CLUSTAL format seed alignment for MF_00286

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DSBB_BURCA       -----------MNDYTLALRRERRLLMLLGWVCIALLAGALY-LQYVKNEDPCPLCIIQR
DSBB_BURCH       -----------MNDYTLALRRERRLLMLLGWVCIALLAGALY-LQYVKNEDPCPLCIIQR
DSBB_BURCE       -----------MNDYTLALRRERRLLMLLGWVCIALLAGALY-LQYVKNEDPCPLCIIQR
DSBB1_BURL3      -----------MNDYTLAIRRERRLLMLLGWVCIALLAGALY-LQYVKNEDPCPLCIIQR
DSBB_BURCM       -----------MNDSTLALRRERRLLMLLGWVCIALLAGALY-LQYVKNEDPCPLCIIQR
DSBB_BURMA       -----------MNNLTLSLRRERRLLVLLALVCLALLAGALY-LQYVKNEDPCPLCIIQR
DSBB_BURPS       -----------MNNLTLSLRRERRLLVLLALVCLALLAGALY-LQYVKNEDPCPLCIIQR
DSBB_BURP0       -----------MNNLTLSLRRERRLLVLLALVCLALLAGALY-LQYVKNEDPCPLCIIQR
DSBB_BURTA       -----------MNNLTLSLHRERRLLVLLGLVCLALLAGALY-LQYVKNEDPCPLCIIQR
DSBB_PARXL       -----------MNNDTAMLRRERSLLVLLALICLALVGGALY-LQYFLHEDPCPLCIIQR
DSBB1_PSEPK      -----------MNEQTSRLNRERRFLVLLGLICLSLIGGALY-MQVVLGEAPCPLCILQR
DSBB1_PSEE4      -----------MNELTSRLNRERRFLVLLGVICLALIGGALY-MQVVLGEAPCPLCILQR
DSBB1_PSE14      -----------MSDNTLYLRREKRFLVLLGIICLALIGGALY-MQIVLGEAPCPLCILQR
DSBB1_PSEU2      -----------MSDNTLYLRREKRFLVLLGIICLALIGGALY-MQVVLDEAPCPLCILQR
DSBB_PSESM       -----------MSNDTFYLKREKRFLVLLGIICLSLIGGALY-MQIALGEAPCPLCILQR
DSBB1_PSEF5      -----------MSDDRLGLGRERRFLVLLGIICLALIGGALY-MQVVLGEAPCPLCILQR
DSBB1_PSEPF      -----------MSEETIRLGRERRYLVLLGIICLALIGGALY-MQIVLGEAPCPLCILQR
DSBB2_BURL3      -----------MSAPIGATRAERWTLLAIGVASFELVAGALW-IQLAWQEDPCPLCIIQR
DSBB_HERAR       ------------------MKNSRPVLFAVALASLLLLAVALY-LQHVENMLPCPLCVIQR
DSBB_CUPNH       -----------------MQANSRAYFLLIALVSFGLVGVALY-LQFEKGYQPCPLCVMQR
DSBB_CUPPJ       -----------------MQANSRAYFLLIAFISFGLVGFALY-LQFEKGYQPCPLCIMQR
DSBB_CUPMC       -----------------MQANSRTYFLLIAIVSFAMVGAALY-MQYAENLQPCPLCIMQR
DSBB_RALSO       -----------------MQANSRAFFLLIAVIAFGLVGYALY-LQHVEGLQPCPLCVLQR
DSBB_NITEU       ---------------------MRIIFLLIALICAGLVSYALY-LQLADGLLPCPLCIFQR
DSBB_NITEC       ---------------------MRIIFLLIFLACAGLIGYALY-LQLMDGLLPCPLCIFQR
DSBB_NITMU       --------------MSNPMRPVRSILLAIFTGCAGLIGYALY-LQLVENLLPCPLCVVQR
