEFSAHFSGVILNAYSLNKTP-----------------------------------
SYFB_DEHMC        VVDATNYVMLEFGQPLHAFDYDQIKSR---------------------HIIVRPAAEGE-
SYFB_DEHM1        VVDATNYVMLEFGQPLHSFDYDQIKSK---------------------HIIVRPAAEGE-
SYFB_PARUW        IVDVTNYVLLEMGHPLHAFDYDLVKGK---------------------KIVVRMAQEGE-
SYFB_DESVH        IVDVTNYILMELGQPLHAYDLDLLA---------------------GGRIEVSAAREGE-
SYFB_DESAG        IVDVTNYILMELGQPLHAFDLDLLE---------------------GARIVVETAAEGE-
SYFB_SYNPX        VVDITNVVMLEQGQPLHAFDADALEQLTGKPVN-------------AASFGLRQAREGE-
SYFB_GLOVI        VVDVTNYVLLEWGQPLHAFDADRLA---------------------AGTLGVRFAHKGE-
SYFB_THETH        VVDVTNYVMLERAQPMHAFDLR-FVGEGI--------------------AVRRAR-EGE-
SYFB_DEIRA        IVDTSNYVMLELGQPTALYDRRDVAGDGL--------------------VVAFGLREGE-
SYFB_MYCTU        AVDVTNYVMLELGHPMHAHDRN--RISGT--------------------LGVRFARSGE-
SYFB_CORGL        ATDVTNYVMLLLGQPMHAFDAA--KVTGD--------------------LVVRNATAGE-
SYFB_CUTAK        VVDVTNYVMLESGQPLHAYDAD--NVSGT--------------------IVVRKAHEGE-
SYFB_BIFLO        AVDVTNYVMLDLGQPMHAYDLD--KLEGP--------------------IVVRRANEGE-
SYFB_ECOLI        VVDVTNYVLLELGQPMHAFDKD--RIEGG--------------------IVVRMAKEGE-
SYFB_PECAS        VVDVTNYVLLELGQPMHAFDLD--RLNGS--------------------IIVRMAEEGE-
SYFB_MANSM        IVDITNFVLLELGQPMHAFDAA--KLAQP--------------------VQVRFAADGE-
SYFB_ALIF1        IVDITNYVMLEQGQPMHAFDLA--KIDGG--------------------IVVRMAEQDE-
SYFB_PHOPR        VVDITNYVMLEQGQPMHAFDLS--KIDGG--------------------IVVRLAEQGE-
SYFB_IDILO        VVDVTNYVLLELGHPMHAFDLD--SLEGN--------------------IDVRLAKPKE-
SYFB_PSEPK        AVDITNYVMLELGQPMHAFDLA--EINGG--------------------IRVRMAEEGE-
SYFB_PSEPF        AVDITNYVMLELGQPLHAFDLA--EINGG--------------------IRVRMAEEGE-
SYFB_LEGPL        VVDVMNYVMLELGQPMHAFDLS--KINGE--------------------INVRYSASGE-
SYFB_LEGPA        VVDVMNYVMLELGQPMHAFDLA--KINGE--------------------INVRYSASGE-
SYFB_XYLFT        LVDITQYVMLELGQPMHAFDVD--TLRGP--------------------IGVRLSRNDE-
SYFB_XYLFA        LVDITQYVMLELGQPMHAFDVD--TLRGP--------------------IGVRLSRNDE-
SYFB_XANC8        LVDITQYVMLELGQPMHAFDLD--TLHGP--------------------VGVRRSRAGE-
SYFB_XANOR        LVDITQYVMLELGQPMHAFDLD--TLHGP--------------------IGVRRSCAGE-
SYFB_BURPS        LVDISNYVMFELGRPSHVFDLD--KIHGG--------------------IDVRWGKRGE-
SYFB_CUPNJ        MVDISNYVMLELGRPSHVFDLD--KIHGG--------------------LDVRWGRKGE-
SYFB_BORBR        LVDISNYVMLEVGRPSHVFDLD--KIGGD--------------------LSVRWAREGE-
SYFB_THIDA        PIDVTNYVLLELGQPMHAFALS--RLSGG--------------------IEVRLARAGE-
SYFB_NEIMB        LVDIGNYVMLEIGQPMHVFDAD--KLSGS--------------------LHIRRAREGE-
SYFB_LACJO        VVDVTNYVMLLTGQPMHAYDARTFKDG---------------------KLEVRKANKNE-
SYFB_LACSS        LVDVTNYMMLTYGQPLHAFDADTLTGDHK-------------------QIEVRLAKTGE-
SYFB_STRP3        VVDVTNYVLLYFGQPMHAFDYDKFEDH---------------------KIVTRAARQGE-
SYFB_STRP8        VVDVTNYVLLYFGQPMHAFDYDKFEDH---------------------KIVARAARQGE-
SYFB_STRPN        VVDVTNYILLYFGQPMHAFDLDTFEGT---------------------DIRVREARDGE-
SYFB_STAAC        VVDISNYVLLEYGQPLHMFDQDAIGSQ---------------------QIVVRQANEGE-
SYFB_LISIN        VVDVTNYINLLYGQPLHSFDYDKIGSK---------------------KIVVRSAKDQE-
SYFB_OCEIH        IVDITNYVLLEYGQPLHAFDFDRFASN---------------------QIVIRRGVEGE-
SYFB_SYNAS        VVDVTNFVMMELGQPLHAFDYRFLEEG---------------------RIVVRRSTEGE-
SYFB_MOOTA        VVDITNFIMLEMGQPLHAFDYDLLEGH---------------------RIIVRRAGPGE-
SYFB_DESPS        IVDITNFVMLEYGQPLHAFDFKKVAGN---------------------KIVVRLPRENET
SYFB_CARHZ        IVDVTNYILLEYGQPLHAFDLDKLASP---------------------EIIVRNARAGE-
SYFB_FUSNN        IVDITNFVMFEYNQPMHAFDLDKLEGN----------------------ITIRAAKKNE-
SYFB_BDEBA        IVDVTNYVMLELGQPLHAFDAAFINGKK---------------------IIVDRAVAGE-
SYFB_THEMA        VVDATNYVMIELGHPVHAFDLNRLKNK---------------------RIVVKSAKGGE-
SYFB_AQUAE        VVDITNYVMLRDGQPLHAFDLSKVEG----------------------GIIVRSAKKGE-
SYFB_LEPIC        VVDVSNYVMLEMGQPTHFFDKKFLENQGG------------------ISLEVSFAKKGE-
SYFB_LEPBL        VVDVSNYVMLEMGQPTHFFDKRFLESQGG------------------VSLEVSYAKKGE-
SYFB_RICTY        LVDITNYIAYSFGQPIHVYDADRIYGALSVGRDCNC-KVISYKNHEIATAVLKSSNDTA-
SYFB_RICPR        LVDVTNYISHSFGQPIHAYDADKIYGGISVDCYIRSDKVISCKNHEMATAVLQFSNDSA-
SYFB_BRUSU        LVDITNYVTFDQGRPLHVFDAAKVKGNLTVR----------------------TARDGE-
SYFB_BRUME        LVDITNYVTFDQGRPLHVFDAAKVKGNLTVR----------------------TARDGE-
SYFB_PELUB        IVDITNYIMFDLNRPLHAYDVDKIDKAIVVR----------------------NSKKGE-
SYFB_WOLTR        IVDITNYIMMSFGRPMHAYDAKKIEGKLIVR----------------------KANNGE-
SYFB_EHRCJ        VVDITNYIMLSFNRPLHVYDANKIKNKLIFK----------------------KADNQT-
SYFB_BLOPB        VIDIVNYVLLELGHPIHVFDYKKIDGNIIR---------------------IRFSKIGEI
SYFB_BLOFL        ITDIANYVLLELGQPVRIFDYEKIDKNIIY---------------------VRFSKPGET
SYFB_WIGBR        IIDIINYVFIETGQTIKIFDADKISGNIT----------------------VRFSKEKES
SYFB_BUCAP        IENILNYILIEIGQPLNILNADKIDDVIEI---------------------RMAIK--KE
SYFB_BUCBP        LVDIINYVLIELGQPIFSFNIHGIVQNIII---------------------RTARD--NE
Q057Y9_BUCCC      IENIINYIFIETGYWFHVFDLDHISKNLYI---------------------KSIKK--KT
SYFB_MYCGA        LVDLSNLIPLFVANPIHIHDADKIVGDVRL-----------------------VQATKKE
SYFB_MYCPN        FVDQANMVTVYTGQPIHCHDADKIHGSVEL-----------------------KLATQLE
SYFB_MYCMO        YKDLENLILIHTGMPIHFLNLKS-LEKVNI-----------------------VSKSSS-
SYFB_MYCPU        LVDLTNLNLIMNAMPTHVYDKDK-ISNEIS-----------------------VKKVSQE
C4XE68_MYCFP      AIDVTNLNLIYTGAPTHVYDRSE-IGEELT-----------------------CKKYSGK
D3VQ30_MYCAA      AIDLTNIALLVAGAPCHVYDKNK-IGKSLS-----------------------CSKFSGE
SYFB_MYCS5        AVNLTNLVLINLGIPIHVYDKAKLKSTKFS-----------------------VGLYNGK
SYFB_MYCHJ        AQNFSNFILIYTGQPSYCLQLEK---HQQK-----------------------VELIEQK
SYFB_MYCH2        AQNFSNFILIYTGQPSYCLQLEK---HQQK-----------------------VELIEQK
SYFB_MYCH7        AQNFANFILIYTGQPCYCLQLEK---NQQK-----------------------VELIEQK
SYFB_PORGI        IVDITNYVLHEFGQPLHAFDLAFIKGDR----------------------VHVQTVAEGT
SYFB_CHLTE        IVDITNYILHSFGQPLHAFDYHQLAGSRIV-----------------------VRSDAES
SYFB_SULDN        VESLMLYATHSSGVILRAYDYA-------------------------------LFCAKDE
SYFB_RHOBA        VVDVTNYVMMECGQPLHAFDLAKVGEGK---------------------IVVRPGKEKE-
SYFB_TROW8        VVDITNYVMVETGQPLHAYDYDAIQGSLC----------------------VRTADKKE-
SYFB_CHLPN        IVDITNYIMLSLGQPLHAYDASHVALDSLR----------------------VEKLSTPE
SYFB_UREPA        FADNMNFLTLLTANPLHAFDARKISGQIVV-----------------------KNAEEDA
SYFB_ONYPE        VVDITNLILIEYGIPLHAFDSENIKQIKV------------------------RKALPQE
SYFB_MYCPE        IVDITNLNAIITSVPCHAYDKDKLGKEIAV-----------------------SLNAHKE
B5Y860_COPPD      VVDLTNYFLFNYGQPMHAFDFDTLTDHRIV---------------------VRQAKPGE-
SYFB_PORPU        IIDISNYIMLKWGQPINIIDLKKIADTNTES----------------YIEITSNFCSSKQ
SYFB_PHATC        LVDFQNYILLETGYPFAFYDLDKVYSKVRTP----------------TFSLSIEKAENGS
SYFB_GRATL        LTDIPQYIYLKWGQSIEIFDKNK-----------------------------ISSVPIQY
C7LJX7_SULMS      ILDIENFILYELGKPIRIYDLDKIKNFSL-------------------------SLKESP
SYFB_MESFL        FENIANMATLISGQPFILIDADKVNGE---------------------------------
                    .                                                         

SYFB_HELHP        LVAQLRIKKDENGLGAVFAHQ----------------------------KLSIIGVSYGE
SYFB_HELPJ        --IDLIIKNDENNLESVYINHQ--------------------------KRSTIVIKHQDQ
SYFB_DEHMC        VLTTLDGVERKLSPDMLLITEP-----------------------DRIIALAGVMGGENT
SYFB_DEHM1        VLTTLDGVERKLSPDMLLITEP-----------------------DKIIALAGVMGGENT
SYFB_PARUW        IFETLDGKERILKDSHLVIADS-----------------------EKPIAIAGVMGGRNS
SYFB_DESVH        RLTTLDGVERVLTSNDLLIRDG-----------------------EKPVGLAGVMGGAET
SYFB_DESAG        RFTTLDGQERVLKASDLLIRDG-----------------------AKAVALAGVMGGANT
SYFB_SYNPX        AFIGLDGRELSLVARAQVVTCH-----------------------DLPIALAGVMGSKAS
SYFB_GLOVI        QLVTLDGTERPLTPANLLITAG-----------------------ERPVALAGVMGGEAT
SYFB_THETH        RLKTLDGVERTLHPEDLVIAGWRG-------------------EESFPLGLAGVMGGAES
SYFB_DEIRA        TVKDLLGNTHQVGPEDLLILDAGMSDEPVMTVAEAFASAGQPKEGSHVLGIAGIMGGDHG
SYFB_MYCTU        TAVTLDGIERKLDTADVLIVDD-----------------------AATAAIGGVMGAAST
SYFB_CORGL        KFETLDHVKRTLNEEDVVITDD-----------------------NGIQSLAGVMGGLTS
SYFB_CUTAK        HLLTLDDTDRTLDPDDLVIADD-----------------------SGAIGLAGVMGGAAT
SYFB_BIFLO        KLTTLDGKEHDLSVEDLLITDSPNGE-----------------RGSRILGLAGVMGGLYG
SYFB_ECOLI        TLVLLDGTEAKLNADTLVIADH-----------------------NKALAMGGIFGGEHS
SYFB_PECAS        TLTLLDGNEVKLNADTLVIADQ-----------------------QNALAMGGIFGGEHS
SYFB_MANSM        ELVLLDGTTAKLQSNTLVIADQ-----------------------TGPLAMAGIFGGQAS
SYFB_ALIF1        KLTLLDGNEAKLNDNTLVIADQ-----------------------NKALAIAGIFGGQES
SYFB_PHOPR        KLTLLDGNETELNSNTLVISDH-----------------------TKALAIAGIFGGKDS
SYFB_IDILO        QLTLLDEQLVELDEDTLVIADE-----------------------KKALAMAGVYGGKNS
SYFB_PSEPK        KLVLLDGQEVALRADTLVIADH-----------------------TRALAIAGVMGGEHS
SYFB_PSEPF        KLVLLDGQEVSLRSDTLVVADH-----------------------TRALAIAGVMGGEHS
SYFB_LEGPL        QLELLDGQEVVLNDNVLVIADK-----------------------EKPLAMAGIMGGANS
SYFB_LEGPA        QLELLDGQEVVLNDNVLVIADK-----------------------EKPLAMAGIMGGANS
SYFB_XYLFT        ALKLLDGRTVVLDNDFLVVTDA-----------------------DQPIALAGLIGGWET
SYFB_XYLFA        ALKLLDGRTVVLDNDFLVVTDA-----------------------DQPIALAGLIGGWET
SYFB_XANC8        QLALLDGREVTLDDSFLTITDA-----------------------DRPVALAGLMGGLDT
SYFB_XANOR        QLALLDGRQVTLDDSFLTIADA-----------------------GRPVALAGLMGGLDT
SYFB_BURPS        SLKLLNGNTIELDETVGVISDG-----------------------AQVESLAGIMGGDST
SYFB_CUPNJ        QIKLLNGNTIEVDEQVGVIADD-----------------------KEIESLAGIMGGDST
SYFB_BORBR        TLELLNGQAVALDPKVGVVVAG-----------------------EQVESLAGIMGGEAT
SYFB_THIDA        TLALLSGQTVELSPDMLVIADA-----------------------SGPVALAGIMGGQAT
SYFB_NEIMB        TLECLNEKTVSLSENTLVVADE-----------------------KGVLSLAGLMGGAAS
SYFB_LACJO        KLTLLNDKEVELDPNDIIITDG-----------------------QKPVMMAGVMGGKNS
SYFB_LACSS        KLTTLDEAEHDLTNEDIVITDG-----------------------NQPIALAGVMGGFNS
SYFB_STRP3        SLVTLDGEKRELTTEDLVITVA-----------------------DKPVALAGVMGGQAT
SYFB_STRP8        SLVTLDGEKRDLTTEDLVITVA-----------------------DKPVALAGVMGGQAT
SYFB_STRPN        KLVTLDGEERDLAETDLVITVA-----------------------DKPVALAGVMGGQAT
SYFB_STAAC        KMTTLDDTERELLTSDIVITNG-----------------------QTPIALAGVMGGDFS
SYFB_LISIN        EITTLDGEKRILQTGHTVITNG-----------------------TEPIAIAGVMGGEFS
SYFB_OCEIH        VIQTLDEQERKLTEDNLVITNG-----------------------SEPVALAGVMGGANS
SYFB_SYNAS        KFISLDEKERVLNANTLMICDG-----------------------VKPVAIAGIMGGFNS
SYFB_MOOTA        KITTLDGVERELDPEMLVIADA-----------------------ARPVAVAGVMGGLAT
SYFB_DESPS        EITTLDGTKREISAEMLLICDA-----------------------DKPIAVAGVMGGANS
SYFB_CARHZ        KITTLDGVERELTSEMLVIADR-----------------------EKPIAVAGIMGGQNT
SYFB_FUSNN        EITTLDGVDRVLKNGELVIADD-----------------------EKAIAIAGVIGGQNT
SYFB_BDEBA        KFITLDGTEIALNGAELTIRDV-----------------------NHPVCLAGVVGGKNS
SYFB_THEMA        RVLLLDEKEYELKGGEVLITDG-----------------------ENVLALGGIMGGMES
SYFB_AQUAE        KIITLDGEERELDEDILVIADR-----------------------EKPLAVAGVIGGLES
SYFB_LEPIC        SFALLDETSPALEEEVLLIRNQ-----------------------GKPVAIAGVMGGKES
SYFB_LEPBL        SFALLDETSPSLEEEILLIRNQ-----------------------GRPVAVAGVMGGKES
SYFB_RICTY        NFYAINGKEYLLTENDLTIKD-----------------------ESGIQGLAGIICGAKS
SYFB_RICPR        NFYAINGKGYLLTENDLAIKD-----------------------ESGIQGLAGIIGGAKS
SYFB_BRUSU        TILALDQREYKLNAGMYVIAD-----------------------ENGPESIAGIMGGEHS
SYFB_BRUME        TILALDQREYKLNAGMYVIAD-----------------------ENGPESIAGIMGGEHS
SYFB_PELUB        TFEALDNKEYKLEDEMCVISD-----------------------ASGVLGLGGIIGGTRT
SYFB_WOLTR        KFTGLNGKEYLLNNDISVISD-----------------------NNNIHAIAGIIGGKCS
SYFB_EHRCJ        EFYALNDKKYILGTENIVAVDL----------------------ENSIHSVAGVIGSKLS
SYFB_BLOPB        LTLSDNN-SLKLLPNTIVISDC-----------------------KKPLSIAGTITPNKY
SYFB_BLOFL        LTLSENNINIKLFSKTLVISDV-----------------------RKPLAIAGVITGNQS
SYFB_WIGBR        MMISKNK-KIIIQKNTLVVSDK-----------------------NSIIEIAGILLGYSA
SYFB_BUCAP        FLILKNDTRIVLDKDILVFSDK-----------------------TKILFIPGNINNSDL
SYFB_BUCBP        QFFDSCSQRVPIDKRTILLSDD-----------------------KEILVLGNHTNSYNS
Q057Y9_BUCCC      YIFDTNKKKFFLRKGTIILTDL-----------------------KNILSFEDMEYSCYS
SYFB_MYCGA        QFLALDNKWYTVQENDLLVVDDEK-----------------------IIALAGIIGSMAT
SYFB_MYCPN        TMLALDNKEYEIKPGDLVVADEQG-----------------------TIAIVGIIGSKRT
SYFB_MYCMO        -LEIANRT--LKIDNNLVIEKSRE-----------------------IIAIPYLETQKEF
SYFB_MYCPU        VSILGNKK--ISLDNNLVVCSKEK-----------------------PISIAGVIGIADF
C4XE68_MYCFP      VTILGNKE--IEVKNALAIYSKDK-----------------------VVSLASVMGLEET
D3VQ30_MYCAA      LEILGGKK--VSVSDVLAIKDETG-----------------------VISLASVMGCENS
SYFB_MYCS5        VNLLGNKQ--VEVSDALAVFNGDK-----------------------VVSLAATMGLEES
SYFB_MYCHJ        VKIKYEPD--TISSYHFLNQEKK----------------------------PLLIPEFSD
SYFB_MYCH2        VKIKYEPD--TISSYHFLNQEKK----------------------------PLLIPEFSD
SYFB_MYCH7        VKIKYEPD--AISSYHFLDQEKK----------------------------PLLIPEFSD
SYFB_PORGI        PFVTLDGVERKLTAEDLMICDSN----------------------GDPMCVAGVFGGLHS
SYFB_CHLTE        SFMALNKVEYQLQPGMTVVCDA-----------------------REPVAIGGVMGGLHS
SYFB_SULDN        TMAKISLCRDKNGFASVMTKDK-------------------------KVSIVGVMQEELF
SYFB_RHOBA        QLEAIDHRNYDLNDSTCVIADS-----------------------SAALAVGGVMGGASS
SYFB_TROW8        TLDTIDGRRLELHTDDLVVADA-----------------------NGALSLAGVIGGSRS
SYFB_CHLPN        SLTLLNGETVLLPSGVPVVRDD-----------------------HSLLGLGGVMGAKAP
SYFB_UREPA        ILLGLDQKEYLIKKGDLIIVDD-----------------------QKILALAGIIGSNDS
SYFB_ONYPE        NITTLNQNDFVLDENDLVITDG-----------------------KKAIALAGIVGLLES
SYFB_MYCPE        KFLALNDKEYVVENKSAVSVISN----------------------NKIVSLASVIGSKEN
B5Y860_COPPD      KLVLLNNEEVTLDEDCMVIADA-----------------------VKPVGVAGVMGGRDA
SYFB_PORPU        KSVKLDNKDIALSRDVLITQIN-----------------------NNITSIAGIGINQEF
SYFB_PHATC        EFFASNQINYKLDNSIFLVQAN-----------------------NIPISIAGIIEN-DE
SYFB_GRATL        SLFNLQKKSHIIYDSPNIELEVLR--------------------YDDVILFPIGFSLNEN
C7LJX7_SULMS      KKFLFNKKFFSSKNDLILFNEK------------------------NPICIAGLLVNNNF
SYFB_MESFL        ----LTLTKQTIDEKELIVLKSG----------------------NSIVNILGLKTEDKF
                                                                              

SYFB_HELHP        RHFGTRSEIYIIEASYVNPTLIAKSLYKHAIKGDVQLTYRSTRGSNPNLEQGIDFLCRKM
SYFB_HELPJ        KDLSECLLLEASYTDPVSLSLKLHALKDKTLQKDNALVYRSTRGSNPNLSDGLNFLSAHL
SYFB_DEHMC        EV-TEKTSRILLESATFDKQSIRKTARGLKLQSEASARFEK-GLSYELAPIALKRATQLI
SYFB_DEHM1        EV-TEKTASVLLESATFDKHSIRRTAKALKLQSEASARFEK-GLSFELAPVALKRATQLI
SYFB_PARUW        EV-SEKTTNIILESAFFDPIFVRKTSKQLGLQTDASKRFER-GTDPNQLISVLNRAAMLI
SYFB_DESVH        EI-SDKSSRVFLEAAVFRPGTIRKTARRLGLSSEASYRFER-GVDQVVCTYAMNRAAQLI
SYFB_DESAG        EI-NDASRRVFLECAVFKPATIRRTARRLGLSSESSYRFER-GVDQVLSTFAMNRAAQLM
SYFB_SYNPX        GV-TAATGRIWLESAMFSPAAVRTTARSVGLRTDASARFEK-GLPKEMTLACSIRALELL
SYFB_GLOVI        EV-GGQTRRIVLEAAIFDPPAIRRSARVFALRTEASARYER-GVDASALEHALGRALQLL
SYFB_THETH        EV-REDTEAIALEVACFDPVSIRKTARRHGLRTEASHRFER-GVDPLGQVPAQRRALSLL
SYFB_DEIRA        HV-RADTRDVVIESAHFDPVLLRRTSTRLGLKTDAVYRYER-GVDPLLAPKAAVRVAELL
SYFB_MYCTU        EV-RADSTDVLLEAAIWDPAAVSRTQRRLHLPSEAARRYER-TVDPAISVAALDRCARLL
SYFB_CORGL        EI-SDTTTDVYFEAATWDTITVARTSRRHKLSSEASRRFER-GVDPAIVEIALDIAATLL
SYFB_CUTAK        EV-TAETTSIILEGAHFDPMTVARAYRRHKLGSEASRRFER-GVDPICAHTAAVRAAELL
SYFB_BIFLO        EV-TADTKNILLEAAHFDQVTIARSARRHKIPSEASRRFER-GVDTALQPAATQMAAELM
SYFB_ECOLI        GV-NDETQNVLLECAFFSPLSITGRARRHGLHTDASHRYER-GVDPALQHKAMERATRLL
SYFB_PECAS        GV-NEETQNVLLECAYFNPLSITGRARRHGLHTDASHRYER-GVDPALQHKAIERATRLL
SYFB_MANSM        GV-NAQTKDVILEAAFFAPLAITGRARQYGLHTDSSHRFER-GVDFELQHKAMERATSLL
SYFB_ALIF1        GV-TSETTDIMLECAFFAPDHIRGRARAYGLHTDSSLRFER-GVDSTLQAAAMERATQLL
SYFB_PHOPR        GV-TTETTDVLLEAAFFAPDHIRGRARAYGLHTDSSLRFER-GVDSTLQAAAMERATQLL
SYFB_IDILO        GV-TESSKNIFLESAFFAPDAILGKARRYGLHTDASHRYER-GVDPQLQRTAMERATELL
SYFB_PSEPK        GVNTEKTRDLFLESAFFEPISVAGKARSYGLHTDASHRYER-GVDSQLAREAMERATQLL
SYFB_PSEPF        GV-SATTRDVFLESAFFDQIAVAGKARSYGLHTDASHRYER-GVDWQLAREAMERATGLL
SYFB_LEGPL        AV-QEQTQHIFLESAYFNPVTIAGVARKYGLFSDSSQRFER-GVDPCLQSKALERATELI
SYFB_LEGPA        AV-QELTQHVFLESAYFNPVTIAGVARKYGLFSDSSQRFER-GVDPCLQSKALERATELI
SYFB_XYLFT        RI-TDTTINVFLEAAHFAPAAIMGRGRKLGLHTDASHRFER-GVDPALPPQAIAFATRLI
SYFB_XYLFA        RI-TDTTVNVFLEAAHFAPVAIMGRGRKLGLHTDASHRFER-GVDPALPPQAIAFATRLI
SYFB_XANC8        RV-TNTTRNVFLESAYFDPAAIMGRGRKLGLHTDAGHRFER-GVDPALAPQAIEVATRLV
SYFB_XANOR        RV-TETTRNVFLESAYFDPAAIMGRGRKLGLHTDAGHRFER-GVDPALPPQAIEVATRLV
SYFB_BURPS        AV-TLDTTNIYLEAAFWWPDSIRGRARKYNFSTDAAHRFER-GVDYSTTVEHVERITQLI
SYFB_CUPNJ        AV-TLDTTNIYLEAAFWWPSAIQGRARRYNFSTDAAHRFER-GVDYATTVEHIERITALI
SYFB_BORBR        SV-TLDTRNIYLEAAFWWPGAIAGRARRYKFSSEASHRFER-GVDYASIPEHIELITRLI
SYFB_THIDA        SV-ERATVDVFLEAAFFAPAAIAGRARRLGLSTDSAHRFER-GVDFGAIHAAMERATQLL
SYFB_NEIMB        AV-SDGTQNIVLEAAWFAPEIIAGKSRQYGFGSDSSFRFER-GVDYRLQADAIERATELV
SYFB_LACJO        EV-EDDTTDVILESAVFDGTSVRKSALRHANRTEASSRFEK-GVNWDNTQKALDMAALLL
SYFB_LACSS        EI-TANTKNVIIEAAIFAPTAVRKTAQRHNLRSDASSRFEK-GVNVADVQVALDAAAAMM
SYFB_STRP3        EI-DANSQTVVLEAAVFDGKSIRKTSGRLNLRSESSSRFEK-GVNYATVLEALDFAAAML
SYFB_STRP8        EI-DGNSQTVVLEAAVFDGKSIRKTSGRLNLRSESSSRFEK-GVNYATVLEALDFAAAML
SYFB_STRPN        EI-SEKSSRVILEAAVFNGKSIRKTSGRLNLRSESSSRFEK-GINVATVNEALDAAASMI
SYFB_STAAC        EV-KEQTSNIVIEGAIFDPVSIRHTSRRLNLRSESSSRFEK-GIATEFVDEAVDRACYLL
SYFB_LISIN        EV-TETTTTVALEGAIFSSSSVGKASRELYLRTEASIRYDK-GSDAWKVEKALAHGGALI
SYFB_OCEIH        EV-TDKTVNVLLEAAYFEATAVRHTVRQTGLRSESSTRFEK-GIDPNRIVEAGLRACQLM
SYFB_SYNAS        EI-KPDTRDILLESAYFAPSSIRRSARDLGMSTDAAFRFER-GIDPEGVLRALDRAAQLI
SYFB_MOOTA        EV-TPATTNILIESAHFDGASIRRTSRRLGLRSEASTRFER-GVNLEGAPAAADRAARLM
SYFB_DESPS        EI-DAESTDILLESACFNPVSVRKTARNLKLPSEASYRFER-GVDPGGVVNALDRAAELI
SYFB_CARHZ        EV-DDDTKTVFIEAAWFNPVSVRKTARKLGLRTDASQRFEK-NVDIEGIKRALIKAALMI
SYFB_FUSNN        QI-DNETKNIFVEVAYFTPENIRKTSRELGIFTDSAYRNER-GMDVENLSNVMARAVSLI
SYFB_BDEBA        GV-SDSTTEVFLEAAYFLPMSARKTSRSHGIDTDSSYRFAR-GVDPDGTLRGLNRAAALI
SYFB_THEMA        GV-YDDTRDLVLEVAYFDPVRIRKAAKALGISSESSYRFER-GVDPNDVELVSLRLAELI
SYFB_AQUAE        GI-KENTKDILLESAYFNPFRVRKASKKLGIQTESSYRFER-NVDIERVDRAQDYAVYLI
SYFB_LEPIC        AV-QNTTTEIVMESAVFMRERIRKSIRSTGIRSDSSVRYEK-GLEATTTLPVIRRALNLL
SYFB_LEPBL        AV-QNNTTEIVMESAVFAREKIRKSIRSTGIRSDSSVRYEK-GLEATTTLPVIRRALNLL
SYFB_RICTY        SC-NDSTINVILEAACFNARLVAASGRRLKIDTESRYRNER-NIDRNFTEKALDIATNLI
SYFB_RICPR        SC-NDSTTNVILEAACFNAKMVAASGRRLKIDTDARYRNER-NIDRNFTEKALNIATNLI
SYFB_BRUSU        GC-DENTVDVLIESALWDPRMIARTGRELGIVTDARYRFER-GVDPEMMVPGAEIATKLV
SYFB_BRUME        GC-DENTVDVLIESALWDPRMIARTGRELGIVTDARYRFER-GVDPEMMVPGAEIATKLV
SYFB_PELUB        GT-ELDTKNVLIESAYFSPRSIRKSSKILNIDTDAKFRFER-GIDPLSIDQGLERAANLI
SYFB_WOLTR        KC-TLETTDVFLESAWFNPISVTKSSRQLNISTDSSYRFAR-SVDPGFILDGLHFAAQMI
SYFB_EHRCJ        SC-LLDTEDIFLESAWFAPVDIVLSSKKIKLSTDSSYRFER-FVDPRFLQTGLDLATKMI
SYFB_BLOPB        SICSETR-HIILQSAFFTPSVIASQSTLYHMHDLYSFHYAR-GVDPSISKLALDRVTSLL
SYFB_BLOFL        SVSCSTH-NIFLKVAFFNPLTIINQYKLYNLYTSSVVRYEK-GIDPDISELALNYATSLL
SYFB_WIGBR        RIDSKTTINIIISSVLYRSKFLFGNSVKYCINSDLAYRNERNMIDPNIQHLAINRATELI
SYFB_BUCAP        EPNKNTK-NIFLTSYLVDKKSILN--ILKKIDSNNILDYYSHGVDASLQKYAIEYATYLI
SYFB_BUCBP        RLSLSSH-NIFLGCALFNPEYINNDSHFNFGFKNKITEYYSRGVDSDIQYKALNYVTYLV
Q057Y9_BUCCC      RISSTTK-NLFLGSICFCPNFIQK-RNLLIPFFSRKIEYSKYNFYPKIQKNIFKYIQKLI
SYFB_MYCGA        AV-DENSINYFIEVGNFDRHQIIKSAAFHKINTYSANLFSK-EISLYQTKKTFEYLYQYL
SYFB_MYCPN        MV-DNTTNNIFFEVVNYNHERIKQTAQRLGVANFASRLMSK-PISLQATENCLNYLQNNF
SYFB_MYCMO        EI-KDSQKEFFIFMNILSPKEVRKTIKTLKLESSQIKQATK-TISHGMQLNAIQYM----
SYFB_MYCPU        GS-DQNTKNFVFEIGRFKTLDIQKSIKSVKLDTQSSKLSSK-KISSGTFKMALNFL----
C4XE68_MYCFP      AA-NRKSKYVVFEIGNFNPSDVRHTAKEIKIDSASSLQGGK-VLSTELVRNGMEYLKYKA
D3VQ30_MYCAA      AV-DENTKEVVFEVGLFDPLLVRHGAREIKMDTASSIQAGR-ALNSQIVFNGISFLKYKS
SYFB_MYCS5        KV-DLQTSEFIFEMASFPSKLIRNNAKEIKMNSNASNLASK-TITKYQVKLAHKFL-FNY
SYFB_MYCHJ        QI-IMENNSFFLIMPKFNLLKVKQIKQFLKKNSLKLTQLGK-NYNYGTTFIALSFLNFFL
SYFB_MYCH2        QI-IMENNSFFLIMPKFNLLKVKQIKQFLKKNSLKLTQLGK-NYNYGTTFIALSFLNFFL
SYFB_MYCH7        QI-IMENNSFFLIMPKFNLLKVKQIKQFLKKNSLKLTQLGK-NYNYGTTFIALSFLNFFL
SYFB_PORGI        GV-TEKTTDIFLESANFNPTMVRRTARRLGLNTDSSFRFER-GLDPERTDWALRRAASLI
SYFB_CHLTE        AV-TDKTTDILLEAAYFNPASVRKTAKQLQLSSDSSYRFER-GVDPCNVKRAAEYAIAMI
SYFB_SULDN        KV-AHSNGVVLIEATYIPPDVISKKMQENKIPAGISYYRASRGSEPD-LNQGLDYCISVI
SYFB_RHOBA        EV-TEATADIVLEAAEFVPLSVRRTARRLKLHSPSSFRFER-RVDPVGIDWASRRACQLI
SYFB_TROW8        RV-TSDTKRILLEAGNFNPIDISLSSRRHKLYTEASARFAR-SVDILIAQRALARAAELI
SYFB_CHLPN        SF-QETTTTTVIKAAYFLPEALRASQKLLPIPSESAYRFTR-GIDPQNVVPALQAAIHYI
SYFB_UREPA        KI-DATSTTAYIECANFNPMLIANTARRLKINTAAAMRFSK----PLTNYVTKVTLKKLL
SYFB_ONYPE        SI-KPTTTKIILEAAYFSPQTIAQTCQKLKTKTESSLRFER-GIDQSLIPLAFQKACQLL
SYFB_MYCPE        SI-SNSTKNVLFEIGNFDNMAIRDASNKLGIKTNASTLGSK-TIPLWITYKSFDYLIGLL
B5Y860_COPPD      SV-SSQTKRVLLEVAAFAPSSVAMSSRKLGVRTDASMLYER-GVAPFGQVDMALLFADFV
SYFB_PORPU        HV-DQNTKLIFIEAAIFKEAVVRKSSRSIGIRTESSIRQER-GLNIDNGRSAYRETLSLL
SYFB_PHATC        IICHSKTSSLLIEGSIFSASKIRQQSRKLAIRTDRSARYEK-SLKSTYLIEALYRLISLL
SYFB_GRATL        IKCDAATNSIVIMGYVCDKQYITDIKKKLKLSTYLSQRCCN-QGSRSDFLNAFYESVYLL
C7LJX7_SULMS      IV-EKFTKNIFIESADYSAEYIYKIAKKYNIKNEFSIRFER-GLDPNLNIYALKRAALLI
SYFB_MESFL        KV-TEETVTMLVVMLNLDQISMRKQQRNLNVSTVDTQRYAK-PLNPNLYDQGIDELVSIL
                                                                              

SYFB_HELHP        VLVSDALVYSGSHNIVQNID-----EITIKTTFKAINQIIG----------IELDKEEIA
SYFB_HELPJ        KAAILE-----SKQTEHSLK-----DCALTFQLEDITEILG----------LVIEAEKIQ
SYFB_DEHMC        LEIAGGQAASGLIDVLPNKK----ERNGIVLSLAKVNQILG----------YEKEPPDAC
SYFB_DEHM1        LEIAGGQAASGLMDVMPVKK----DRNSVVLSLSKVNRVLG----------LEGEKFDSC
SYFB_PARUW        QMVAGGIIEDSILDEQTKDF----LELTIRCRLSRINQILG----------TTLSRGEVE
SYFB_DESVH        AGLSGATLRPGICHNEPLPW----QAPVLRFRRARGEALLG----------ISLDETFCR
SYFB_DESAG        CELSGGVLRPGVCRAEPAPW----QAAQLRFRPARAAALLG----------ISLDDGFCR
SYFB_SYNPX        KELFPCEAKGLWVCGDSAA-----DASSVLLRRNALHQLLGPIED--EEGSSDLADAVVE
SYFB_GLOVI        ADCAGARAVVQATDDYRRR-----ENRVVSLRPERLAQILG----------EDIPDAEIA
SYFB_THETH        QALAGARVAEALLEAGSPK-----PPEAIPFRPEYANRLLG----------TSYPEAEQI
SYFB_DEIRA        RAAGGTPEAGQTV-VGTPE-----VPQTITTTGEQIRALLG----------MHIGTAEMR
SYFB_MYCTU        ADIAGGEVSPTLTDWRGDPPCDDWSPPPIRMGVDVPDRIAG----------VAYPQGTTA
SYFB_CORGL        VEIAGGTVDAGRTLVGDVP-----AMQPITMKVTRPSELAG----------VDYSAETVI
SYFB_CUTAK        AQYGGATVGEP-TVVGEVP-----EMPRQTINADLPNRILG----------TKVPTEEVI
SYFB_BIFLO        AKYGNGEPSEHPNDVNNTP-----RAKAIHFKASEVARVAG----------LDVDINRIS
SYFB_ECOLI        IDICGGEAGPVIDITNEAT---LPKRATITLRRSKLDRLIG----------HHIADEQVT
SYFB_PECAS        IDICGGEAGPVVDITSDAD---LPTRATITLRREKLDRLIG----------HVIADEQVS
SYFB_MANSM        VEICGGEVGEICEVVSETH---LPKLNKVQLRRSKLDALLG----------HHIETETVT
SYFB_ALIF1        VELCGGEVAPVVAVESEAD---LPKANTVELRRSKLDGLLG----------HHIPSTDVV
SYFB_PHOPR        VEICGGEVAPVNGSESEAD---LPKANVVALRRTKLDSLLG----------HEIPSEDVV
SYFB_IDILO        LAICGGEAGPVTEAVAEAF---LPKRDGITLRACRLAKVLG----------VSIANDNVT
SYFB_PSEPK        LDIVGGEAGPVVEAVSEQH---LPQVAPVTLRAERITQMLG----------MEMDPAQVE
SYFB_PSEPF        LEITGGEAGPIIETVSEQH---LPSIAPITLRAQRITQMLG----------MEMDSAEVE
SYFB_LEGPL        LSISGGEPGPVIESFDKKF---LPGTVSFLFDTTKVKKLTG----------LSIPLNEMK
SYFB_LEGPA        LSISGGEPGPVIESFDKKF---LPGTVSFLFDTTKVKKLTG----------LSIPLNEMK
SYFB_XYLFT        LELAGGKPGSLIHVQLPEY---LPAPASILLRRTRIARLLG----------IVIDDAEVE
SYFB_XYLFA        LELAGGKPGSLIRVELPEY---LPAPASILLRRTRIARLLG----------IVIDDVEVE
SYFB_XANC8        LELAGGMPGPVVDAALPHH---LPQPASILLRRARIARVLG----------IQIDDADVA
SYFB_XANOR        LELAGGTPGPVVHAQLPQH---LPQPARILLRRARIARVLG----------IQIDDVDVV
SYFB_BURPS        LDICGGQAGPVDDQIVS-----LPQRAPVSMRASRANRIIG----------VEIGEDEIA
SYFB_CUPNJ        LEICGGQAGPVDDHIVN-----LPQRRPVSLRLARAERVLG----------IELSSAVVA