DSBB_HAHCH       ---------------MPAWLTNRTIYFLCFLAIAGLMGFAFY-LQYVKDLEPCPLCMAQR
DSBB_MARHV       -------------------MTSRWIFGLVFLVCAGLLAVAFY-MEHVMGLEPCPLCWLQR
DSBB_CHRVO       ---------------MGLNITNRQGFLLVAAACAGAIGFALF-AQYQLGEEPCPLCILQR
DSBB_METCA       ----------------MTLPSARTCFLLGFLFCAALLAAALY-FQFSGGLEPCPLCISQR
DSBB_NITOC       ----------------MRL-SVRWVFFLGFFLCALMLAIAGY-FQFVENLEPCPLCILSR
DSBB_SACD2       -------------MKITKLPSYRQTALIIFAGCVGLILAALY-MQEVLGLHPCPLCITQR
DSBB_ACIBT       -----------------MRLSYRLVSGLLVLASIVGMSFALY-LEHVKGLEPCPLCIFQR
DSBB_ACIAD       -----------------MQWSYRFVSGLLVLASIVGMTFALY-LEHFKGLEPCPLCIFQR
DSBB_PSYA2       ---------------MLQLTTYRNLQVFLVIMTAIGMSFALFFLQRYMGFSPCPLCIFQR
DSBB_PSYCK       ---------------MLQLTTYRNLQVFLVIMTAIGMSFALFFLQRYMGFSPCPLCIFQR
DSBB_ALCBS       --------------MSSIIPAPRPLNALAFLACLAAIVGALY-LQHVDGLEPCPLCIFQR
DSBB_CHRSD       ------------MIIRLAGMSVRQGCLLGLLMCALMMGVALV-LQYVYGLTPCPLCIGQR
DSBB_XANAC       --------------MNPFRWSFRAQFLLGFLACAGLLAYAIY-VQLHLGLEPCPLCIFQR
DSBB_XANC5       --------------MNPFRWSFRAQFLLGFLACAGLLAYAIY-VQLHLGLEPCPLCIFQR
DSBB_XANOR       --------------MNPFRWSFRAQFLLGFLACAGLLAYAIY-VQLHLGLEPCPLCIFQR
DSBB_XANOM       --------------MNPFRWSFRAQFLLGFLACAGLLAYAIY-VQLHLGLEPCPLCIFQR
DSBB_XANCP       --------------MNPFRWGFRAQFLLGFLACAGLLAYAIY-VQLHLGLEPCPLCIFQR
DSBB_XANC8       --------------MNPFRWGFRAQFLLGFLACAGLLAYAIY-VQLHLGLEPCPLCIFQR
DSBB_XYLFA       --------------MNALQWSFRAQCLTGFLFCTGLLAYAIF-LQLHQGLEPCPLCIFQR
DSBB_XYLFT       --------------MNALQWSFRAQCLTGFLFCTGLLAYAIF-LQLHQGLEPCPLCIFQR
DSBB_METFK       --------------MCNKLFAGRRGYFLGFVASFGLVGLALF-LQQKYNLEPCPLCISQR
DSBB1_PSEAE      ----------------MPLASPRQLFLLAFLACVAIMGGALY-LEHVVGLEACPLCVVQR
DSBB2_PSEAB      ----------------MPLASPRQLFLLAFLACVAIMGGALY-LEHVVGLEACPLCVVQR
DSBB_PSEU5       ----------------MRLASPRSLFVIAFLGSALLIAIALY-MEHVMGLAPCPLCIVQR
DSBB2_PSEPF      ----------------MSLACSRSLFFMAFTAGILALGASYY-LEYAVGLVPCSLCLVQR
DSBB2_PSEPK      ----------------MLPARLRTFFLPACLVALAVLVASFR-LENTVGLMPCPLCLSQR
DSBB2_PSEE4      ----------------MSLACLRSFFLPALLASTAVLVASFH-LESVVGLVPCALCFSQR