SYFB_BORBR        LDICGGQAGPVDDQCVN-----LPVREPVRMRLARCHRVLG----------VAVERAEVA
SYFB_THIDA        LDICGGQPGPISEVTGS-----LPRREPIELRLSRLRRVAG----------VELGADQVI
SYFB_NEIMB        LQICGGAAGEMVEAQGE-----LPEAKQVGLRLDRLKTVLG----------VDIPAEQVE
SYFB_LACJO        RNDADGTVNEGEIKATDAQR----NPSVVKTTVSYINKVLG----------TELSRAEME
SYFB_LACSS        AELGAGQVTAGVVSPTNLAP----QPKVIQFDSARVNRVLG----------TDMSVQTMI
SYFB_STRP3        QELAEGQVLSGHVQAGQLST----EPVEVSTNLDYVNVRLG----------TELTFADIQ
SYFB_STRP8        QELAEGQVLSGHVQAGQLPT----EPVEVSTSLDYVNVRLG----------TELTFADIQ
SYFB_STRPN        AELAGATVRKGIVSAGELDT----SDVEVSSTLADVNRVLG----------TELSYADVE
SYFB_STAAC        QTYANGKVLKDRVSSGELGA----FITPIDITADKINRTIG----------FDLSQNDIV
SYFB_LISIN        AELSGGTLVGGVVEVDNREK----AVNKIETSLTRINRILG----------TEISLSEIE
SYFB_OCEIH        QRYAGGKVLQGFAEENHLDTK---STKEVKVPLTQVNQRLG----------MELTEKDVQ
SYFB_SYNAS        AELSGGKICKGRIDEHPKPVE---TVGEIHLRCRKVNSLLG----------TNIPAAEMA
SYFB_MOOTA        AELAGGRVAPGRIDCYVKRRQ---PV-TIELRPERVNYLLG----------TELAPTTMK
SYFB_DESPS        AEIAGGALCSEGIDNYDGK-K---AVEVQRFSISRTSSLIG----------VEFSGEELT
SYFB_CARHZ        CELAGGTIQGRYGDVYPKKFT---PK-VIAVSLSRAEEFLG----------ISLDAKRVV
SYFB_FUSNN        AEVAGGDVLSEVIDKYVEKP----QRAEISLNLEKLNKFIG----------KNLTYDEVG
SYFB_BDEBA        LEVAGGEAYADHHDFYPNPV----KKAPVDITIKTVSDRLG----------YEAEEHKFV
SYFB_THEMA        QKLAGGYVLRKFWDVYPRKIE----PKKVMLRKARIEKILG----------TKVE--EPG
SYFB_AQUAE        LKHAGGKV-KVVKDVYREKYK----PKKVFLPQGKYIRYAG----------ESYKNEEVK
SYFB_LEPIC        KENGCSELKASEPVGFLHIPH---KEVRIHTDIHFINAKLG----------VTLSQGDIT
SYFB_LEPBL        KENGCPSLKASEPVGFLHTPH---KEVRIHTDIHFINTKLG----------ITLSQGDIT
SYFB_RICTY        LSICGNCEVSEVVKVGEQEL----QKIPLDFSVYFLEKITG----------IKLSIKEIE
SYFB_RICPR        LSICGNCEVSEVVKVGEQEP----QKKPLDFSVYFLEKITG----------IKLSIQEIE
SYFB_BRUSU        LELCGG-QPTVLDVVGYKPH----TARVIDFPVTEVKRLTG----------LDVSYEDAF
SYFB_BRUME        LELCGG-QPTVLDVVGYKPH----TARVIDFPVTEVKRLTG----------LDVSYEDAF
SYFB_PELUB        QEICGG-EVSEFDIQKIEDV----KKKSLKFDPSLFEKITG----------FNIDIKEMI
SYFB_WOLTR        VDLCGG-KASNVVFAGSLDE----ADTKVSFDYQDVNKFGS----------VSVLPDEMF
SYFB_EHRCJ        LEYCGG-THFDVVSNEVHVV----DNIELNFFPDSVRSIGN----------VNISNEEIF
SYFB_BLOPB        IRSCGGYPGPIINMTN-KSMLP--KPTNIILHRTKLDKIIG----------FHILDSEIT
SYFB_BLOFL        IKYCHGKAGPTINIIS-HNHLP--KIKIIKLHRSKLNMILG----------FYIPDQKII
SYFB_WIGBR        LRFCCGSPGKIINYIN-NKFLP--KKILIKLYKKKLYEILG----------FFISKKLIE
SYFB_BUCAP        VKICGGKIGPINTKKSNFNSLS--CSNKIKLYHQNFNKCID----------SFVDSSIIS
SYFB_BUCBP        LKICGGNASNVVLANS-SRVTV--IQKKIFVLKKTLHRYVN----------NIISDTLVV
Q057Y9_BUCCC      LNICGGRSSNIKKYNL-IKNFI--ITNKIFFTIRKLNKISG----------IIFLKKDII
SYFB_MYCGA        LTKVYNQQLSELSKTFSVDE----YHQQVKVNYDKIRSLLG--------SMNYLPDAMIQ
SYFB_MYCPN        LNPESIGKISKFSSTIKAPA----FNRKIYLNFNQLRELIGV-------TKKQLNDHMIR
SYFB_MYCMO        --QSLFEEIEIVNINLNLKP----KEILFDHTFINRIAGFEI-------VKEQK-FINAK
SYFB_MYCPU        --TSYFDSQVLVSKNLKDKK----ESFNFVWEDLNKFLNTDV-------KKMPH-FNRVL
C4XE68_MYCFP      F-EDKQPSSVLINLPSKTKN----KIFLQQKKLLGKYSGLQI-------KDLDKEFEKVE
D3VQ30_MYCAA      A-LDGQSVSQIVNIPKVKKG----KSVIQSRKKLSIYANCNI-------KDLSI-FDDVE
SYFB_MYCS5        L-KDLKLSNVVNDFELDKKV----EINFDEEKLQRYSNGLP-----------SSEFIKAF
SYFB_MYCHJ        E-DQKIDFSWPINFDKSLIS----KKTFLDLNYNELKEILGL-------ELSQEDISKTN
SYFB_MYCH2        E-DQKIDFSWPINFDKSLIS----KKTFLDLNYNELKEILGL-------ELSQEDISKTN
SYFB_MYCH7        E-DQKIDFSWPINFDKSLIS----KKTFLDLNYNELKEILGL-------ELSQEDISKTN
SYFB_PORGI        LEIAGGHLGGMTDVYSNPLK-----PHLISLSFEKVNSVIG----------RTIEPEMVR
SYFB_CHLTE        LEIAGGNVDSAEAWGDMPAA-----QKIVSLRPKRVNAVLG----------SSITASRMV
SYFB_SULDN        EDNSESSVYGGTIEIDEPHE-----DKIISLNKKEIDEIVG----------ANIDKAKIT
SYFB_RHOBA        TEIAGGSVAPGVIDTAPEIP----ARETVLLRPKRVAALLG----------LEIETAELD
SYFB_TROW8        RDLASGDITELGSAYINYTQ-----QSPILLSTLDIERVVG----------CCFTREEIM
SYFB_CHLPN        LEIFPEATISPIYSSGEICR----ELKEVALRPKTLQRILG----------KSFSIEILS
SYFB_UREPA        ANFKSDAKLIYYFKHSVHN--------VIKNKINQVSDFVG----------AEIDLDTAQ
SYFB_ONYPE        VTLADGKITYQPVITKQKNR----TNPTISLNLDFVTRKIG----------VSLCPTQIK
SYFB_MYCPE        KDLNIKVSSVNYVGDKLKDN-------LIDFDSQTIQDLLG-------------QKTDVE
B5Y860_COPPD      EQMGCAQATALWFAGEERR------YRLVDYNPQRIVKLSS------------VKDQDLV
SYFB_PORPU        IELTHGKVKATFLKKETENS-----TLNIDISLKKIQDVLGPIKD--NHTVRFLSFDEIE
SYFB_PHATC        RISNPSLVYKFHSSNKVLEK----VLKPIVLNYKTIVEILGPIKKRTNEHLIYISPETVT
SYFB_GRATL        GSFGFATLGKFYGYHKLYNISRILFIDKVKIQNILGSVKIGS--------YNYLTVKEIF
C7LJX7_SULMS      KKLSGGKISSKIVDFYPEKPE---KNIDLFIRFNKINNIIG----------YNLNFIKIK
SYFB_MESFL        DEYKMLEDVQKVVTTVQKQN----YDNVYSITLEKVQDILG----------IEITVEEII
                                                                              

SYFB_HELHP        TILKRLNFKLDA-----------TCDENFFMVTVPNYRH--DIQSIQDVAEEVLRIYGID
SYFB_HELPJ        NILKNLGFKVSTKEP--------NSKPQILEVIVPNFRH--DIKTIQDIAEEILRFVGID
SYFB_DEHMC        KIAKRLGFIWLPEYVPGMEEFGYGATEDMVRIYPGYWRM--DIETDIDMIEEVARIAGYH
SYFB_DEHM1        KIAKRLGFAWMPEYVPGMEEFGYGSVDDKMRFFPGYWRM--DIESDIDMIEEVARIAGYD
SYFB_PARUW        TIFQSLGFHYQWD------------GQDSFMVCVPTYRT--DVKEEIDLIEEVARIYGYD
SYFB_DESVH        ETLERLGCKVDA------------ADAADWKVTAPSHRR--DFEREADLIEEVARVRGMD
SYFB_DESAG        ETLQKLGCTLSG------------ADTPEWTVTAPSHRH--DLEREADLIEEVGRVYGMD
SYFB_SYNPX        QCLTALGSELSP------------SDEGWNVIAPPSRRL--DLAREIDLIEEVARLVGFD
SYFB_GLOVI        RVLKNLGFDVQT------------GPQEFAVTVPGHRLR--DIEREIDLIEEVARVVGYD
SYFB_THETH        AILKRLGCRVEG------------EGP-TYRVTPPSHRL--DLRLEEDLVEEVARIQGYE
SYFB_DEIRA        ESLTRLGCTVTG------------DGD-SLTVTPPSWRV--DMVIWQDLAEEVARLHGFT
SYFB_MYCTU        RRLAQIGAVVTH------------DGD-TLTVTPPSWRP--DLRQPADLVEEVLRLEGLE
SYFB_CORGL        ARLEEVGCTVAV------------SGD-TLEVTPPTWRG--DLTMSADLVEEVLRLEGLE
SYFB_CUTAK        EILTRSGVKVTA------------LGD-SLHLVAPTWRP--DLVDAYDYVEEIGRKIGFD
SYFB_BIFLO        DILTDIGCTVAG------------GGNGEFAVTAPSWRP--DLNEPCDLVEEIARLVGYD
SYFB_ECOLI        DILRRLGCEVTE-------------GKDEWQAVAPSWRF--DMEIEEDLVEEVARVYGYN
SYFB_PECAS        DILQRLGCNVVK-------------TDAGWQATAPSWRF--DMEIEEDLVEEVARIYGYN
SYFB_MANSM        EIFHRLGLPVSY-------------ENEVWTVTSASWRF--DIEIEEDLIEEIARIYGYN
SYFB_ALIF1        EILTRLGCAV-------------ESTDTGWTASSPSWRF--DIAIEQDLIEEVGRIYGYN
SYFB_PHOPR        EILTRLGCNVSVVDDS-------ETTDAGWTATSPAWRF--DIAIEQDLIEEVGRIYGYD
SYFB_IDILO        EILERLGFDVSF-------------DGEQWQVGIPSYRF--DLSIEEDLIEEVARVYGYN
SYFB_PSEPK        QLLNALELTTTK------------SGEGQWTVSVPSHRF--DISLEVDLIEELARLYGYN
SYFB_PSEPF        RLLNALGLKVSA------------DGAGQWRVEVPSHRF--DISLEVDLIEELARLYGYN
SYFB_LEGPL        NLLEGLGVVIIK------------ETNHFFEVTIPSHRV--DLQQDADLVEEIIRLYGYD
SYFB_LEGPA        NLLEGLGVVITK------------ETNHFFEVTIPSHRV--DLQQDADLVEEIIRLYGYD
SYFB_XYLFT        RILQALGMQVTT-------------QAEGWRVVAPSRRF--DIAIEEDLIEELVRIRGYE
SYFB_XYLFA        RILHALGMQVTT-------------QAEGWRVVAPSRRF--DIAIEEDLIEELVRIRGYE
SYFB_XANC8        RILTALGMHVEA-------------AADGWQVTAPSRRF--DIAIEEDLIEELARIHGYD
SYFB_XANOR        RMLRALGMQLDA-------------VAEGWEVMAPSRRF--DIAIEEDLIEDLARIHGYD
SYFB_BURPS        QIFTRLGLAFER-------------DGDVFRVTPPPHRF--DIEIEEDLIEEVARIYGFE
SYFB_CUPNJ        DVFQRLQLPFTRSQ---------GADGEVFEVTPPSYRF--DIEIEEDLIEEVARIYGFE
SYFB_BORBR        QIFTRLGLPFQE-------------QGDDFVVTPPSYRF--DIEIEEDLIEEVARVYGFE
SYFB_THIDA        RDLAALGCVVEQ-------------ADERLVVTPPSFRF--DLAIEEDLIEEAVRLFGYD
SYFB_NEIMB        TILQHLGLQPEK-------------TAEGFRVTAPSFRF--DIEIEADLIEEIGRVYGYE
SYFB_LACJO        KIFDQLGFTVAGSE-------------DELVVTIPNRRW--DISIPADLVEEVGRIYGYD
SYFB_LACSS        NLLERLGFEVANNA-------------DQLTVTIPARRW--DIEIQADVIEEIARLYGYD
SYFB_STRP3        RIFNQLGFGLTGDE-------------TRFTVAVPRRRW--DISIPADLVEEIARIYGYD
SYFB_STRP8        RIFDQLGFGLTGDE-------------TRFTVAVPRRRW--DISIPADLVEEIARIYGYD
SYFB_STRPN        DVFRRLGFGLSGNA-------------DSFTVSVPRRRW--DITIEADLFEEIARIYGYD
SYFB_STAAC        TIFNQLGFDTEIND-------------DVITVLVPSRRK--DITIKEDLIEEVARIYGYD
SYFB_LISIN        TIFDRLGFVLEVKE-------------DTLIIEVPTRRW--DITIEADILEEVARIYGYD
SYFB_OCEIH        SVLNRLKFDFDQDG-------------HTFIVHVPTRRR--DITIFEDMLEEIIRIHGYD
SYFB_SYNAS        DILRGLGMEVTAKEGTV----------EEYRIKPPSFRV--DIGREIDLVEEIARIHGYD
SYFB_MOOTA        ELLERLHLEVRGE--------------GPFQVTVPAYRG--DLTGEIDLVEEIARLYGYN
SYFB_DESPS        AMLTSIEMVVEKDPENE----------DILLVTAPTFRI--DIEREADLVEEIARIYGYD
SYFB_CARHZ        EILESLGFRVTIGE-------------KKIFVEVPSYRP--DVSLEADIYEEIARYLGYN
SYFB_FUSNN        KILTHLDIELKPLGEG------------TMLLIPPSYRA--DLTRPADIYEEVIRMYGFD
SYFB_BDEBA        DFMKRLGCEINKKGE-------------TFTVLPPTFRF--DIEQDMDLVEEYARLNGYE
SYFB_THEMA        DILRRLEFQVEDRG-------------DSYEVLVPTFRP--DVEREIDLIEEIGRIYGYE
SYFB_AQUAE        EILDALEIPNEIMR-------------CGVEVLVPSHRSF-DIQRDVDLIEEIMRVKGYE
SYFB_LEPIC        DILERLHFIVSWKG-------------EHLEVLVPKFRHNYDVTIPEDLVEEIGRTKGYD
SYFB_LEPBL        DILERLHFMVSWKG-------------DRLEALVPKFRHNYDVTIPEDLVEEIGRTRGYD
SYFB_RICTY        VILNKLGFITDVKG-------------DIIKVIAPSWRH--DINILEDIAEEIVRIYGYD
SYFB_RICPR        DILNKLGFITDVKG-------------DIIKVIAPSWRH--DINILEDIAEEIVRIYGYD
SYFB_BRUSU        DILKRLGFGVEGDG-------------KTIRATVPSWRG--DVEGKADLVEEVMRIHGIN
SYFB_BRUME        DILKRLGFGVEGDG-------------KTIRATVPSWRG--DVEGKADLVEEVMRIHGIN
SYFB_PELUB        KILDNLGFEIKENK-------------GILDAVIPSWRP--DISQEVDVVEELVRIKGYD
SYFB_WOLTR        DILTKLGFSTDKKTE------------NNWNVKVPSWRS--DVTIPADLVEEVVRIYGYD
SYFB_EHRCJ        DFLIKLGFIVDNNNE------------FLWRVTVPSWRS--DIKHSSDIVEEVLRLYGYD
SYFB_BLOPB        HILKRLGFQTEFSD-------------NIWKILPPTWRF--DISIEENLIAEITRIHGYN
SYFB_BLOFL        NILTNLGFQVETQG-------------HNWIVSTPSWRF--DINIEENVISEIIRIYGYN
SYFB_WIGBR        NILLLLGYKYEFIK-------------NYWKVSVPSWRMC-NVKIEEDLISDISRFYGFE
SYFB_BUCAP        NILLCLEYKVNFHK-------------KYWYVFPPSWRF--DILIEEDVIGDILRIYNYN
SYFB_BUCBP        KYLLQLGYLVEKQK-------------HCWLVIPPSWRF--DIQIQEDVISDLVRVFGYH
Q057Y9_BUCCC      TILKSCYFSYIENN-------------DSFYVTPPYWRL--DIQIEEDVISEIIRMYGYE
SYFB_MYCGA        KSLTDLGFLVEDDL-----------------VYVPSYRN--DIYNWQDLVEELLKILNIN
SYFB_MYCPN        NYLTSLGFKMENQI-----------------ARAPAYRQ--DITVWQDISEELLKILDLN
SYFB_MYCMO        KSLEILGFKFFEDK-----------------ILVPAYRH--DYTGPYDVIEELFRFYGYD
SYFB_MYCPU        KSLNILGFEFKDNK-----------------VYLPTYRH--DIEHVQDILEEFLRFYGYE
C4XE68_MYCFP      DQLQRIGFKIFYNR-----------------LSAPTYRT--DLNCYEDIIEEYFRFYGYD
D3VQ30_MYCAA      TTLKKIGFSMDKNR-----------------VIAPTYRS--DIQHYEDVIEEYFRFYGYN
SYFB_MYCS5        DKLKLLEFEFENQK-----------------IKVPLYRY--DVSIFEDIIEELFRFYNYD
SYFB_MYCHJ        LILEKIGYNFDNTS-----------------FSPPFYRV--DIEFFADYAADFLRFYGLE
SYFB_MYCH2        LILEKIGYNFDNTS-----------------FSPPFYRV--DIEFFADYAADFLRFYGLE
SYFB_MYCH7        LILEKIGYNFDNTS-----------------FSPPFYRV--DIEFFADYAADFLRFYGLE
SYFB_PORGI        SILNSLEIRISKEE------------DGVMTLEVPRYRT--DVTRDVDVIEEIMRIYGYN
SYFB_CHLTE        RLLEKICIKAVSQEAVS-------DDVDSIAFSVPSFRV--DIEQEIDLIEEVARLYGYN
SYFB_SULDN        KILKNLGFDTTKSL------------ADNFVIIVPKFRH--DIVNKQDIVEEIVRLVGID
SYFB_RHOBA        KILRSLGCEVSAFA-------------DGLQCVPPSWRH--DLTREVDLIEEVARIHGYD
SYFB_TROW8        SSLRAIGCDVSCDSDHS------TPDTQVMLVTPPSFRP--DLVNVQDLAEEVIRVIGFN
SYFB_CHLPN        QKLQSLGFSTTPQE-------------TSLLVKVPSYRH--DINEEIDLVEEICRTESWN
SYFB_UREPA        TFLKRLGYKINKSN-----------------LITPSHRY--DVLNEFDVYEDIMKKISIQ
SYFB_ONYPE        NWLLNLDYQIHTSKHLGP-----QNKNEQLNLQAPLRRY--DVKIKEDVISDLTRLYGCH
SYFB_MYCPE        KNLKLMGFNFVGKK-----------------VKAPVYRE--DLENISDLVEELTKKINVN
B5Y860_COPPD      DMISTKQWEVITEEG---------NNDGKKKIRIPAYRW--DITRTEDLVDELVKFVGYD
SYFB_PORPU        NTLKSLQFKITKKDV------------KKFNVIIPSYRKY-DVFREIDIVEEIARVYGYN
SYFB_PHATC        DYLKRLNFKFLFDSS-----------TLNWEVTIPSIRSD-DITREIDLIEEVGRLHGFN
SYFB_GRATL        TLLERLNFLPIYDSL-----------KSSFKIHIPVYRQD-DIVRPIDVIEEVARIYGFD
C7LJX7_SULMS      EILILLKIKVLKENF------------NGLKIKIPLYRK--DITREIDVIEEILRIYGYN
SYFB_MESFL        SLFRTLDIEISVKK-------------SELTFTVDKNRT--DLYGKNDLCEEIARLYGYD
                                                           :     :   :  :  .  