DSBB_LEGPL       ----------------MKKLTYRKIQSFQAIITVLVIFASFY-LEYAAGLQPCPLCLMQR
DSBB_LEGPA       ----------------MKKLTYRKIQSFQAIITVLVIFASFY-LEYAVGLQPCPLCLMQR
DSBB_NEIMB       -----------------MTPLFRKAVWLLFAVSVCAFAGSLA-AQYVLGMEPCVLCISQR
DSBB_NEIMF       -----------------MTPLFRKAVWLLFAVSVCAFAGSLA-AQYVLGMEPCVLCISQR
DSBB_NEIMA       -----------------MTPLFRKAVWLLFAVSVCAFAGSLA-AQYVLGMEPCVLCISQR
DSBB_NEIG1       -----------------MTPLFRKAVWLLFAVSVCAFAGSLA-AQYVLGMEPCVLCISQR
DSBB_ACIAC       ------------MVSNWLDAAPRRVLALISAACIAMLAFGMY-LQHVVGLEPCPMCIVQR
DSBB_ACISJ       -------------MLNWIDTAPRRILALISAACVAMLAFGMY-LQHVVGLEPCPMCIVQR
DSBB_VEREI       -----------MMVWNWIDRTPRRVLALISLACVALLACGLY-LQHVVGLVPCPMCIVQR
DSBB_POLNA       ------------MFLNLLDA-PRRLLALVALGCVALLAFGLY-LQHVVGLEPCPMCIVQR
DSBB_POLSJ       ------------MFLTYFDAMPRRVLALVSLACVALLAFGLY-LQHVVGLEPCPMCIVQR
DSBB_RHOFT       --------MSFQVVTGWLDNSPRRIFAFVSLASIGMLAFGQY-LQHVVGLEPCPMCIVQR
DSBB_AZOSB       --------------MIALPRNRRPLFLAVFAYCAALLAFGLY-LQHYQGIEPCPMCIMQR
DSBB_AROAE       --------------MQSFAFSTRALFLGLFAVCAGLLGFGLY-LQHAVGLEPCPMCIMQR
DSBB_ECOLI       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_ECO57       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_SHIDS       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_SHIFL       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_SHIF8       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_SHIBS       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_SHISS       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_ECOUT       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_ECOK1       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_ECOL6       -----------MLRFLNQCSQGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_ECOL5       -----------MLRFLNQCSHGRGAWLLMAFTALALELTALW-FQHVMLLKPCVLCIYER
DSBB_SALTY       -----------MLRFLNQCSRGRGAWLLMAFTALALEMVALW-FQHVMLLKPCVLCIYER
DSBB_SALTI       -----------MLRFLNQCSRGRGAWLLMAFTALALEMVALW-FQHVMLLKPCVLCIYER
DSBB_SALCH       -----------MLRFLNQCSRGRGAWLLMAFTALALEMVALW-FQHVMLLKPCVLCIYER