SYFB_HELHP        NVSSVPLL-------------------------CSQSHNINNTYFTYKNTRKLAYGLIAY
SYFB_HELPJ        NLVSKPLH-------------------------CVSSKNSNPHYDTHRFFENLKHKALAC
SYFB_DEHMC        TIPCLPLD------------------------KAIPKI---ETPPLPGMKRFLRQILSGY
SYFB_DEHM1        TIPCLPLD------------------------KAIPKI---ETPPLPGIKRFLRQILSGY
SYFB_PARUW        HIPRNGGR------------------------YQTSKL---PDAPIYLFEKEIQSYLIAE
SYFB_DESVH        TIEPVLPK------------------------VMRPLDRAGAPESKYSFWLRLKHWAAGL
SYFB_DESAG        NIPPVLPK------------------------VSKPLEQ-GRTDSEYEFWARIKAWGRGL
SYFB_SYNPX        RFGAHLPD------------------------PLAPGAL----TPAQQAERRLRTLFCGA
SYFB_GLOVI        RFAPTLPP------------------------PADGGYL----PFEDFIERRVRSLCQGA
SYFB_THETH        TIPLALPA------------------------FFPAPDN-RGVEAPYRKEQRLREVLSGL
SYFB_DEIRA        ELPETLPT------------------------LRVHESN-IGASAQSEARAELRRTLAGL
SYFB_MYCTU        VIPSVLPP------------------------APAGR----GLTAGQQRRRTIGRSLALS
SYFB_CORGL        AIPTIIPT------------------------APAGR----GLTDAQKRRRAVGHALAYA
SYFB_CUTAK        RIKAVLPP------------------------SLGAS----GLTKAQRGRRRVLRSVVEA
SYFB_BIFLO        QIPITVPP------------------------APVEGL--VGLTPDQQRRRRVADELAEF
SYFB_ECOLI        NIPDEPVQ------------------------ASLIMG---THREADLSLKRVKTLLNDK
SYFB_PECAS        NIPNIPTQ------------------------APLIMT---SHREASLALKRVKTLLVDH
SYFB_MANSM        SIPNNAPL------------------------AHLSMR---EHHESDLELSRIKLALVGN
SYFB_ALIF1        NIPNQAPV------------------------AALNMN---DHKEANQPLKRVRDLLVDR
SYFB_PHOPR        NIPNQAPV------------------------AALKMN---DHKEANQPLKRVRDLLVDR
SYFB_IDILO        SIQAAPPA------------------------AQLRMT---ERKESQLSTHQLVDAMVSR
SYFB_PSEPK        NLPVRYPQ------------------------ARLAPQ---GKPETRGDLPTLRRLLVAR
SYFB_PSEPF        RLPVRYPQ------------------------ARLAPQ---AKAEARSDLPELRRLLVAR
SYFB_LEGPL        KLQAQPMQ------------------------TSVQAG---LISAKEKIATHVSSWFSAK
SYFB_LEGPA        KLQAQPMQ------------------------TSVQAG---LISAKEKIATHVSSWFSAK
SYFB_XYLFT        HLPTALPV------------------------GASHIA---MPSETRLDMTSVRRQLIAR
SYFB_XYLFA        HLPTALPI------------------------GASHIA---MPSETRLDMTSVRRQLIAR
SYFB_XANC8        RVPTTLPG------------------------GASRIA---MPSETQLDELSVRRQLVAR
SYFB_XANOR        RVPTTLPG------------------------GASRIA---MPSETQLDELSVRRQLVAR
SYFB_BURPS        KIPARPPV------------------------AKSEMR---ATDETRRSVHAIRHALAAR
SYFB_CUPNJ        RIAARPPV------------------------AESEMR---PTNEGRRSTHVVRHALAAR
SYFB_BORBR        RIPDVPPV------------------------ARAKMH---AQPEARRGAHAVRRLVAAR
SYFB_THIDA        RIPARPPA------------------------APSRML---AQDETRIADDALRQKMVDL
SYFB_NEIMB        NIPDDYTS------------------------GRLKML---ELPETRRPRFAVYNEMAAR
SYFB_LACJO        NLKSTQPL-LA--------------------ETH------GGYSAKETAMRRIKDIVQGQ
SYFB_LACSS        NLPSTLPT-GD--------------------MTT------GALTTEQKALRRTRHTLEGA
SYFB_STRP3        KLPTTLPE-AG--------------------GTA------AELTPTQALRRKVRGLAEGL
SYFB_STRP8        KLPTTLPE-AG--------------------GTA------AELTPTQALRRKVRGLAEGL
SYFB_STRPN        RLPTSLPK-DD--------------------GTA------GELTVIQKLRRQVRTIAEGA
SYFB_STAAC        DIPSTLPVFDK--------------------VTS------GQLTDRQYKTRMVKEVLEGA
SYFB_LISIN        EIPVTLPA--T--------------------STT------GGLSDSQKARRVMRAYLEGA
SYFB_OCEIH        HLPYTIPQ-GW--------------------VKS------GGLTDKQLLQRKIREFMMSS
SYFB_SYNAS        NIPVSLPV-GA--------------------MEP------VPRDRRKILEERLRRHLAGT
SYFB_MOOTA        RIPVTLPG-NL--------------------TAR------EKQAPAQRWEEAGREAAAAA
SYFB_DESPS        NVPTATPL-VA--------------------LSY------PEQDDDRLKRYPLALKLTRI
SYFB_CARHZ        NFPDTMPI-GI--------------------TT-------TGFSPEYNFEYKVKNLLTAL
SYFB_FUSNN        NIEAKIPV-MS--------------------IES------GEENINFKMPRIVRGILKEL
SYFB_BDEBA        HIPEALPA-LA--------------------AAP------SFQDKTFMLNRTTSELLRGE
SYFB_THEMA        KVESKVIS---------------------------VPAVNRGWGEKQLFRREISQFMKGM
SYFB_AQUAE        HYTSETLK---------------------------LPSIANLWKDN---LLEVKKYLRDK
SYFB_LEPIC        TIQVSPLL--------------------------AEVKTPIRNLNRELERKCKTFFAIAL
SYFB_LEPBL        TIQVTPLL--------------------------AEIKTPIRNLSRELERKCKTFFSVGL
SYFB_RICTY        KI--ESIK-------------------------LPELHQDNNNLREYKRISSFKRILASQ
SYFB_RICPR        KI--ESIK-------------------------LPELYQ-NNNLREYKRISSFKRILASK
SYFB_BRUSU        RIDPQPLP-------------------------SHGAVNGRILTTLQIRTRHARRMLASR
SYFB_BRUME        RIDPQPLP-------------------------SHGAVNGRILTTLQIRTRHARRMLASR
SYFB_PELUB        QI--KIIE-------------------------PEKVRKKQTLNLKQKLFHFLQRSIASK
SYFB_WOLTR        KIK-------------------------------EEP-LIDNVEVEINTHDNLRVLMISR
SYFB_EHRCJ        KIC-------------------------------EEPIPISHVDISDDYHDRLKALLLSE
SYFB_BLOPB        NIPCVS---------------------------LCTNFITDRSHASTIPLSRIKNLLIDR
SYFB_BLOFL        HIPKIPAK-------------------------ISLNQTVQCIPNQVISLSKSKTVLIAR
SYFB_WIGBR        KIPIDL---------------------------SYKKIKYNNCKYNINTLNNAKKLLTNR
SYFB_BUCAP        NIPLTPLK-------------------------QNYYFNSKNKDLKSPLLDEAAVLLINR
SYFB_BUCBP        NIPACALV-------------------------TNYKL--VHDDNIYTSLNRIKLLLVDL
Q057Y9_BUCCC      KIKSCPPQ-------------------------EHINSNISNKKSEEMSLSRIKFFLIDQ
SYFB_MYCGA        LFQPIP-------------------------IKADYLLEVNNETN--ELLDRLSKKLRSL
SYFB_MYCPN        KIKEDE-------------------------ILSSTKLEKHEKLNAYDALQKLRTKLQTL
SYFB_MYCMO        NFPIL--------------------------QPEIKPFKIQKKY-------DFKFSLASK
SYFB_MYCPU        NLVFE--------------------------APNIKNFETKNYE-------EYLNFIPYL
C4XE68_MYCFP      KFKTE--------------------------APALAPFKINKRN-------NDKSLLQSM
D3VQ30_MYCAA      NFKPE--------------------------APKLESYKVAHSV-------DNKNILQSL
SYFB_MYCS5        NFKEI--------------------------PYIQIPGELKADNK------NFKEKLKAL
SYFB_MYCHJ        KLKDC--------------------------KLEQVKAKIPNPD-------FEPVKLKTL
SYFB_MYCH2        KLKDC--------------------------KLEQVKSKIPNPD-------LEPVKLKTL
SYFB_MYCH7        KLKDC--------------------------KLEQVKAKIPNPD-------FEPVKLKTL
SYFB_PORGI        QVELTGYI-------------------------RASLGHETETDRRYKWQTVVSEQLVGA
SYFB_CHLTE        NLEPAPVM---------------------------VSSYPVSRKVPEYFPDYLRSIMIGL
SYFB_SULDN        NIPSKPFT-------------------------FTETNSFSSDYYDYKKRVTYRHKAAFS
SYFB_RHOBA        QIPEDSPI----------------------------PVAPSSKRRFDTAMERIRGVLTAA
SYFB_TROW8        RIPSLRLSVPHREQPVQSQQYKLENGKLENGYTLSPVTPPRTPPVTFEQRRLLGQSLAAC
SYFB_CHLPN        IETQNPVS---------------------------------CYTPIYKLKRETAGFLANA
SYFB_UREPA        EIKPQPIS---------------------------FDILNFENNLAYDFEKKVSDFLVDQ
SYFB_ONYPE        KLPPQTIQ----------------------------IPTQGKLTLKQKNIRELRKLLVNL
SYFB_MYCPE        NLELKPIE---------------------------SSFVDFEFDNFEENWNFLEKYFINK
B5Y860_COPPD      RIPSLPLM-----------------------------DYIPFREKESITKENKLREASSL
SYFB_PORPU        QFQSKIPK----------------------------IQFTKHPSSRRNFIDQIRNILRNL
SYFB_PHATC        NFLTMLPQ----------------------------IKSVGRADFSYQTRKKITSYLLNM
SYFB_GRATL        NFISKLPL------------------------NPIDNKNIFLNNIFANKVYRIRYLLRCL
C7LJX7_SULMS      HFNCKEKI----------------------YFSCSCKKRNFLLKKEKMIENMISNQLNSH
SYFB_MESFL        NIIEQPLE---------------------------YVSFKKTKNLDKKLKDKLSDYLVGA
                                                                              

SYFB_HELHP        GFVECIHYVFASSQNLERLGFVRLDED---------------------------------
SYFB_HELPJ        GFKEVIHYVFYSKEKQQKLGFEVLEDP---------------------------------
SYFB_DEHMC        GFQELISYSFTSREMLSRVSSGAEPE----------------------------------
SYFB_DEHM1        GFQELISYSFTSREMLSRVFSGAEPE----------------------------------
SYFB_PARUW        GLQEFITCDLIGPTLVNVVQNLSMPAE---------------------------------
SYFB_DESVH        GLNEAINYSFVGQKDLDHLNLAVDGR----------------------------------
SYFB_DESAG        GLNEAVNYSFVGHKDLDFLGLPAGNR----------------------------------
SYFB_SYNPX        GLQEITTLSLVSAS-------DSDPR----------------------------------
SYFB_GLOVI        GLTEVVTYSLAPDR-------DQQP-----------------------------------
SYFB_THETH        GFQEVYTYSFMDPEDARRFRLDPPR-----------------------------------
SYFB_DEIRA        GFQEVVTYTFTSDEEAQKARAEAPG-----------------------------------
SYFB_MYCTU        GYVEILPTPFLPAGVFDLWGLEADDSRR--------------------------------
SYFB_CORGL        GYAEIIPSPFMDPEVFDVWGLAADDERR--------------------------------
SYFB_CUTAK        GFVELITLPFIGDKDLDVLGISGDDTRH--------------------------------
SYFB_BIFLO        GMVESLSYPFVGDDDYKAFGFDPEATKK--------------------------------
SYFB_ECOLI        GYQEVITYSFVDPKVQQMIHPGVEA-----------------------------------
SYFB_PECAS        GYQEAITYSFVDPKIQGLIHPNEAS-----------------------------------
SYFB_MANSM        DFHEAITYSFVDPKLQSILHPEQAV-----------------------------------
SYFB_ALIF1        GYHEAITYSFVEPEQQKLIVPEIEP-----------------------------------
SYFB_PHOPR        GYHEAITYSFVEPEQQKLVVPGVEP-----------------------------------
SYFB_IDILO        GYQEAITYSFVDPKHQALMFDETAA-----------------------------------
SYFB_PSEPK        GYQEAITYSFIDPKLFELFSPGVEP-----------------------------------
SYFB_PSEPF        GYQEAITYSFIDPKQFELFNPGVEP-----------------------------------
SYFB_LEGPL        GYHETISYSFVDPELQEALYPQKEF-----------------------------------
SYFB_LEGPA        GYHETISYSFVDPELQEALYPQKEF-----------------------------------
SYFB_XYLFT        ELQETINYAFIDAELLRRWQLNTGQ-----------------------------------
SYFB_XYLFA        ELQETINYAFIDAELLRRWQLNTGQ-----------------------------------
SYFB_XANC8        ELQETINYAFVDAALLERWQLTDGV-----------------------------------
SYFB_XANOR        ELQETINYAFVDAALLERWQLTNGL-----------------------------------
SYFB_BURPS        DYAETVNFSFVDAEWERDFAGNDNP-----------------------------------
SYFB_CUPNJ        DYQEVINFAFVEEKWERDFAANDNP-----------------------------------
SYFB_BORBR        DYQEVVNYSFVEAAWERDYAGNDNP-----------------------------------
SYFB_THIDA        DYQEVITYSFVDPAGEQALDPDVRL-----------------------------------
SYFB_NEIMB        GYREVVSYAFVDEQWEQDFAANADP-----------------------------------
SYFB_LACJO        GLMEAISYSLTSPEKAISFTKDPKP-----------------------------------
SYFB_LACSS        GLTQAISYALTTEEKAGQFTLAAKQ-----------------------------------
SYFB_STRP3        GLTEIISYALTTPEKAIEFAVAPSH-----------------------------------
SYFB_STRP8        GLTEIISYALTTPEKAIEFAVAPSH-----------------------------------
SYFB_STRPN        GLTEIITYALTTPEKAVEFTAQPSN-----------------------------------
SYFB_STAAC        GLDQAITYSLVSKEDATAFSMQQRQ-----------------------------------
SYFB_LISIN        GLNQALTYSLTSKKDATRLALSDEK-----------------------------------
SYFB_OCEIH        GAMETLTYSLTNEQNVKRLVTPNID-----------------------------------
SYFB_SYNAS        GFSEVITYSFVSPTAADILALDAGD-----------------------------------
SYFB_MOOTA        GLAEVITYSFIGPRALDQLRLPEDH-----------------------------------
SYFB_DESPS        GFNEAINYSFVTAQHADMLQLSEQD-----------------------------------
SYFB_CARHZ        GMQEIITYSFINPDSYNKLGLSVDE-----------------------------------
SYFB_FUSNN        GLNEVINYSFIPKFTKELF-----------------------------------------
SYFB_BDEBA        GFQQAVNFAFVGSKAQKAFLGSLEALKATGL-----------------------------
SYFB_THEMA        GFDEVVTFSFVDSQKVKKWPLVDREP----------------------------------
SYFB_AQUAE        GLTEVINFSFEDS-KLYELLNLPLPE----------------------------------
SYFB_LEPIC        KYHEVFNYSFQSYKENEFSGDPKLS-----------------------------------
SYFB_LEPBL        GYHEVYNYSFQALKENELDGDVELS-----------------------------------