DSBB_SALPA       -----------MLRFLNQCSRGRGAWLLMAFTALALEMVALW-FQHVMLLKPCVLCIYER
DSBB_YERPE       -----------MLQFLNRCSRGRGAWLLMALTAFLLELTALY-FQHIMLLQPCVMCIYER
DSBB_YERPA       -----------MLQFLNRCSRGRGAWLLMALTAFLLELTALY-FQHIMLLQPCVMCIYER
DSBB_YERPN       -----------MLQFLNRCSRGRGAWLLMALTAFLLELTALY-FQHIMLLQPCVMCIYER
DSBB_YERPP       -----------MLQFLNRCSRGRGAWLLMALTAFLLELTALY-FQHIMLLQPCVMCIYER
DSBB_YERPS       -----------MLQFLNRCSRGRGAWLLMALTAFLLELTALY-FQHIMLLQPCVMCIYER
DSBB_YERE8       -----------MLQFLNRCSKGRGAWLLMALTALVLELVALY-FQHVMLLQPCVMCIYER
DSBB_PHOLL       -----------MMRFLNHCSQGRSAWLLMILTALILESSALY-FQHVMKLQPCVMCIYER
DSBB_PECAS       -----------MLRFLNRCSRGRGAWLLLAFTALALELTALY-FQHVMLLKPCVLCIYQR
DSBB_SODGM       -----------MMRSLNRCSKHRAAWLLLALTTFSLELVALY-FQHVMLLKPCVLCVYQR
DSBB_BLOPB       -----------MLNFLNICSKTRKSWVLLIFTVVILELIALY-LQHIVLIKPCVLCVYQR
DSBB_BLOFL       -----------MLHIFYIYSKSRKFWAILICSSISLISIALL-NQFFFLLKPCILCIYQR
DSBB_HAEDU       -----------MLSYFKELSLRRPAWLLLATLACTLEVTGLY-FQHKLGLIPCVMCIYER
DSBB_ACTP2       -----------MLSYFKELSLNRTAWLLLAFVAFALEASAIY-FQYGMGLVPCVMCVYER
DSBB_HAEIN       -----------MLALLKQFSEKRFVWFLLAFSSLALESTALY-FQYGMGLQPCVLCVYER
DSBB_HAEI8       -----------MLALLKQFSEKRFVWFLLAFSSLALESTALY-FQYGMGLQPCVLCVYER
DSBB_HAES1       -----------MLIFFKNLSMKRSTWILLFISALVLESTALY-FQHGMGLNPCVMCIYER
DSBB_MANSM       -----------MLSFFKTLSMGRSGWLLLAFSALVLELVALY-FQYGMQLQPCVMCVYER
DSBB_PASMU       -----------MLSFFKTLSTKRSAWFLLFSSALLLEAIALY-FQHGMGLAPCVMCIYER
DSBB_SHESM       ------------MTAFTRFAHSRASWLILTGSAIALEAAALY-FQYVMKLDPCVMCIYQR
DSBB_SHESR       ------------MTAFTRFAHSRASWLILTGSAIALEAAALY-FQYVMKLDPCVMCIYQR
DSBB_SHESA       ------------MTAFTRFAHSRASWFILTGSAIALEAAALY-FQYVMKLDPCVMCIYQR
DSBB_SHEON       ------------MTAFTRFAHSRVSWFFLTGSAIALEAAALY-FQYVMKLDPCVMCIYQR
DSBB_SHESW       ------------MTALTRFAHSRSSWFLLTGTAIGLEAAALY-FQYVMKLDPCVMCIYQR
DSBB_SHEAM       ------------MQSLISFAHSRLSWGILALSALALESAALY-FQHIMKLDPCVMCIYQR
DSBB_SHELP       ------------MSALTRFAQSRLAWTLLLLTAVGLEACALF-FQHVMKLDPCVMCIYQR
DSBB_SHEDO       ------------MSKLVTFSQQRSAWLILMFSALGLEASALY-FQYVMLLDPCVMCIYIR
DSBB_SHEFN       ------------MSQLQQFCHNRFSWGLLLLSAIGLELAALF-FQYGMDLAPCVMCIYIR
DSBB_VIBVU       ---------MNLFASLNQFSKNRISWLLLLLFVVFFEGAALF-FQHVMMLSPCVMCIYER
DSBB_VIBVY       ---------MNLFASLNQFSKNRISWLLLLLFVVFFEGAALF-FQHVMMLSPCVMCIYER
DSBB_VIBPA       ---------MTIFSSLNQFSKGHVSWLLLLLFIIFFEACALY-FQHVMMLAPCVMCIYER
DSBB_ALIF1       ------------MQALNHFSRIRLSWFLLLLCIIFFEASALT-FQHIMKLPPCVMCIYER
DSBB_PHOPR       ------------MQFLNTFSKSRISWLLLLLCIVFFEGSALF-FQHGMKLGPCVMCIYER
DSBB_VIBCH       ---------MRILSSLKTFSQSRLSWLLLLAFVVFFTLCAMY-FQHVMLLAPCVMCIYER
DSBB_AERHH       -----------MIEFLRRIAAHRLAWSLLAASALFLELSALF-FQHVLGLHPCVMCVYER
DSBB_AERS4       -----------MIEFLRRIAAHRLAWGLLAASALFLELSALF-FQYVLGLHPCVMCVYER
DSBB_PSYIN       MLLFFVILGIFVLTILKAISKQRWSWLLLAASALSLELSALY-FQHVMQLEPCVMCVYER
DSBB_COLP3       ------------MNYLSNITTSQRPWLLLALAALGLELSALY-FQYVLGLAPCIMCVYQR
DSBB_PSET1       ------------MNWLAQLPTQRTPWLLFSGIVFLLEITALF-FQYKMGLAPCIMCIYQR
DSBB_PSEA6       ------------MTFISNLADTRLAWGLLFLSALVLVAYALF-SQHAMGLQPCIMCIYQR
DSBB_IDILO       ------------MLSVGQWPNKPFAWLLLFLGCSGLLGAALY-FQMVLNLEPCVKCVYQR
DSBB2_PSEAE      ------------MSALLKPLDNRLFWPAVAIGGLLILAFVLY-LQHVRGFAPCSLCIFIR
DSBB1_PSEAB      ------------MSALLKPLDNRLFWPAVAIGGLLILAFVLY-LQHVRGFAPCSLCIFIR
DSBB_ALKEH       ---------------MGDWLLRRRGLALLLVLTLLLNLGALG-LEYLADMPPCPLCWVQR
DSBB_DECAR       --------------MICSKVPVRAWFATLGLGCLGLVAVGMA-LQTLLHLAPCPLCIFQR
                                                             :      .*  *   *

DSBB_BURCA       YFFCAIGIFAFLAAGIRN--WRGVWVLELLIAIAAAGGVGTAARHLSIQMNP-GFSCGFD
DSBB_BURCH       YFFCAIGIFAFLAAGIRN--WRGVWVLELLIAIAAAGGVGTAARHLSIQMNP-GFSCGFD
DSBB_BURCE       YFFCAIGIFAFVAAGIRN--WRGVWVLELLIAIAAAGGVGTAARHLSIQMNP-GFSCGFD
DSBB1_BURL3      YFFCAIGIFAFLAAGIRN--WRGVWVLELLIAIAAAGGVGTAARHLTIQMNP-GFSCGFD
DSBB_BURCM       YFFAAIGIFAFLAAGIRN--WRVIWVFELLIAIAAAGGVGTAARHLSIQMNP-GFSCGFD
DSBB_BURMA       YFFVLIAVFAFIGAGMAS--GAGVAVTEALIVLSAAAGVGTAARHLYVQLNP-GFSCGFD
DSBB_BURPS       YFFVLIAVFAFIGAGMAS--GAGVAVTEALIVLSAAAGVGTAARHLYVQLNP-GFSCGFD
DSBB_BURP0       YFFVLIAVFAFIGAGMAS--GAGVAVTEALIVLSAAAGVGTAARHLYVQLNP-GFSCGFD