SYFB_RICTY        GYDEVVTNSFMSSEDAKLFAELKEE-----------------------------------
SYFB_RICPR        GYDEVVTNSFMSSEDAKLFAELKEG-----------------------------------
SYFB_BRUSU        GMMEAVTYSFISEAQAKAFGGGKPE-----------------------------------
SYFB_BRUME        GMMEAVTYSFISEAQAKAFGGGKPE-----------------------------------
SYFB_PELUB        GYFEAITWSFTDSKINQLFIENNKE-----------------------------------
SYFB_WOLTR        GFHEVFTWSFMSESIAEKFGYSNKL-----------------------------------
SYFB_EHRCJ        GLMEVITWSFTNMVFAEKLGYSSEL-----------------------------------
SYFB_BLOPB        GYQEIMTYSFVNYNIQKLLHPQKIP-----------------------------------
SYFB_BLOFL        GYQEIITYSFVDPNIQKLLHPQCIP-----------------------------------
SYFB_WIGBR        GYQEIISYTFVDKNIQNIIHPNKIP-----------------------------------
SYFB_BUCAP        GYYEIITYSFINPSLQDDIIPNNNQ-----------------------------------
SYFB_BUCBP        GYNEVITYSFVDSQIQKYLFPKRKQ-----------------------------------
Q057Y9_BUCCC      GYNEIISYSFVNLKMQRSFISKNHF-----------------------------------
SYFB_MYCGA        KFNHIRTYNLTSKKRAELLNLFKYQDPV--------------------------------
SYFB_MYCPN        GFHNVITYQLISPERARNFNLFGLSNLW--------------------------------
SYFB_MYCMO        NYNEIKTYSLVA-KEDNNFDPFNFKTEI--------------------------------
SYFB_MYCPU        NYSETRTYSLVS-KDKNIFNPFNFKENI--------------------------------
C4XE68_MYCFP      GYQEVRTFTLTN-IDALKFNPFEFKEDL--------------------------------
D3VQ30_MYCAA      GYNEIRTFSLIS-SEMNILNPFNFESTV--------------------------------
SYFB_MYCS5        GYSEARTFTLVN-EKDSKFDPLDLSDAI--------------------------------
SYFB_MYCHJ        GYYETNSFLLIS-KEEN-FNPLELKSQ---------------------------------
SYFB_MYCH2        GYYETNSFLLIS-KEED-FNPLELKSQ---------------------------------
SYFB_MYCH7        GYYETNSFLLIS-KKED-FNPLELKSQ---------------------------------
SYFB_PORGI        GFNEILNNSLTAGSYYEGLKSHPREMA---------------------------------
SYFB_CHLTE        NFREVLTNPLIRKAEADCFSSMLVN-----------------------------------
SYFB_SULDN        GFFESVHFVFDEKKVLQEYGFEILDESK--------------------------------
SYFB_RHOBA        GISEAMTPSVVTEKLDQMISPWTELPA---------------------------------
SYFB_TROW8        GHVEVICYPFVNLAAAGICHIDVTHNPDSTHNPDSGSDPIIPTGVTRITEPGSSGVSGPD
SYFB_CHLPN        GLQEFFTPDLLDPETVALTRKEKEE-----------------------------------
SYFB_UREPA        GLFECKTYNLKNQTQAHEFNFFNFKQA---------------------------------
SYFB_ONYPE        GFYETITYSLISSEMFEAFTPQKPF-----------------------------------
SYFB_MYCPE        GFTLVKTLNLTSLENNKAFNLFGSKKS---------------------------------
B5Y860_COPPD      YFQEVFMVSLISDKDVQNISAHMGIDAK--------------------------------
SYFB_PORPU        GLTELVHYSLVKSKGE--------------------------------------------
SYFB_PHATC        GLTELIHYSLVSNETFLKNE----------------------------------------
SYFB_GRATL        GLHEAQNYSFYDYYPFNHDTQIKIY-----------------------------------
C7LJX7_SULMS      GFYEILNSSLTEKKYSKYENNNFYEK----------------------------------
SYFB_MESFL        GFNNIKTYSLTDIESNKTWNLFKVKDP---------------------------------
                           .                                                  

SYFB_HELHP        ---------------------LELLNPITNELDTLRTSLLPAMLDSVKRNENLGF-KNIT
SYFB_HELPJ        ---------------------LELQNPITTELNTLRTSLVCGLLDASLRNKNLGF-KSIA
SYFB_DEHMC        --------------------FLAISNPMSSEQEVMRTSLRPSLYASLAANRRFEK-DGLR
SYFB_DEHM1        --------------------CLAISNPMSSEQEVMRTSLRPALYASLAANRRFEK-NGLR
SYFB_PARUW        -------------------AIVKVLNPTSIEQSILRTSLLPGLLQVVKYNLDHQN-HQIN
SYFB_DESVH        ---------------------IPIMNPLTADQNVLRTELAPGLLQNLRHNIAQGN-AGLR
SYFB_DESAG        ---------------------ISIMNPLTSEQDVLRTELAPGLLNTLRHNLAQGS-TGLQ
SYFB_SYNPX        ---------------------IAISNPLLAETSHLRTNLWEEHLAVCVRNLKASQ-PGCW
SYFB_GLOVI        ---------------------VVLSNPLSAELNSLRTNLIDGLLEILRFNRSQGN-MPFH
SYFB_THETH        ---------------------LLLLNPLAPEKAALRTHLFPGLVRVLKENLDLDRPERAL
SYFB_DEIRA        ---------------------VRLRNPMTTDRTGMRTALYPSLLRAAGAHPKG---ERAL
SYFB_MYCTU        -------------------MTTRVLNPLEADRPQLATTLLPALLEALVRNVSRGL-VDVA
SYFB_CORGL        -------------------KTVSVLNPLEAERNVLSTSLLPSMLDAVKRNVARGH-NDFS
SYFB_CUTAK        -------------------ATVKLANPLDDTRPYLRTTLLPGLFHAVTTNMSRSQ-DDLA
SYFB_BIFLO        -------------------VSVEIANPLYGDRPYLRREILPTLATTVQRNIRRGI-ENVS
SYFB_ECOLI        ---------------------LLLPSPISVEMSAMRLSLWTGLLATVVYNQNRQQ-NRVR
SYFB_PECAS        ---------------------LSLPSPISVEMSVMRLSLWSGLLSAAVYNQNRQQ-SRLR
SYFB_MANSM        ---------------------WILPNPISSEMSAMRVSLLTGLLGAVVYNQNRQQ-NRVR
SYFB_ALIF1        ---------------------LILPFPISAEMSAMRLSLWTGLINTVVHNQKRQQ-PRVR
SYFB_PHOPR        ---------------------LILPFPISADMSAMRLGLIQGLLNTVVHNQKRQQ-SRVR
SYFB_IDILO        ---------------------LTLPHPISVDMSSMRVSLWPGLVGAVAHNQKRQQ-SVLA
SYFB_PSEPK        ---------------------LLLANPISSDMAAMRASLWPGLVKALQHNLNRQQ-DRVR
SYFB_PSEPF        ---------------------LLLANPISNDMAAMRSSLWPGLVKALQHNLNRQQ-DRVR
SYFB_LEGPL        ---------------------MELLNPISSELSQMRAGMWPGLIASMIYNSHRQQ-TAVK
SYFB_LEGPA        ---------------------MELLNPISSELSQMRAGMWPGLIASMIYNSHRQQ-TAVK
SYFB_XYLFT        ---------------------VMLMNPLSAELAVMRPRLLPGLVAALGRNIARQL-ERVR
SYFB_XYLFA        ---------------------VMLMNPLSAELAVIRPRLLPGLVAALGRNIARQL-ERVR
SYFB_XANC8        ---------------------VPLANPLSAELAVMRPRLLPGLVATLGRNVARQV-GRVR
SYFB_XANOR        ---------------------VPLANPLSAELAIMRPCLLPGLVATLGRNAARQA-GRVR
SYFB_BURPS        ---------------------VRLLNPIASQLSVMRTTLFGSLVGVLRHNLNRRA-ERVR
SYFB_CUPNJ        ---------------------IRLLNPIASQLAVMRSSLIGGLLDKVRYNLNRKA-ARVR
SYFB_BORBR        ---------------------VRLVNPIASHLSVMRSSLIAGLVAIVRHNANRKQ-SRVR
SYFB_THIDA        ---------------------LTLANPIASQLSVMRTTLWGGLIETLRHNLNRQQ-ERVR
SYFB_NEIMB        ---------------------IRLQNPLAAQYAVMRSTLIGGLVEILQNNLNRKQ-NRVC
SYFB_LACJO        ---------------VVEV-----QWPLNSSRSTMRENLITGLVDAASYNMARKQ-KELA
SYFB_LACSS        ---------------TATVL----DWPMTQDHAYLRMNLVTGLLDDAAYNVARKQ-TDLA
SYFB_STRP3        ---------------LTEL-----MWPMSVERSALRQNMVSGMLDTVAYNVARKQ-SNLA
SYFB_STRP8        ---------------LTEL-----MWPMSVERSALRQNMVSGMLDTVAYNVARKQ-SNLA
SYFB_STRPN        ---------------LTEL-----MWPMTVDRSVLRQNMISGILDTVAYNVARKN-KNLA
SYFB_STAAC        ---------------TIDL-----LMPMSEAHASLRQSLLPHLIEAASYNVARKN-KDVK
SYFB_LISIN        ---------------TVAL-----SMPMSEEHSHLRTSIVPQLIRSASYNIARKN-MDVA
SYFB_OCEIH        ---------------LENSYPISLAMPMSEDHKYLRLSIVPELLRILQHNIARKQ-TDLN
SYFB_SYNAS        ---------------ERRK-VVRIKNPLTEDQSVMRTTLIYSLLKVMQENANAGD-YDLK
SYFB_MOOTA        ---------------PWRR-TVKIQNPLREEQSIMRPSLLPGLLEVAGRNASRRV-LPVA
SYFB_DESPS        ---------------YRRK-VVTLLNPLSEEQAVMRACLLPSLLENVKRNISFQK-TAVK
SYFB_CARHZ        ---------------VLTK-SVVLLNPLSIEQSVMRTTLLPGLLDIAKRNENRQQ-ENLL
SYFB_FUSNN        ---------------NFGDEVIEIKNPLSEDMAIMRPTLLYSLITNIRDNINRNQ-TDLK
SYFB_BDEBA        ---------------AATEKEIRILNPLNEEMDVMRSSLSFGLFKNLNHNFHSGN-MQGR
SYFB_THEMA        ---------------------IALSNPIASDMDVMRTSQFYSLIQVLAENFKRQN-RDLK
SYFB_AQUAE        ---------------------LEVINPLNPTQRYMRNTLITSLLRTAVYNDRNYN-YDQA
SYFB_LEPIC        ---------------------VKIKNEMPEEQSVLRNSLLPSLLKNTRTNQDRFS--EIK
SYFB_LEPBL        ---------------------VKIRNEMPEEQSVLRNSLISSLLKNIRTNQDRFS--EIK
SYFB_RICTY        ---------------------LFLLNPMSIDENYMRPTVLPNLISIVSKNLARAI-KDMA
SYFB_RICPR        ---------------------LFLLNPMSIEENYMRPTVLPNLISIVSKNLARDV-KDMA
SYFB_BRUSU        ---------------------LKLANPIAADMSDMRPSLLPGLLAAAQRNADRGF-GDIA
SYFB_BRUME        ---------------------LKLANPIAADMSDMRPSLLPGLLAAAQRNADRGF-DDIA
SYFB_PELUB        ---------------------IKIINPISSDLNVLRSSIFSNLIIHLNKNLGRGF-KDLS
SYFB_WOLTR        ---------------------FIIDNPFNNNFNIMRPSIVPNLLQVTADNIVHGM-SDLA
SYFB_EHRCJ        ---------------------LLIDNPISDKLNLMRPSLLLNLLQVVYENQAYGS-SEIA
SYFB_BLOPB        ---------------------LILKNPITSEMSTMRLSLWSGLIKTVIYNQNRQQ-KQMK
SYFB_BLOFL        ---------------------LTLMNPISTNMSVMRLSLWTGLIQTMLYNQNRQH-KNIK
SYFB_WIGBR        ---------------------VPIINPISTEMSVLRLSFFTNFIQTILYNQNRQT-KYIK
SYFB_BUCAP        ---------------------ILISNPISKDFSSMRLSLWPGLLKTVSYNKNRQQ-ESMR
SYFB_BUCBP        ---------------------FFLLNPISRKMSSMRLSLWNGLLSSVLYNQNRQE-KVMR
Q057Y9_BUCCC      ---------------------IKIQNPISNDMSIMRTSLWIGLLQCISYHQNRQY-ESIR
SYFB_MYCGA        ----------------------VVSKPISETRQYYRQNILTNLLEVYQLNRSYKN-KLYP
SYFB_MYCPN        ----------------------EIKNPLSNERSVLRVGLIDSLLRVIQKNAAYKN-KLGN
SYFB_MYCMO        ----------------------LMKTFPSEKRRIIRNSQAFSLLEIAEYNIKRKL-EKIN
SYFB_MYCPU        ----------------------NLETFHSKEREQIRNSMILSMEEVLQYNLKRKV-ENVN
C4XE68_MYCFP      ----------------------KLQTFVSKEREAIRNSIVPSLLEVAEYNLKRKM-NRLN
D3VQ30_MYCAA      ----------------------KLMTFVSKEREEVRNSIIPSLLESAEFNLKRKI-NNVS
SYFB_MYCS5        ----------------------KLETFVSKEREFVRNSLAISLAEAVNNNKKKKI-NNVN
SYFB_MYCHJ        ----------------------DLLTFPSQEHTKIRYSLAWQLAKITKYNQKRKI-TEIS
SYFB_MYCH2        ----------------------DLLTFPSQEHTKIRYSLAWQLAKITKYNQKRKI-TEIN
SYFB_MYCH7        ----------------------DLLTFPSQEHTKIRYSLAWQLAKITKYNQKRKI-TEIN
SYFB_PORGI        ---------------------VELMNPLSQELNCMRQTLLFGGLETLSHNLRRKH-LSLY
SYFB_CHLTE        -----------------------VLNPISEELEVLRPNLAPSLLKVVGYNMRHGN-RELR
SYFB_SULDN        ----------------------ELLNPIVNTLDTLRSTLLCGLLRATSNNINNGY-SSVK
SYFB_RHOBA        ---------------------LQTRTSMLEGARTLRRSLIPSLLQSRAANWASAS-LVAD
SYFB_TROW8        NVDVKEKCSADTSVEHPTTRAISLHNPIDATEGYLRRSLIPGLLQCAHRNLSRGL-CDLS
SYFB_CHLPN        -----------------------ISLQGSKHTTVLRSSLLPGLLKSAATNLNRQA-PSVQ
SYFB_UREPA        ---------------------YEINNPTSNMRSHLKLNNLNSLLEVLEYNQNQKN-ELEN
SYFB_ONYPE        ---------------------IKIMNPLSQDKMILRQSLLSSLVEVLSYQHKRQT-FDTA
SYFB_MYCPE        ---------------------IKIMNPISSEREYFRNNLIQQHLEVLSNNYAHKI-NLYN
B5Y860_COPPD      -------------------NVLAVDNPVSRELAYLRPNLLISLIKAALLNQNRFH-DDVH
SYFB_PORPU        ---------------------INLKNPLIKDYSTLRSSLLEGLINASAYNIKQSN-QTVD
SYFB_PHATC        ---------------------IKLVNPLLSDCSTLRVSLLPSLLMTIQENLKQGN-SILE
SYFB_GRATL        -------------------------NPLAQDQSFLRSSLAVHLTLNQQDNLRQGN-KDIE
C7LJX7_SULMS      ---------------------IFIFNSKNKNFSFLRDNLLFGILEKISSNKNK-------
SYFB_MESFL        ---------------------VVLMSPLSIQRETFRNNLSKSMIDTIIFNANNGN-KSVK
                                                                   :          

SYFB_HELHP        LFEIGSVYS-----------------------------SKREEKSKLALVASGCMQDECY
SYFB_HELPJ        LYEKGSVYN-----------------------------SKREEIQKLGFLVSGLQKKESY
SYFB_DEHMC        LYELGRVYLPK------------------------ENKKQEEPEMLCAVIAGGSSQSRWQ
SYFB_DEHM1        LYELGRIYLPK------------------------ENNKQDEPEMLCALIAGSASEAWWQ
SYFB_PARUW        GFEIGRIHFKD------------------------GDQYQEQS-VVGILLSGFSQPYHFE
SYFB_DESVH        LFEVAHIFEAD----------------------ATSDTTARERARLDILVYGSRYDSQWP
SYFB_DESAG        VFELAHIFEAD----------------------QSSDTTARESGRLGLLVYGQRYQDGWP
SYFB_SYNPX        IFELGTTYAG-------------------------SADAVEESRLLSGVICGEQRLERWT
SYFB_GLOVI        AFEVGVVFLR-------------------------SDEGIFESGRLGAVMCGEPAVGDWQ
SYFB_THETH        LFEVGRVFR------------------------------EREETHLAGLLFGEGVGLPWA
SYFB_DEIRA        LFEIGRIFP------------------------------AAGEQERLGLLMRGDLAARTY
SYFB_MYCTU        LFAIAQVVQPTEQTRGVGLIP-VDRRPTDDEIAMLDASLPRQPQHVAAVLAGLREPRGPW
SYFB_CORGL        LFGLQQVA--FEHGSGVSPMPSVASRPEESVVAELVDSLPNQPLHVATVGTGNIEFEGPW
SYFB_CUTAK        VFESGTVF--RAVTPAAAPRPGVDERPSDEVLAEIDAALPAQPRMLAAVICGSWLPDRWD