DSBB_BURTA       YFFVLIAVFAFIGAGMAS--GAGIAVIEALIVLSAAAGVGTAARHLYVQLNP-GFSCGFD
DSBB_PARXL       YFFLLIAIFAFLGARFNS--WRGVRLLEVLAALSALGGIVTAARHVYVQANP-GFSCGFD
DSBB1_PSEPK      YALLFIAVFAFIAAAMPG--RRSLTFFEALVVLSAIGGIVAAGNHVYILANP-MVSCGID
DSBB1_PSEE4      YALLFIAIFAFIAAAMPG--RKSLTFFEVLVVLSAIGGIVAAGNHVYILANP-MVSCGID
DSBB1_PSE14      YALLFIAIFAFIGAAMSG--RRGVTVCETLVTLSALGGIAAAGRHVWILAHP-SDSCGID
DSBB1_PSEU2      YALLFIAIFAFIGAAMPG--RRSVTAFETLVTLSALGGIAAAGRHVWILAHP-SDSCGID
DSBB_PSESM       YALLFIAIFAFIGAAMNG--RRGVTVFEALVTLSALCGIAAAGRHAWILAHP-SDSCGID
DSBB1_PSEF5      YALLLIALFAFIGAAMSS--RRGVTVMETLVVICALAGAGVAGHHVYTQFYP-SVSCGID
DSBB1_PSEPF      YALLLIALFAFIGAAMRT--RRSITVFEVLVVICAIAGAGVAGHHVYTQFYP-AVSCGID
DSBB2_BURL3      YLFLLIALFTFVAAAGG----RRVALLRVLSLTTALAGAAVAVRHIYVQAHP-GFSCGFD
DSBB_HERAR       YAFAAIALICLV-TAFRT--EVTARIGAALAALASLAGAGVAGWHIYIKAHP-TVSCGID
DSBB_CUPNH       FAFIGIGIFSLLAAVAQN--TRSLW--QGLGMLSGIAGIAVAVYHVSLLLNP-KASCGID
DSBB_CUPPJ       FAFIGIGLFSLLAVIAQN--TRSLW--QGLGMLSGVGGIAVAVYHVSLLLNP-KASCGID
DSBB_CUPMC       FAFIGIGIFSLLAVIAQN--TRTLW--QGLGMLSGVGGIAVAGYQVALLMNP-KASCGID
DSBB_RALSO       FAFVGIGVFSLLAALSSA--TRLLW--HGLGMLSGLGGIFVAGYHVSLLLNP-KASCGID
DSBB_NITEU       MAYWLVGITALFAFIHHPQ-RLGRRIYCGLIILFSLAGAIVAGRQAWLVRFPEAFECGIS
DSBB_NITEC       IAYWLIGITALFTFIHNPQ-SLGQHIYYGLIILFSLAGAIVAGRQAWLIRFPEAFECGIS
DSBB_NITMU       MAYWLIGLTALAGFFHTPE-TTGRRIYAGLMAVFAFTGGLVALRQAWLVRYPEAFECGIS
DSBB_HAHCH       IAFVLAGLVFLAAALHNP-KNTGTTVYAFLGWVTTLGGAALATRQLWLQSLPADQVPACG
DSBB_MARHV       FGFMGAGLVSLLAFLHGP-RGFGNRVYGLLLIVAAGAGLAVAGRQLWLQSLPADQVPACG
DSBB_CHRVO       IGVMAVGALALLAALHNP-GKTGAKVWGGLMTLAALSGAGVSLRQLWLQSLPADQVPQCG
DSBB_METCA       IMVLAVALVFLAAAIHHP-ASLGIRAYALLGTAVALGGASISGRHVWLLHLPPEEVPECG
DSBB_NITOC       VAVLAIGGVFLVAALHNP-KSWGIKVYALLGFVVTLIGIGITGRHVWLQSLPADQVPACG
DSBB_SACD2       IFIIGVGLISLIAAIHNP-AALGRKVYGCLATLSGVIGAGVSARHVWLQNLPEDQVPACG
DSBB_ACIBT       VGLMAMGFVALIAFLHNPVSNAIKRFYAFLAGVAILWSVGVAGRHVWLQHLPPDQVPSCG
DSBB_ACIAD       VGLMAMGIVALIAFLHNPVSNAFKRVYAFLATLGILWSVGVAIRHVWLQTLPPDQVPSCG
DSBB_PSYA2       IGLMIMGGFALIAALFHPKSMVIRLLLWLGSLAGIGWAAIVAGRHVWLQHLPADQVPSCG
DSBB_PSYCK       IGLMIMGGFALIAALFHPKSMVIRLLLWLGSLAGIGWAAIVAGRHVWLQHLPADQVPSCG
DSBB_ALCBS       VGVIAGAVILLIASLHGPKNIGVRIYGALTTLAALGGGA-VAARHIWLQNLPADQVPACG
DSBB_CHRSD       IAVLLAAFVFAIGALHNPAGNLGRGLYAGLAALASVLGLAVAARHVWLQSLPPENVPSCG
DSBB_XANAC       IAFAALAVFFLLGALHGPRAAAGRKVYGVLSFIAAGVGMGIAARHVWVQIRPKDMMSSCG
DSBB_XANC5       IAFAALAMFFLLGALHGPRAAAGRKVYGVLSFIAAGVGMGIAARHVWVQIRPKDMMSSCG
DSBB_XANOR       IAFAALAVFFLIGALHGPRAAGARKVYGVLSFIAAGVGMGIGARHVWVQIRPKDMMSSCG
DSBB_XANOM       IAFAALAVFFLIGALHGPRAAGARKVYGVLSFIAAGVGMGIGARHVWVQIRPKDMMSSCG
DSBB_XANCP       IAFATLALLFLLGALHGPRGAGGRKAYGVLAFIAAGVGMGIAARHVWVQIRPKDMMSSCG
DSBB_XANC8       IAFATLALLFLLGALHGPRGAGGRKAYGVLAFIAAGVGMGIAARHVWVQIRPKDMMSSCG
DSBB_XYLFA       IAFAVLGILFLIAGLYNSSNVYTRKAYGLLIFLTAAIGTGIAGRHVWVQLMPHNTISSCG
DSBB_XYLFT       IAFAVLGILFLIAGLYNSSNVYTRKAYGLLIFLTAIIGTGIAGRHVWVQLMPHNTISSCG
DSBB_METFK       IAFMALGILFLLAALHNP-GRVGRKVYGLLHVIAAATGIGIAARHIWIQANPDKVMAECG
DSBB1_PSEAE      IFFILIGLTCLAGAIQGP-GLRGRRIYSVLVFLLALGGGATAARQVWLQTVPLDQLPACL
DSBB2_PSEAB      IFFILIGLTCLAGAIQGP-GLRGRRIYSVLVFLLALGGGATAARQVWLQTVPLDQLPACL
DSBB_PSEU5       ICVIGFGLVCLVAAIHGP-AKVGRRVYAAIAALFVAAGAATAIRQIWLQSVPADQLPSCL
DSBB2_PSEPF      LFMSVLTLCCGLAAVHGP-QRVGLSLYWMVTLLSSLGGTTAAWRQVLFQSDSLQELAHCA
DSBB2_PSEPK      LLLGGYALLCFAAVLQAP-GTRGILRYARLALGCSLAGALLAARHVWLQGA--EGVNEVC
DSBB2_PSEE4      LMLGVYALVCLAALVHSP-AARGRRAYAGLALASAFGGALLAGRHVWLQGD--PQVVDGC
DSBB_LEGPL       VCVFILLGLMGVSLGT----VKKAHIVSLIQFQVACAGLYFSLRQLWLQSLPSDQAPACM
DSBB_LEGPA       VCVFILLGLMGLSLGT----VKKAHIVSLMQFLVACAGLYFSLRQLWLQSLPSDQAPACM
DSBB_NEIMB       LCVLATALCTAIVLMCRPRRRAGGLFGAVFISIPAVTGISVAAYQLWLQSLPPGTAPSCG
DSBB_NEIMF       LCVLATALCTAIVLMCRPRRRAGGLFGAVFISIPAVTGISVAAYQLWLQSLPPGTAPSCG
DSBB_NEIMA       LCVLATALCAAIVLMCRPRRKAGGLFGAVFISIPAVTGISVAAYQLWLQSLPPGTAPSCG
DSBB_NEIG1       LCVLATALCAAVVLACKPKGRVGGLSGAVFISIPAVTGISVAAYQLWLQSLPPGAAPSCG
DSBB_ACIAC       YALIGVAVFTGLGSLRGG-RGW-WMTWGVLALLLSGFGAFVAARQSWLQWYP-PEIATCG
DSBB_ACISJ       YALIGVAVFAGLASARGQ-KGW-WMTWSVLALVAAGFGAFVAARQSWLQWYP-PEIATCG
DSBB_VEREI       YALIGLALLTGLASARSA-KGW-WLTLSALAALTAGFGATVAARQSWLQWYP-PQSVSCG