SYFB_BIFLO        LYELGHVYLWDPNAPAIPALP-GGVRPTDEQLAALDAGLPEQPDHVAGILTGLAEDDGWM
SYFB_ECOLI        IFESGLRFV----------------PDTQ------APLGIRQDLMLAGVICGNRYEEHWN
SYFB_PECAS        LFESGLRFV----------------PDAS------ADLGIRQDLMLSGVITGTRYEEHWD
SYFB_MANSM        LFETGLRFI----------------PDES------AEFGIRQELVFAAVMTGSRLSEHWA
SYFB_ALIF1        LFESGLRFI----------------PEES------AENGMRQEMMLAGIIAGTRGEEHWD
SYFB_PHOPR        LFESGLRFI----------------PEAS------AENGMRQEMMLAGVIAGTRGEEHWD
SYFB_IDILO        FVETGLRFI----------------PDES------AENGVRQEAVISGIRSGKAHSEHWS
SYFB_PSEPK        LFESGLRFV----------------GQL---------GDLQQQPMIAGVITGSRLPEGWA
SYFB_PSEPF        LFESGLRFV----------------GQL---------EGLKQEPMIAGVVCGSRLPEGWA
SYFB_LEGPL        FFEIGVVFD----------------LDG---------GQLKERSCIAGLLMGEQGNLNWS
SYFB_LEGPA        FFEIGVVFD----------------LDG---------GQLKERSCIAGLLMGEQGNLNWS
SYFB_XYLFT        LFELGNVFT----------------ASDE------AGAAPLETRHVAAAVCGDAFALQWG
SYFB_XYLFA        LFELGNVFT----------------ASDE------AGAAPLETQHVAAAVCGDAFALQWG
SYFB_XANC8        LFELGKVFS----------------AAG-------PGDAPVESQQVAAAVCGDALALQWG
SYFB_XANOR        LFELGKVFA----------------AAAD------AGAAPQESQHVAAAVCGDALALQWG
SYFB_BURPS        VFEAGRVFV----------------ADPSVKAGELAVEGYAQPKRIGALAYGPVVEEQWG
SYFB_CUPNJ        LFEVGRVFH----------------RDADVKDGGLTVAGYHQPMMAAGIAYGPAFEEQWG
SYFB_BORBR        LFELGRVFH----------------RDPQLADGPLEVAGVRQPLMLAGVAWGGAVEEQWG
SYFB_THIDA        IFELGRVYA----------------SLAE------------QPRKLGGLAYGEALPEQWG
SYFB_NEIMB        VFEIARVFS----------------KGSD--------GQFVQNERIGGLWYGAVMPEQWG
SYFB_LACJO        LFEQGRVYDHENNTF-------------------------NEHEHLAALYSGHTLAA--N
SYFB_LACSS        LYEQGRVFLQHADQAR-----------------------PNEVEYVAGLMSGNRQVK--S
SYFB_STRP3        LYEIGKIFEQEVNPKED---------------------LPNEVNHFAFTICGLVAQK--D
SYFB_STRP8        LYEIGKIFEQEVNPKED---------------------LPNEVNHFAFAICGLVAQK--D
SYFB_STRPN        LYEIGKVFEQTGNPKEE---------------------LPNEINSFAFALTGLVAEK--D
SYFB_STAAC        LFEIGNVFFANGEGE-----------------------LPDQVEYLSGILTGDYVVN--Q
SYFB_LISIN        LYEMGTVFYATEGDN-----------------------LPIEQEHLAGLITGNWHTA--D
SYFB_OCEIH        YFEIGKVFISEEQELTH---------------------QPTEKLHLAGAFTGLWHNH--P
SYFB_SYNAS        IFEIGKIFLQGNTGGL-----------------------PTEKKRLACLMTGMSDKE--L
SYFB_MOOTA        IYELGRVFIPAGSRR------------------------PGEPLRLAGLVMGTTPR---G
SYFB_DESPS        LFEIGKIFLAQGEDVQ-----------------------PIERQCITGVLSGNKFGESSS
SYFB_CARHZ        LFEMGNVFEKNGEDL------------------------PKETKLIGGIALGYRYGD---
SYFB_FUSNN        LFEISKTFKNLGAEKDG---------------------LAIEDLKVGIILSG--REDKNL
SYFB_BDEBA        LFEIGSTFF---VKDDG---------------------SFAEGSRAGMAIWG--RAS-NL
SYFB_THEMA        LFEIGKIYFK----------------------------ENGNFREIETLSAMSCGLENPG
SYFB_AQUAE        VFELGKVFFK----------------------------EGE-----ENRLGILLKGNKPR
SYFB_LEPIC        IFEFGRVYFNLP--------------------------EPENEKKIFAFAVSLDKKSSEP
SYFB_LEPBL        IFEFGRAYFNIP--------------------------EPDNEKKFFSFAVSFDRKSSES
SYFB_RICTY        FFEVGPSFINLNTE------------------------LTYLTAIISGSFN------NKN
SYFB_RICPR        FFEVGPSFVNLNIE------------------------STYLTAIISGAFN------NKN
SYFB_BRUSU        LFEVSGIYEGDTPD------------------------KQRRVAGGVRRGTAKVEGAGRF
SYFB_BRUME        LFEVSGIYEGDTPD------------------------KQRRVAGGVRRGTAKVEGAGRF
SYFB_PELUB        FFEIGPTFLGSEPG------------------------EQQTVATGLRSG----KLARQS
SYFB_WOLTR        IFEIGPVYDSLDQP--------------------------KYSLSGIRTGN----NLPRN
SYFB_EHRCJ        IFEIGQVYGFNNICG-----------------------SNSNVVCGVRYGN----NLPRN
SYFB_BLOPB        LFESGICFIPQKNAE----------------------NQVNQDLMIAGIRSGLRFNEHWD
SYFB_BLOFL        LFESGICFIPKNSHS----------------------KQVSQQLRLSGIRSGLRHYEHWD
SYFB_WIGBR        IFESGFCFSKNKKYK----------------------LGIKQSFFISGAVSGFKNVESWY
SYFB_BUCAP        FFERGLCFSIDESQI----------------------LGIRQEMFLGGVISGFYSKENWF
SYFB_BUCBP        FFESGLCFEEDGNEY----------------------LGVKQDLYLAGVISGYKNETDWR
Q057Y9_BUCCC      VFEFGLCFYLKNKNK----------------------FSIIQDEYLSAAISGFSNRREWY
SYFB_MYCGA        IFEIQSLLTKNGANHHI------------------------------GLVMANNLFNHSY
SYFB_MYCPN        IFEFSFVKTKDSNQLHI------------------------------AALWLEKMFGSTY
SYFB_MYCMO        FFDFGMINEGK----------------------------------------RALIFASNE
SYFB_MYCPU        IFEIGIINNSQ----------------------------------------RSLALLSNQ
C4XE68_MYCFP      LFECGMINNGK----------------------------------------YVYGLLSNT
D3VQ30_MYCAA      LFEHGMINDNK----------------------------------------FVYGLLSNE
SYFB_MYCS5        LFEVGMVNANL----------------------------------------FYACLATTD
SYFB_MYCHJ        LYEKGSIAGWN----------------------------------------HSLALASTI
SYFB_MYCH2        LYEKGSIAGWN----------------------------------------HSLALASTI
SYFB_MYCH7        LYEKGSIAGWN----------------------------------------HSLALASTI
SYFB_PORGI        LFEWGKCYRFHAAKRTD----------------ETPLAAYAEDDRLGIWICGQRVHNSWA
SYFB_CHLTE        LFEVAHGFEKQPEAGRG---------------NEGPLSAFLEKELLSMVITGRREPRSWN
SYFB_SULDN        LFEVGSVFNSQ----------------------------REESLKMALIFSGDREAESLA
SYFB_RHOBA        LFEIAHVYLPAPAG-----------------------------------SDSALLPDETY
SYFB_TROW8        IFEIGRVFLGQLRTSNLIGCN-SDSTCNACSRKNTIESMNEVYQPYTVSVLQTGSAIQKQ
SYFB_CHLPN        AFEIGTVYAKH----------------------------GEQCQETQTLAILLTEDGESR
SYFB_UREPA        IFEISKINPVD------------------------------SSQQTVLSIILCKPLINSK
SYFB_ONYPE        FFEIGKTYFPN-------------------------------QETLSLAFALNGHFLNSL
SYFB_MYCPE        IFEIQGLNYDG-------------------------------LWNKHLCLTLPIEHFNNK
B5Y860_COPPD      LFEIGSVFTRVSKD------------------------ANSTEVEERRHIAYLSKGLYWE
SYFB_PORPU        GFEIGTVFNLKR--------------------------NKIIETTKLAIILGGSLDIRSE
SYFB_PHATC        GFEYGHVFSGNIETT------------------------LTEIEYVGGIFGGTKIKSSWF
SYFB_GRATL        VFEIGKVFRLYSSSLEY------------------DNTLNSFEFLHLSGLIANSIFLRPS
C7LJX7_SULMS      FFEWGKKYF----------------------------------------FYKKNILENKT
SYFB_MESFL        FFEMADIFALNGFR------------------------------QSNLCFGVSGEAITDS
                                                                              

SYFB_HELHP        PHTKAVKWNLFAFGTICQRCVGDLSFRNIRDEANAKELLSHFCFTDERLLHPYQSAFVYQ
SYFB_HELPJ        PHAKGKAWDFYSFAECVSRIIGDFSLEKLT--------------TQTPINHPYQSAKIIQ
SYFB_DEHMC        R--NTAGFDFFDVKGIVESMVSRLGLS-ADFVVSD-----------EHGLSHGYQAGILV
SYFB_DEHM1        R--NTAGFDFFDAKGIVESLVSRLGIA-ADFAVSD-----------EPGLTPGYQAGILV
SYFB_PARUW        E--KKREYDFYDLKGIIENLLKELGIEKPQFKNLD-----------LKTFHSGRQASLFV
SYFB_DESVH        H--VEADADYADIKGIVEHCLAFLHLEGATFTLAA-----------SHPFLMPCVDVAVQ
SYFB_DESAG        R--REEDAGYEDLKGIVEHLLRVLNLGPAAFTLRK-----------DHSWLLPCVEIRVG
SYFB_SYNPX        TSGKPAPPDYYAARGRLTEVMQALKLDVSDRRLTD-----------DSRLHPGRAATLVL
SYFB_GLOVI        K--LTPPFDWFAAKGVLAAILQPWQIEVEYQADRR-----------DERLHPGRTASLWV
SYFB_THETH        K--ERLSGYF-----LLKGYLEALFARLGLAFRVEAQ--------AFPFLHPGVSGRVLV
SYFB_DEIRA        Q--DGVRGDFSVFKGLVQGFAGAVGASFALEQLRGDD--------VPAALHPGVAGAVVW
SYFB_MYCTU        G--PGRPVEAADAFEAVRIIARASRVDVTLRPAQY------------LPWHPGRCAQVFV
SYFB_CORGL        G--KGRAYTFADAIESARAVARAAGVTLELANADA------------LPWHPGRCAALLI
SYFB_CUTAK        G--ESVKADWRHAVLVAQKAADALGVRLVRKADRQ------------APWHPGRCAALIV
SYFB_BIFLO        G--GKRPVDWSDAVEAVRRIAGRIGAAIELDQPAADD--------VPVQWHPGRAARVMV
SYFB_ECOLI        L--AKETVDFYDLKGDLESVLDLTGKLNEVEFRAE----------ANPALHPGQSAAIYL
SYFB_PECAS        L--ARQAVDFYDLKGDLEAVLALTGKLSEVEFKAE----------NNPALHPGQSAAIYL
SYFB_MANSM        S--KAEPADFFDLKGYIENLLSLTKAGPYIKFVAK----------EFPAFHPGQSAAIVL
SYFB_ALIF1        I--ATNTVDFFDLKGDLEAVLELTANELAYEFKAA----------KHPALHPGQTAAIVV
SYFB_PHOPR        I--DTNTVDFFDLKGDLEAILELTANEKAYSFKALSSEN----KKQNPVLHPGQSAVIVV
SYFB_IDILO        E--GDRPVDFYDVKGDVEALLAQTGNAAAFRFVAS----------QNPALHPGQSAAIYR
SYFB_PSEPK        N--GRDGVDFFDVKADVEALLGYSGALSDFTFSAG----------KHPALHPGQTAVIER
SYFB_PSEPF        Q--GRDTVDFFDVKADVEAVLGFAGALDQFTFAPG----------KHPALHPGQTARIER
SYFB_LEGPL        E--SARLFDFYDLKGDLQSLFA-SLKLDDVEFIQS----------SHHALHPGQSAQIVI
SYFB_LEGPA        E--SARLFDFYDLKGDLQSLFA-SLKLNDVEFIQS----------SHHALHPGQSAQIVI
SYFB_XYLFT        E--QVRKVDFYDLKGDLESLAAASGAVLTFHSSAQ------------PWGHPGRSADVWC
SYFB_XYLFA        E--QARKVDFYDLKGDLESLAAASGAVLTFHSSAQ------------PWGHPGRSADVWC
SYFB_XANC8        E--PARKVDFHDLKGDLLALAAASGAVLEFQPSTQ------------PFGHPGRSADIYR
SYFB_XANOR        E--AARKVDFHDVKGDLMALAAASGAQLEFQPSTQ------------PFGHPGRSADIYR
SYFB_BURPS        T--ATRQVDYFDVKGDLEALLAPVPA--RFVKAEH------------PALHPGRSARIEV
SYFB_CUPNJ        I--TTRNVDFFDVKGDVETLFYPRVA--RFEPVEH------------PALHPGRAARMLI
SYFB_BORBR        V--PHRQVDFYDVKQDVEALFGARADALRFVADRY------------PALHPGRSARIEL
SYFB_THIDA        V--PGRRVDFFDVKGDLERLFGQPLD---AGRGEH------------PALHPGQSAALWV
SYFB_NEIMB        G--KTRNADFYDIKADVENLLKNKAV--EFVKTGH------------PALHPGRAANIVS
SYFB_LACJO        WQHLDQKIDFYFVKGQLTNLFRAIGIKDEDVEYRA---------ELVQGMHPTRTAGIYI
SYFB_LACSS        WQEAAAPVDFYTIKGIVDTLMASYNLQAAVAYQAT---------DAYPEMHPGRTAAIYV
SYFB_STRP3        FQTQAQAVDFYHAKGILDTLFANLNLK--VQYVPT---------KDLANMHPGRTALILL
SYFB_STRP8        FQTQAQAVDFYHAKGILDTLFANLNLK--VQYVPT---------KDLANMHPGRTALILL
SYFB_STRPN        FQTAAVPVDFFYAKGILEALFTRLGLQ--VTYTAT---------SEIVSLHPGRTAVISL
SYFB_STAAC        WQGKKETVDFYLAKGVVDRVSEKLNLE---FSYRR---------ADIDGLHPGRTAEILL
SYFB_LISIN        WQKTPKPVDFFVLKGIVEGLVNKLGIEA-ELHWKQ---------IEKEELHPGRTASIQL
SYFB_OCEIH        WQQDKKQVDFFVVKGIIEGLFNYLQLN---ISFKQ---------VKMKDMHPGRCAELNI
SYFB_SYNAS        WSSGESRLDFYDLKGVVESLFASLNLTGIRYCS----------DALQAFLHPGRSCGIFI
SYFB_MOOTA        WNWPAGEMDFYYLKGILESIFSRLRVRDVSWEA----------SNAYPFLHPGRAATIKA
SYFB_DESPS        LYFKSANVDIFDAKGTVEFILSEMGLTDLANNEKIEFTVP-PEGAREPFSTQDYALTIHL
SYFB_CARHZ        WYNKPRKYDFYYVKGILESLFTSLGINNFSFSA----------AKDLPFLHPGKAARVYL
SYFB_FUSNN        WNQSKTDYNFYDLKGYLEFLLERLNVTKYSLTRLE------NSN-----FHPGASAEIKI
SYFB_BDEBA        WNKSLDYPVVYELKAAVEVLLKSLNISSYTWVTPA------NKSEVPEFLHQGQFAQLLV
SYFB_THEMA        DYTDKRSVSFYTIKGVLDELFFRLGVNVVYRAAEI------------PGLFPTRSARIYV
SYFB_AQUAE        TLKEEK-WEPYDLTEIIAGIFALFGLEPEFRNAKR------------NFLHPYVQGEVYL
SYFB_LEPIC        D-LKLLEEDFLKIKKEVESFLESIQIYEYTWKIQQ-----------ETIFHPGANLCLVA
SYFB_LEPBL        D-LGLLEDDFLKVRKEIESFLKYIRIFEYFWDIKP-----------EIFFHPGASLSLIV
SYFB_RICTY        PHSLGRSYDIFDIKGALEQVIEYAGLSLDKCIVAN---------ETVLPQYYHPTRAINI
SYFB_RICPR        PHSFGRNYDIFDIKGDLEQVIEYAGLSLDKCIVID---------ETVLPQYYHPTRAINI
SYFB_BRUSU        WAGNAAPVGVFDAKADALAALEAAGAPVDRIQIEA---------GGPEWLHPGRSG--TL
SYFB_BRUME        WAGNAAPVGVFDAKADALAALEAAGAPVDRIQIEA---------GGPEWLHPGRSG--TL
SYFB_PELUB        WLEKERLIDVFDVKSDVIKSLVEAGYNKDKLYIDD---------EAPSYYHPGKSGRIFL
SYFB_WOLTR        HYNTDRKIDVFDAKADLIAALELFNVSYGNLTIER---------AEKEYYHPGKSG---T
SYFB_EHRCJ        LYKCDRSVDVFDVKSDVISILQELNIESNSIELRK---------SDKSYLHPVRSA---D
SYFB_BLOPB        LT-KVCPVDFYDIKGDVEALLNITNKLH---CIRFKKYT-------HPALHSGQSAAIYL
SYFB_BLOFL        I--HTSLTDFYDIKGDVESILYLFNKKNQNNNIHFKSCT-------YPALHPGQSAEIYL
SYFB_WIGBR        S--KQREIDFFDIKGDVETLLYLNGNSS---DFEFKTCK-------NKEFHPGKNSKIFF
SYFB_BUCAP        S--VRRKVDFYDLKGDLESLLEVICGLN---KFEIRHQN-------ILGLHPEQSAKIYL
SYFB_BUCBP        S--FNKIVSFYDLKGDIELIMALLRKLD---KVSFKKML-------FQNLCPKQSAAIYF
Q057Y9_BUCCC      Y--RKRKFDFYDLKGDVESILNILGKFD---NIEFVSEK-------FLGLCLGKSAGIYL
SYFB_MYCGA        DPSSGIKLDLITIKGISDIIVQNFGFNCNYQTIND-----------DTYLVKNDSLKLVV
SYFB_MYCPN        QKDQGVSVDIPAMKGLAQLIISNFGFNCDFEPITE-----------GEYFTKNVGLKLVV
SYFB_MYCMO        KSFNEIKKDLFSLFSYK-FELRKTK---------------------NNYLHPNASAHIFY
SYFB_MYCPU        KSFNRFKEDVESILKDKLYSFEKGG---------------------FDFSHPLESIIIKD
C4XE68_MYCFP      KTFEQVKQDVVNFLNDNNLVFKPFKD--------------------NQFIHPNVSAKIYQ
D3VQ30_MYCAA      KSFDEIKQDIYNFLKVDNLEFIPFKD--------------------NELIHPNVSAKIIY
SYFB_MYCS5        KSFLELKQDFVSFFDNLNLEFKKPK---------------------NQFLHPNYSAEIYL
SYFB_MYCHJ        YTSEDLKKHLKILYNYDFDFLPADS----------------------EFLNPEKSQFIYL
SYFB_MYCH2        YTSEDLKKHLKILYNYDFDFLPADS----------------------EFLNPEKSQFIYL
SYFB_MYCH7        YTSEDLKKHLKILYNYDFDFLPADS----------------------EFLNPEKSQFIYL
SYFB_PORGI        HP--EEPTSVFELKAVVEQVLCRVGIETGAYTLKT----------ADNDLYASAMEVKTR
SYFB_CHLTE        R--QDENVDFYDLRGVVEMLLEKLNLLEKSAFNIY------------NARTIGIEITSTE
SYFB_SULDN        NTGKPAKVDFALFVQKVSNVIGEFELREYKTKHTL--------------SHPYQCAEIFI
SYFB_RHOBA        HIGLIAGEDFFALKGTIETLCDRLGIPGELTVGPVQ----------RDGFAKGGAVELTL
SYFB_TROW8        PYTEGRKYDLADVFDSARQIARGLGVDFHFVQDKH------------PAFHPGRCAKVIC
SYFB_CHLPN        SWLPKPSLSFYSLKGWVERLLYHHHLSIDALTLES---------SALCEFHPYQQGVLRI
SYFB_UREPA        INDSLIVNNFVTTKALLHALLTKLNIDYAYDKNHV----------VNELYDNNQLALINA
SYFB_ONYPE        WHKQDVSSSFFVTKGILEKISAFLGITLTYQKTQQ-----------HSNFHPGMQANLLF
SYFB_MYCPE        INNSKIVIDLLFIKSILTDLFNVFNIPFEIKAIENLS-------NDIEFISTNNGFEIYV
B5Y860_COPPD      NALDKDLWSYREFKGALENIFERCSLTLGWENAFV------------SWAESQFSGIIKY
SYFB_PORPU        WSEPAHSLNWYEAKGIIENFFRKLNKSIQWVKRESSN-------DQINFIQNNKSATLTY
SYFB_PHATC        E--KGQSLKWFEAKGKIEKLFQQLNLGIHWRINSQTY--------TKKFLHPYRSAEIFL
SYFB_GRATL        WSDKEQSLSWFHAKGMVEEFLDRLEVPVVWKKISDLD---------QSNLFFNLMHLLNM
C7LJX7_SULMS      LGIICANNSFFKFKGIIEQLIIRCGINVD-----------------NQKIYKNGISFNYK
SYFB_MESFL        LSQVHIKSNYAYISSILMSVLDLYKVDVTNVTFEVND-------KAIDEIHPYINATVKY
                                                                              

SYFB_HELHP        KD------KPIGIIAKLHPQVAT--NMDLSEEIFICEIEIGMSDFSLPQAY--------E
SYFB_HELPJ        NN------EIIGVIAKIHPKVIQ--ELDLFES-YYAEIDASKLKRPAMLLK--------P
SYFB_DEHMC        GD------MPVGILGQVSPQTAD--KFDITEPVYMFEINLSKLITRAMVRR-----KFNP
SYFB_DEHM1        GD------MPVGVLGQLSPQTAD--KFGITEPVYMFEINLSKLITRATVRR-----KFTQ
SYFB_PARUW        DE------LEVGSFGEVHPSIQR--RLDVSQRILFGEFNLHDLMQVATKLE-----KVKP
SYFB_DESVH        -G------RQVGVIGRVRPEIAD--AYHARKDAWLADLDLDVLRELHDAAR----IAFRS
SYFB_DESAG        -S------VCAGVAGRVKPDIAD--AYHARKDVWMAEIDLDALRTLCRDVA----VQFSA
SYFB_SYNPX        EG------RPLGCFGQLHPELAA--SQNLPEATFLFELDLTRLVESATRRNR-WVPAFKA
SYFB_GLOVI        SG------ERLGTLGQLHPRLAS--RLDLPEQTFVFEIDLDFLIDLVRERP----VEFRS
SYFB_THETH        EG------EEVGFLGALHPEIAQ--ELELP-PVHLFELRLPLPDKPLAFQD---------
SYFB_DEIRA        NG------ERVGWLGALHPEIAQ--EFGLKGDTFLMEAALPLPGRDWAFRD---------
SYFB_MYCTU        GE------SSVGHAGQLHPAVIE--RSGLPKGTCAVELNLDAIPCSAPL-------PAPR
SYFB_CORGL        DG------TPVGYAGELHPQILE--KAGLPARTCAMELDLSALPLVENL-------PAPV
SYFB_CUTAK        DG------KVIGHAGELHPTVVS--KAGLPQRTCAVEFNLDALVAAAPRGG-----EVMA
SYFB_BIFLO        GD------VFTGWVGELHPRVNE--ALGFPAHSAAFELNLTALFATLTGKPV----QAKP
SYFB_ECOLI        KG------ERIGFVGVVHPELER--KLDLNGRTLVFELEWNKLADRVVPQA-------RE
SYFB_PECAS        CG------ERIGFIGVIHPELER--KLDLNGRTVVFELLWDKVADRVLPDA-------NE
SYFB_MANSM        DG------EEIGYIGQLHPMAAQ--KLGINGKAFACELIVDKVAERNVANA-------KE
SYFB_ALIF1        DG------KEVGFIGTVHPELER--KFGLNGRTIMFEIEWDAINTRVIPEA-------AS
SYFB_PHOPR        DAGLETE-KEVGVIGTVHPELER--KFGLNGRTIVFEIEWAAINTRVLPEA-------VA
SYFB_IDILO        GS------EKVGDIGALHPKFDK--ALGLNQRTFVFELALSVVTERPLPQA-------KP
SYFB_PSEPK        DG------KLVGYLGAIHPELAK--ALGLDRPVFLFELVLGDVVEGRLPKF-------SE
SYFB_PSEPF        EG------REVGFIGAIHPELSK--SLGLDRPVFVFELVLAEVALGKMPKF-------HE
SYFB_LEGPL        NG------KHSGWIGVLHPRLSD--AFDLDQDVVLFELNLESLINPTIPLY-------KP
SYFB_LEGPA        NG------KHSGWIGVLHPRLSD--AFDLDQDVVLFELNLESLINPTIPLY-------KP
SYFB_XYLFT        DD------MCIGWIGQLHPALTQ--TLEINVDVIAFELALEPLVRRALPRA-------HA
SYFB_XYLFA        DD------TCIGWIGQLHPALTQ--TLEINVDVIAFELALEPLVRGALPRA-------HA
SYFB_XANC8        DG------VCIGWIGQVHPRLAK--SLDIDVDVIAFELQLAPLVKRALPRA-------GE
SYFB_XANOR        DG------VCIGWIGQVHPRLAK--ALDIDVDVIAFELQLGPLVQRTLPCA-------GE
SYFB_BURPS        DG------HAVGWIGELHPRLMQ--KYELPHAPVMFEIDTDALVARALPAP-------SE
SYFB_CUPNJ        DG------KPVGVVGEMHPRWLQ--EYELTQAPVLFELELDALREAGLPTY-------AE
SYFB_BORBR        DG------QPIGWLGELHPQWTQ--QADLHHAPVVFELDFEALAERRLPAV-------RE
SYFB_THIDA        DG------HRGGWIGALHPRLVQ--AFDLAAAPVLFELDSEILARRALPRH-------AG
SYFB_NEIMB        DG------KVIGFVGELHPKWLQ--KYDLPQAPLVFEIDMAAVLECGKTRY-------RV
SYFB_LACJO        ND------QYIGLIGMLAHAVTTLDKALRGSEIYVYEIDLDTIVSMLHKGM-----KAKA
SYFB_LACSS        GE------TFVGIVGQIHPKIA---KATHLKETYIFELDLAKILELQRQTI-----IAKP
SYFB_STRP3        DE------QVIGFVGQVHPGTA---KAYSIPETYVAELDMAALEAALPSDQ-----TFAE
SYFB_STRP8        DE------QVIGFVGQVHPGTA---KAYSIPETYVAELDMAALEAALPSDQ-----TFAE
SYFB_STRPN        GD------QVLGFLGQVHPVTA---KAYDIPETYVAELNLSAIEGALQPAV-----PFVE
SYFB_STAAC        EN------KVVGFIGELHPILA---ADNDLKRTYVFELNFDALMAVSVGYI-----NYQP
SYFB_LISIN        EG------KEIGYLGALHPAVE---ASYDLKETYVFEINVKALLDATKEKV-----VYHP
SYFB_OCEIH        DG------ENIGFMGQLHPKTA---NVFDLPETYVFEIDLESVFEKYINVP-----SFTD
SYFB_SYNAS        DE------KSIGYMGEAHPDVLS--RLDMKNRALIFEMDVDAISELFSGSV-----TYKE
SYFB_MOOTA        GT------RVLGYLGELHPDVLA--AVELPARACAFELDWEAAGDLALRVP-----RYEP
SYFB_DESPS        GP------NVLGTIGKVEEEVLK--SFGIKHEVYYFDLNFDALCALSPQTK-----AFSS
SYFB_CARHZ        EN------TEIGYLGELHPLVQK--KYEFKNTPLVFELNYDLLKTLIPAEK-----KYTP
SYFB_FUSNN        GE------DIIGVFGELHPNLVN-YFGIKREKLFFAELNLTKLLKYIKIKV-----NYES
SYFB_BDEBA        EG------KKVGFIGTLHPLLLE-DNKI-RVPAALAELDLDQLYKGQPRPY-----RIQS
SYFB_THEMA        EN------REIGFIGMVDPKLLD--EYDVKEDTYFFEIDMELLRKYASKRP-----AYRP
SYFB_AQUAE        EG------EFVGFFGKLHPKIAK--ELELKGEPFVAEIEIERVLSKK-RLP-----HYRE
SYFB_LEPIC        RSGKDGLETIVGNLGYVHPAILD--SFELKKRVIYGSFEFERIVELWNQNRK--VSRFVT
SYFB_LEPBL        DSKQ------IGNLGYVHPAVLD--SFELKKRVIYGSLEFEKLVEIWNTNRN--ISRFNV
SYFB_RICTY        RLGKN----LLGHFGQIHPKILK-YYDIN-QEIFAFELNITNLPLIKAKFGK---RNELK
SYFB_RICPR        RLGKN----LLGHFGQIHPKILK-YYDIN-QEIFAFELNITNLPLIKAKFGK---RDEFT
SYFB_BRUSU        KLGPKV---VLGTFGEFHPDTLE-ALDVS-GALCGFEVYLDAIPEPKAKSAR-T-KPALS
SYFB_BRUME        KLGPKV---VLGTFGEFHPDTLE-ALDVS-GALCGFEVYLDAIPEPKAKSAR-T-KPALS
SYFB_PELUB        NKGKEK---VVAFFGDIHPGILK-KLDIKVESLVGFEIFLDNLKQPKKSLKD-Q-KTQYK
SYFB_WOLTR        LSFKNK---ATGYFGELHPNILD-LFDIK-QKVVGFEMILENMGNLPVSREK------FI
SYFB_EHRCJ        VYFKDI---CLGYFGELHPNIVH-LYEIK-RPVVCFEVFLYKIPKVDVAHKE------LT
SYFB_BLOPB        KN------ICIGYIGMIHPTIQM--KLNLRSQVLVFELSWNMISQFTLPKI-------TT
SYFB_BLOFL        ND------IFLGYVGVIHPMIQY--KLRIHSNVLVFELIWDSIVNIKSQKI-------ID
SYFB_WIGBR        KK------KYVGIIGEINPNIQN--KLDIKNRIFVFELLWDNIKNFYVPKI-------YN
SYFB_BUCAP        DN------KYIGSLGKIHPKIEK--KLNLYNSTFLFELSLNYISKLKFYNT-------EE
SYFB_BUCBP        ER------EMIGVIGVISSNISK--KMGLKYKTIVFELIWKKIAQSNDYRI-------RD
Q057Y9_BUCCC      HG------ELIGFL---DSSLHR--LFNLKNSVILFEIKWKKICSHQIKKI-------KS
SYFB_MYCGA        YD------ETIGYIGKIKKSILK-EFDLADQDIYCLDINLERLITSINRYVR----TYEA
SYFB_MYCPN        FN------EQIGYVGLIKDELLA-PYDLKGRPVYGLEINLDRLLNSLNRLER----SYTP
SYFB_MYCMO        EN------KLIGWMGKINPSLKI-SDLIFVEILLDE-FNISKNQ-------------FKE
SYFB_MYCPU        ND------QLIGYIIRANAKDFE-EDFVYAEILIDK-LRNKKIE-------------NKS
C4XE68_MYCFP      NN------SFIGWLGKVNPSYNS-VDAWVCEVHKEV--NKGYKL-------------FEN
D3VQ30_MYCAA      NG------CFIGWIGKVHPSYNA-SNFWVAEFINVN--NNSKVE-------------FNV
SYFB_MYCS5        ND------QKLGWIGKINPSFLD-LDCLFVEFKYDLYFDDKFKK-------------YEA
SYFB_MYCHJ        DN------VLVGWLGQVAEKYNY-ENVNFLEILLSKVEKIPKKEGGKIK--------FRP
SYFB_MYCH2        DN------VLVGWLGQVAEKYNY-ENVNFLEILLSKVEKIPKKEGGKIK--------FRP
SYFB_MYCH7        DN------VLVGWLGQVVEKYNY-ENVTFLEILLSKVEKIPKKEGGKIK--------FRP
SYFB_PORGI        SG------KLLGTFGTVSTELIK--RFEIEQPVYFAELLWDALMSESARYKL----EARD
SYFB_CHLTE        NG--KTSVLKAGTVQQVNREVLD--VFGLDQDVYLAELDVTLLERCFESGVI-----YEP
SYFB_SULDN        KE------VSVGEIFRLHPNVEQ---KYDLDVTYMCELNFNKLPNDLKTAK--------Q
SYFB_RHOBA        VGDDAKEPLRLGFLGFVDGKLVK--QWKLTGRVVAAELSADVLVNQSRLVPQ-----QQA
SYFB_TROW8        KH------HHIGYTGQILPTLAN--KHNLPDNVFACEINLDLVAQLGCSQEI-----VKT
SYFB_CHLPN        HK------QSFATLGQVHPELAK--KAQIKHPVFFAELNLDLLCKMLKKTTK----LYKP
SYFB_UREPA        NK------QVFGFIGQLKNQVKK--TYGLSNDIFIINLNLTSYLNQKQVITK-----VIK
SYFB_ONYPE        NN------QIIGVIGKTHPQLNT--KYHLKESFLCELFLTDEILNTTKTFT------FQP
SYFB_MYCPE        KN------KLIGIASQISPEILNKYKLDSSKPIYFVELIINDLLDSKISKSI----TVSD
B5Y860_COPPD      EG------REVGQVGMLKPSLLK--AYDLKGPVFAAELDLDVLPLVTGREP-------VF
SYFB_PORPU        NN------DNIGLFGELNELTSS--QFGFNTELFVLEIDLDILQYSDPEINY-LSYRIQP
SYFB_PHATC        SSG-----KNIGVFGQLHPLLAN--KLGLSSEIYLFELNLELIQQSLQQNK---LTIYSQ
SYFB_GRATL        NWTAIICNRFHEEIGIFGKLCNK----SDFNSTYVFEFDLVKLIASIESLNH-INSIINP
C7LJX7_SULMS      KN-------IICNIGYIKNAILE--EFEIFHNILYADINWDIILLLLKKEEKSFFKKKYH
SYFB_MESFL        KN------KKIGFIYKLNPAFEQ---ANKIYPTFICEVNLNLLLEIADKVHV-----TSE
                                                                              

SYFB_HELHP        FSKYQKSTRDLTILIDKDIPFYRVRQILLEDQIA-----YVKNIYPIDVYYDKA------
SYFB_HELPJ        FSIYPSSVRDLTLIIDENTAFSKIKKALKDAQIP-----NLSEILPLDIFKES-------
SYFB_DEHMC        INRFPAVERDLALVIDRHITNRQVIDILSEY-------DLVKNAELFDMYQGKQ-----I
SYFB_DEHM1        INRFPSVERDLALVLDRSITNRQVTDIISEF-------DLVKNVELFDMYQGKQ-----V
SYFB_PARUW        LAIYPGSERDWTFTIKTSVPFAEIIKAIHEQKS-----DLLENVLLLDIYRSEK-----L
SYFB_DESVH        LPVYPPVRRDITVAAPGSLQVGAVLDHILGLRLP-----LLCGVELIDVFEPE-------
SYFB_DESAG        LPVFPPVKRDITVMAPASVPVSAVTDHVRGMSLK-----LFSDIVLVDVFEPET---PEG
SYFB_SYNPX        FPTVPASERDLAVVVDRSQAASDLMQSIRKAGKP-----LLEAVTLIDRFEGD-----QL
SYFB_GLOVI        FSPFPPAARDLSFYAREALTVFEFERLIREQGEP-----LLESVALLDEFKGQ-----GV
SYFB_THETH        PSRHPAAFRDLAVVVPAPTPYGEVEALVREAAGP-----YLESLALFDLYQGPP-----L
SYFB_DEIRA        PSRAPAAWRDLAVIAPQGVSYGDIVGVLKGAGGE-----LLESVEPFDVFTGEQ-----V
SYFB_MYCTU        VSPYPAVFQDVSLVVAADIPAQAVADAVRAGAGD-----LLEDIALFDVFTGPQ-----I
SYFB_CORGL        LSSFPALHQDIALVVDETIPAEDVRAVVEAGAGE-----LIETVELFDVYRSEQ-----L
SYFB_CUTAK        ISSFPVAKEDVALVVDKSVAAEDVRQALIEGAGP-----LLESIELFDVYEGEQ-----V
SYFB_BIFLO        ISTFPPVKQDLAFTVDETVTAGQLENVIRKAAGA-----NLESIELFDVFTGEQ-----V
SYFB_ECOLI        ISRFPANRRDIAVVVAENVPAADILSECKKVGVN-----QVVGVNLFDVYRGKG-----V
SYFB_PECAS        ISRFPANRRDIAVVVAENVPAGDILAECKKVGAN-----QLVGVNLFDVYRGKG-----V
SYFB_MANSM        ISKFPANKRDLALVVAENIAASDILDACREVAGS-----KLTQVNLFDVYQGQG-----V
SYFB_ALIF1        VSKFPANRRDIAIVADEAIASGDIVAECLASGGE-----LLTSAKLFDVYRGQG-----V
SYFB_PHOPR        VSKFPANRRDIAVVVDEAAASGDIVKACIAAGGE-----FLTDAKLFDVYVGKG-----V
SYFB_IDILO        VSRYPSIRRDLAVVVDKDLAAGELIAAMENVGVK-----QLVDLNLFDVYIGDG-----V
SYFB_PSEPK        LSKFPETRRDLALIAGRDVASSAVLELIRDNAGE-----WLTDLRLFDVYQGKG-----I
SYFB_PSEPF        LSRFPEVRRDLALIAHKDVAASAVLDVIRENAGE-----WLTDLRLFDVYQGKG-----I
SYFB_LEGPL        ISKYPQIRRDLSFLVDRQISAMQIERVIRNTVKED----WLKSFDVFDVYMGKG-----I
SYFB_LEGPA        ISKYPQIRRDLSFLVDRQISAMQIERVIRNTVKED----WLKSFDVFDVYMGKG-----I
SYFB_XYLFT        LSRFPFVRRDLACVVPEHVTWSELAITVRDVIG-----PLLRDVKLFDRYVGKG-----I
SYFB_XYLFA        LSRFPFVRRDLACVVPEHVTWSELAITVRDVIG-----SLLRDVKLFDRYVGKG-----I
SYFB_XANC8        LSRYPSMRRDLAFLVPDAVSWAALSASVRTSVG-----PLLREVQLFDRYVGQG-----V
SYFB_XANOR        LSRFPSVRRDLAFLVPDEVSWAAVSASVRTTVG-----PLLREVQLFDRYVGQG-----V
SYFB_BURPS        VSKFPPVRRDIAVVVDQKVEVQALFDEMKKALADDAC-KFVQRVALFDEFRAKSNTSGGL
SYFB_CUPNJ        ISKFPAAVRDLAVVVKQSVRVQDMLDSMRAALDKQGCGRFCQSLVLFDEFRPKA-ASAAI
SYFB_BORBR        LSRQPAVVRDLALWVDAKLPAQAMLDTVAAAIARDPQLSVVQDAQVFDVWREKP--VAGQ
SYFB_THIDA        LSRFPQVRRDLAFVLDAGLAAGDLLAALREAAP-----ASIRAIEVFDDYRGKG-----V
SYFB_NEIMB        VSKFQPVRRDLAFVMPEAMSHDDLLLVLKGAAN-----KLVQEISVFDVYRGTG-----L
SYFB_LACJO        APKFPAIERDLSLLVPNDVTNAQIEAQIKLNGGK-----YLYDIRVIDVYAGSQ-----I
SYFB_LACSS        APKFPEVTRDIALQVPEAITNADLVNAIKEKGGR-----YLVSVSLFDVYAGSH-----I
SYFB_STRP3        ITKFPAMTRDIALLLDREVSHQAIVTAIESAGVK-----RLTKIKLFDVYEGAT-----I
SYFB_STRP8        ITKFPAMTRDIALLLDREVSHQAIVTAIESAGVK-----RLTSIKLFDVYEGAT-----I
SYFB_STRPN        ITKFPAVSRDVALLLKAEVTHQEVVDAIQAAGVK-----RLTDIKLFDVFSGEK-----L
SYFB_STAAC        IPRFPGMSRDIALEVDQNIPAADLLSTIHAHGGN-----ILKDTLVFDVYQGEH-----L
SYFB_LISIN        IPRYPEMTRDLALLVDKDTDHATISQVIKEHGGN-----LLVDIELFDIFEGES-----L
SYFB_OCEIH        IPRYPSVSRDIAFILDTEVFSGEVQQYIQEIGAP-----LVKEVSIFDVYQGEH-----L
SYFB_SYNAS        FSRYPESSRDVAFVIDQDVEADGMLNIALNAREE-----LLENVCIFDVYAGAG-----V
SYFB_MOOTA        LPRFPAVERDLAVVVPATTPAAAVAGVIREAGGE-----LLRAIALFDVYEGAP-----V
SYFB_DESPS        LPVYPAVKRDIALVVPASISAGELLATVRSSRDK-----LMEYAEIFDVFEGGK-----I
SYFB_CARHZ        LSPYPEVKRDIALLVEREIPAATFIEVIKGLAIN-----TLKNIEIFDVYEGEK-----L
SYFB_FUSNN        ISKYPEVLRDLAITLDRDILVGDMIKEIKKKVA------LIEKIDIFDVYSGDK-----I
SYFB_BDEBA        VSKFPIVERDFAFVMPKALKVGDVLKDIRKAGAG-----LLLNVDVFDLYEGEK-----M
SYFB_THEMA        TPRFPAVRRDISFLLPKGFESVKIIELFKKSGGD-----LVEEVGVFDIYEGKG-----I
SYFB_AQUAE        VAKFPPVVRDIALVMDKELDVNKLLIDTKSQIGE-----LLEEVRVFDVYTGEK-----V
SYFB_LEPIC        PSQFPEAEIDLSILVGEKENTNVFTDLVKLERIP-----ELKEGWVYSQFMGGN-----V
SYFB_LEPBL        PSQFPEAEIDISILIGEKENTNLFTDLVRREKIP-----ELQEGWVYSQFAGGS-----V
SYFB_RICTY        VSDFQANFRDYSFIVNQDHRVGEIISYINNFNK-----NLVKSVMLFDIYSGDK-----L
SYFB_RICPR        VSDYQANFRDYSFIVDQDHKVGEIISYIKNFNK-----KLVKSVMLFDIYSGDK-----L
SYFB_BRUSU        LSLFQSLKRDYAFVVDAAVEAGNVVKAVSSADK-----KLIVGVQVFDIFTGAS-----L
SYFB_BRUME        LSLFQSLKRDYAFVVDAAVEAGNVVKAVSSADK-----KLIVGVQVFDIFTGAS-----L
SYFB_PELUB        YSDFQKSERDFAFVLDKNFKVQELIETISNVDK-----ELIKSVKVFDVYEGAN-----I
SYFB_WOLTR        DYKHQSVKRDFAFIVNRDVEVGKIINMVKKSS------ELITEVFVFDVYHGNN-----M
SYFB_EHRCJ        ESCYQSVKRDFAFLIDKDTSVQHLIDVTKNSNP-----VLIDNVTVFDLYEGNS-----I
SYFB_BLOPB        ISKFPKNFRDISIIVPNKVASESVIIECKKIANEDQ----LIDIKLSDVYTGQN-----I
SYFB_BLOFL        ISKFPKNYRDISLIIPTHISASSVIETCKKIGIIN-----LTEVKLIDVYTGRN-----I
SYFB_WIGBR        ISDIPFNYRDISIVISNKIPIIEVIKICKDSIKKE-----LININIFDIYQGKE-----I
SYFB_BUCAP        ISKYPTSRRDIAILVSKDIPFLDIITVCKDFFVNK-----KVEINLFDVYSCKE-----F
SYFB_BUCBP        VSLYPRCSRDISIIVNDSIAADEILKVSKNVFLDK-----IVEVKLFDVFYGKN-----V
Q057Y9_BUCCC      ISTLPISKRDISIIISDKIIVKDIIDLCNKNIYIK-----NSEIYVYDIYTGSN-----V
SYFB_MYCGA        YDHYQEVTRDITFQL-KNEVDFNSFINVINSFNK------LSKWEIISIFDATNQIDTNK
SYFB_MYCPN        ISKLQDVFKDITFSFPRDESHFETFVKAIKKLQT------IFKWELISVFDTEKD-----
SYFB_MYCMO        YNFDPLKFRDITFSIEKNQS-IDTYLKELKKIKN------IFEVQIIDKFEKNEK-----
SYFB_MYCPU        LNYLPLKTLDINFEVPSENG-LFEVYKTLEKNEK------IYSYKLIDHYQKNQI-----
C4XE68_MYCFP      YDSTPFKSIDLTFELKPHQS-IDDKIIEIKKVAF------IFEIYQIDEFAKPES-----
D3VQ30_MYCAA      YDPSPLKSIDLTFTINSNEA-IASKISEINEISK------SFSIMQIDSFTNADK-----
SYFB_MYCS5        PNLDVLKSIDLTFELNNNEH-LQKYLDKINSVAK------VFEIKEIDDFKKETS-----
SYFB_MYCHJ        YDNSQLKYRDITLSLPMKDI-PDPYLKVIQKIPE------IFSVKLINYVIINNQ-----
SYFB_MYCH2        YDNSQLKYRDITLSLPMKDI-PDPYLKVIQKIPE------IFSVKLINYVIINNQ-----
SYFB_MYCH7        YDNSQLKYRDITLSLPMKDI-PDPYLKVIQKIPE------IFSVKLINYVIINNQ-----
SYFB_PORGI        LPRFPEVKRDLALLLDKAVSFAEIESLARGCEKK-----LLRRVELFDVYEGKN-----L
SYFB_CHLTE        PSKFPVVERDLSFVLPRHIPAQRLIDLAKASDPR------VRSVRIFDVFDRGTTQ---G
SYFB_SULDN        SSKYQASFRDLSIVMPQEMAYEKIKNVIDASSTK-----ELVRFYVVDKYSDKS------
SYFB_RHOBA        VSSFPSIQRDLNLVLPESVRWNELAGLVRKAAKE-----RLADLTYRETYRNEKVD----
SYFB_TROW8        LPTSPAATQHLTLTLGNNIAAASVISVVKEGAGE-----LLEDIRLIDEYKHEE------
SYFB_CHLPN        YAIYPSSFRDLTLTVPEDIPANLLRQKLLHEGSK-----WLESVTIISIYQDKS-----L
SYFB_UREPA        PSMYHDVIRDISVKLASDVDLNNIIANIKKIKNI-------RKVEISDLYIKDD------
SYFB_ONYPE        IPKFPTVIRDLAFLVDTKYSFYQIEQTIKQTTPF-----DLIKCELFDVYQIPK------
SYFB_MYCPE        EKKEHNIARSITLSLDRNQNYKKIESVLDNYKNNL---NLLDKFEIESVFIKDN------
B5Y860_COPPD      PLKFPQSWRDLSVVMPVEVPVSELAKLFEGEP-------LVKDWKVVDLYRGEK-----L
SYFB_PORPU        YSKYPCITRDLCIVIPKKMQINSLFQLLNQFNDN-----DLENMTLFDQYSNKL-----L
SYFB_PHATC        YSVYPKIVKDLSFIIKKNIKFDELEKIIYANGTE-----FLSQINLLDDYKGEF-----I
SYFB_GRATL        YSSYPSLTRDISLTVKNSCTISFIKARILSYENN-----LIESIEVFNYYKDKS------
C7LJX7_SULMS      KYNFTIYRRDISLLIEKKISFEEIKKLSFYKENK-----ILKKIHLLDEYNSKN-----F
SYFB_MESFL        ISKFQKSTRDISFELSNDVNFDTIVKAMLKDLNY------LTNYKVIDKYSDEQMD----
                                                                 .            

SYFB_HELHP        LGEKMALSIRIVLQSDEGTLQEMQLVQAVESVLSVLVREFDAVLRT-----
SYFB_HELPJ        -GNTIALSVRCVIHSLEKTLNDEEVNSAVQKALEILEKEFNARLKG-----
SYFB_DEHMC        AENKKSLAYHLLFQSDTHTLKDEEVDGVMSQILGRLNTETGAVLRS-----
SYFB_DEHM1        AEDKKSLAYHLLFQSDTHTLKDADVDSVMNQILKRLNTETGAVLRS-----
SYFB_PARUW        TVGHQNMTLRFIYRDFSKTIAQEVVENEHQRLKTAVSQKFANDLKQ-----
SYFB_DESVH        GKDERNLTFRMTFRHASRTLKDAEVDKERDKVAHSLVEKLPVRI-------
SYFB_DESAG        GTPERNLTFRLTFRHAERTLKDKEVDKERDKVAESLTEALGVRI-------
SYFB_SYNPX        GENKASQAFRLRYRHQSETLTDDQVQPVHDKVRNALVKQHGAELRS-----
SYFB_GLOVI        PEGCRSLAFRMVYR-SDHTLTEEEITAVHQRVRQALAERYSVDLRS-----
SYFB_THETH        PEGHKSLAFHLRFRHPKRTLRDEEVEEAVSRVAEALRARGFGLRGLDTP--
SYFB_DEIRA        GAGNRSVAVRLTYRGAK-TLTDEEVDPVFNAQIDAVKARGWAIREK-----
SYFB_MYCTU        GEHRKSLTFALRFRAPDRTLTEDDASAARDAAVQSAAERVGAVLRG-----
SYFB_CORGL        GENKKSLAFSLRFRATDRTLTDEEANEARLQAAELAKEKFNAEMRG-----
SYFB_CUTAK        GDNRKSLAFNLRLRGADRTLTDSEALETRDAAVARAEETCGAQLRS-----
SYFB_BIFLO        GEGKKSLAYAVVFRSPSKTLSAEDSDAIRKAIVAEAAEIGAQLRA------
SYFB_ECOLI        AEGYKSLAISLILQDTSRTLEEEEIAATVAKCVEALKERFQASLRD-----
SYFB_PECAS        AEGYKSLAISLTLQDTTRTLAEEEIAATVAECVAALKQRFQASLRD-----
SYFB_MANSM        PEGHKSLAISLTIQDTEKTLEEDDINAVISVVLSELKDRFNAYLRD-----
SYFB_ALIF1        EEGKKSLAIALTLQSVERTLEEADITSAVDAIVAAIGEKFSATLRD-----
SYFB_PHOPR        EEGKKSLAIALSLQSVERTLEDADISGAVDSIVAVLAERFGASLRD-----
SYFB_IDILO        AEGKQSLALSVTLQDSDKTLEEAEVTELMTKFIETLKSEFNATLRD-----
SYFB_PSEPK        DPDRKSLAVGLTWQHPSRTLNDDEVNTTLQNILTSLEQRLNTTLRK-----
SYFB_PSEPF        DTDRKSLAVGLTWQHPSRTLNDDEVNSTTQNILTSLEQRLNATLRK-----
SYFB_LEGPL        PEDKKSIAVAMTLQDDTRTLVDAEINLTISAIIKKLENEFSILLRE-----
SYFB_LEGPA        PEDKKSIAVAMTLQDDTRTLVDAEINLTISAIIKKLENEFSILLRE-----
SYFB_XYLFT        EPGFKSLAIGLILQDDTRTLIDRDVDDIMTKVVMAIQQRHDVRIRS-----
SYFB_XYLFA        EPGFKSLAIGLILQDDTRTLIDRDVDDIMAKVVMAIQQRHDVRIRS-----
SYFB_XANC8        EPGFKSLAMGLILQDNSRTLTDRDVDAVVADVVAVIEREHRARIRG-----
SYFB_XANOR        APGFKSLAMGLILQDNSRTLTDRDVDAVVTDVVAVIEREHRARIRS-----
SYFB_BURPS        SAHEKSLAFRVTLQDAAGTLQDETVDQAIQTLVDRMARVYGARLRG-----
SYFB_CUPNJ        GADEKSLAFRVTLQDTGSTLQDETVDSAVRCMVDALGEAFQARLRG-----
SYFB_BORBR        TVTEKSLAFRFWLQDTEVTLDEARVADCIARIKDALVAAHNARQRA-----
SYFB_THIDA        DQNQKSLAIRVVMQDTERTLTDRDVDEAVQKLVDAAARRCSATLRA-----
SYFB_NEIMB        PEGMKSVAVKVILQDMENTLTDEAVEPLIGKLIGAATAA-GARLRS-----
SYFB_LACJO        ESGHKSISYSLTFLNEKDTLTDEVVATAMEKIEADLKESLKIKVR------
SYFB_LACSS        EAGEKSMAYTLTYLNEDATLTEEEVNAAFEKVVAHLVATFQAKVR------
SYFB_STRP3        QAGKKSMAYSLTFQNPNDNLTDEEVAKYMEKITKALTEQVGAEVR------
SYFB_STRP8        QAGKKSMAYSLTFQNPNDNLTDEEVAKYMEKITKSLTEQVGAEVR------
SYFB_STRPN        GLGMKSMAYSLTFQNPEDSLTDEEVARYMEKIQASLEEKVNAEVR------
SYFB_STAAC        EKGKKSIAIRLNYLDTEETLTDERVSKVQAEIEAALIEQ-GAVIR------
SYFB_LISIN        GENKKSLAYTLTFLDSERTLVEEDVQKATNKVVEALQAKLHAIIR------
SYFB_OCEIH        EDGKKSVAYRLMYQDPAKTLQDDEVESSYQQIVEAVNKKFGSYVRS-----
SYFB_SYNAS        PEGKKSLGLRFTYRSYSATLTDDEVSRVHSKIVQRIIDQTGARVR------
SYFB_MOOTA        PEGCKSLAYSLVYQLPDRTLTDAEVNAAQERIQRALEERLGASLRQ-----
SYFB_DESPS        QKGYKSVAVSITYRSQTKTLTEKNVEKSHSKIVSLLTDRFGGSFRDA----
SYFB_CARHZ        GPNKKSIAISLTFSSTEKTLSEEEINNFMAQVLKALEAKTGAKLRTF----
SYFB_FUSNN        DKDKKSVAMSIILRDKNRTLTDGDIDTAMNTILELIKDKYNGEIRK-----
SYFB_BDEBA        EAGKKSVAIRIWLQDKNATLQETQINETTTKILESLKKNFDLSVR------
SYFB_THEMA        PENMVSVTLYVVFRHPERTLTDEEVNKIFEEMVQKAEREFGIRRRF-----
SYFB_AQUAE        GEGKKSVAVRLVLRSKTGSLKDEEANELVNKLVNYLKEKYGVELRT-----
SYFB_LEPIC        PEGKKSVSYRFRLVNYERTFTQERIKEISDQLVILAGKNGFVLR-------
SYFB_LEPBL        PVGKRSVSYRFRLVNYEKTFTQERIKEISDHLVALAGKNGFVLR-------
SYFB_RICTY        PEGKKSISIKIELQADDRTLSETDLNAFSQDLVESISQKFQGTLRE-----
SYFB_RICPR        PEGKKSIAIKIKLQADDRTLSETDLNSFSEDLVASISQKFQGILRE-----
SYFB_BRUSU        GEGKKSIAVEVLLQPQDRTLTDEDLEALSKQIVASVAKQTGGVLRG-----
SYFB_BRUME        GEGKKSIAVEVLLQPQDRTLTDEDLEVLSKQIVASVAKQTGGVLRG-----
SYFB_PELUB        PEGKKSIALNVIIQPLEKTLTEDDLNKINQLIISAVESKTGAKIRS-----
SYFB_WOLTR        EPNKMSIALSVTFCSPTHTLIEEEIQKESSAIVNLVHKNTGGILRYT----
SYFB_EHRCJ        GDNKLSVALSVTFNPVDHTLNDQEIKDASDLIINAVAEKLGGVLRSF----
SYFB_BLOPB        AKGFKSFTIRLFFQSKTHTLKEEEISDIVNKCSIILKKRFHGTLR------
SYFB_BLOFL        PTNFKSLTIKLTLQSKTHTLKEQEIKEIIIICTTTLKKHFNAIFR------
SYFB_WIGBR        KKGHKSISIRLTLQNKNYNMTNLEINSILEKCICNLKKNFLIEIRTIC---
SYFB_BUCAP        DNRKKSLGISFVFQNFKKNLKENEVNLMLHDCIKILKKKFQVVLRK-----
SYFB_BUCBP        GLNKKSLSLRFIFGSSKRTLSEEIISNCLNECIRILQEKFNAILRDRNFLF
Q057Y9_BUCCC      PSGKKSISICFLFNSLQSMLKESDININILQCISALKDKFGAILRE-----
SYFB_MYCGA        TYQPTKYTVRCYLKQ-GDKTYTTKEINQIFDELIDLMKTKQILI-------
SYFB_MYCPN        GVPITKYTVRYYLKNFTNTPLTLEQIKAVETQLKQQCELAKIALDL-----
SYFB_MYCMO        ----LNITVRILLED--------DAIKNLDEAILKNSWN------------
SYFB_MYCPU        ----SIYTIRIWAFE--------ENIEELKTLFNL----------------
C4XE68_MYCFP      ----RNVTLRIIGSN--------EEIQKINNEFNN----------------
D3VQ30_MYCAA      ----RNVTLRVTGSF--------EEINKINEIFNKK---------------
SYFB_MYCS5        ----HNVSLRITAPS--------AEIDKLNSHFNKD---------------
SYFB_MYCHJ        ----QKITYRITGPD--------QVCAEIDKFYK-----------------
SYFB_MYCH2        ----QKITYRITGPD--------QVCAEIDKFYK-----------------
SYFB_MYCH7        ----QKITYRITGPD--------QVCAEIDKFYK-----------------
SYFB_PORGI        PAGKKSYAVSFFLRNDEKTLNDKQIEAIMAKIRTTLEQKLGAQLR------
SYFB_CHLTE        EPSTRSVALSLELADRSGTMNEEAISAVISKVIDNARSELGAVIRQV----
SYFB_SULDN        LGENMSLSIRFVLQSFDKTLEEEEITNAMNTILEALKNQLGVGIR------
SYFB_RHOBA        GPNKKRVLFSMELQSQTETLSGGDADSIINELVASCEKQLEAVLLR-----
SYFB_TROW8        -SDKKSLTFAMRFRDKEKTLTAQRVNLAKENAVRLASSKFGAIMRR-----
SYFB_CHLPN        ETRNKNVSLRLVFQDYERTLSNQDIEEEYCRLVALLNELLTDTKGTINS--
SYFB_UREPA        ---GIIYTFKYYINDHLSNLSSEQIIIIEQEVNNYLKQF------------
SYFB_ONYPE        TKEKHSLALRLFFHNLDKNLEKQDVEHCMEKITSNLIKHFHIEIR------
SYFB_MYCPE        ---KPSYTFSLEINPSKLNKKETNEINEIVERLIKDLINEGAEIKR-----
B5Y860_COPPD      SPSEKSVTVRVWLGAEDHTVSSEEVDQVVERVLGRLTEAGWHLRT------
SYFB_PORPU        GNGKKSIGLRFTYRSDHKTLTNLEIDNKQNELQKNIIKKLNLEIRK-----
SYFB_PHATC        PEKHTSLCLQLTFQSNKKTLENKEIDRIVKNLKRVLELKVQAILRE-----
SYFB_GRATL        INAFYNVGLRIVYRAHNRTLNYSDINRIDQEIDDLLNEYKL----------
C7LJX7_SULMS      PFGKKSYTISFFFQNLKNNLTETIIEKTINKLKFIFIKKIKAIIR------
SYFB_MESFL        KENISSLTVKLSFNSLDHQLTEKEINDDFEKILNNLKELKVKVR-------