DSBB_POLNA       YALVLVAIVAGLTAITSN-KKG-LITGSGVLLLLAGFGAFVAARQSFLQWYP-PEVASCG
DSBB_POLSJ       YALVLVAVVAGITAVAKS-RGL-LITGSGLLVLLSGFGAFVAARQSFLQWYP-PEVASCG
DSBB_RHOFT       YALVLVAIIAGLTGASGR-KGL-HLGGAVLMLGSSGFGAYVAARQSWLQWYP-PEVVSCG
DSBB_AZOSB       YAFALVGVIALVAGLHGP-RGAGVRVYGGLLLLTALAGGSVAARQTWMQLYP-PEIPECG
DSBB_AROAE       YAFVAIALTALVAGLHGP-GRRGTRAYAAVILLLALAGGGVALRQTWMQLYP-PEFAECG
DSBB_ECOLI       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_ECO57       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_SHIDS       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_SHIFL       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_SHIF8       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_SHIBS       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_SHISS       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_ECOUT       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_ECOK1       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_ECOL6       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_ECOL5       CALFGVLGAALIGAIA-PKTP-LRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPF-ATCD
DSBB_SALTY       CALFGVMGAGLVGAIA-PKTP-LRYVAMVIWIYSAWRGLQLAYEHTMIQLHPSPF-MTCD
DSBB_SALTI       CALFGVMGAGLVGAIA-PKTP-LRYVAMVIWIYSAWRGLQLAYEHTMIQLHPSPF-MTCD
DSBB_SALCH       CALFGVMGAGLVGAIA-PKTP-LRYVAMVIWIYSAWRGLQLAYEHTMIQLHPSPF-MTCD
DSBB_SALPA       CALFGVMGAGLVGAIA-PKTP-LRYVAMVIWIYSAWRGLQLAYEHTMIQLHPSPF-MTCD
DSBB_YERPE       VALFGILGASLLGAIA-PRSP-LRYLAIAVWIYSAWKGVQLAWAHTMLQLNPSPF-NTCD
DSBB_YERPA       VALFGILGASLLGAIA-PRSP-LRYLAIAVWIYSAWKGVQLAWAHTMLQLNPSPF-NTCD
DSBB_YERPN       VALFGILGASLLGAIA-PRSP-LRYLAIAVWIYSAWKGVQLAWAHTMLQLNPSPF-NTCD
DSBB_YERPP       VALFGILGASLLGAIA-PRSP-LRYLAIAVWIYSAWKGVQLAWAHTMLQLNPSPF-NTCD
DSBB_YERPS       VALFGILGASLLGAIA-PRSP-LRYLAIAVWIYSAWKGVQLAWAHTMLQLNPSPF-NTCD
DSBB_YERE8       AALFGILGASLLGAIA-PKSP-LRYLAIFIWIYSAWKGVQLAWTHTMLQLHPSPF-TTCD
DSBB_PHOLL       VALFGVLSAGILGVIA-PKTP-LRWLAIILWIYSAWGGLQLAWQHTMMQLHPSPF-NTCD
DSBB_PECAS       SALWGVFAAGIVGAIA-PSSL-LRYPAIALWIYSSYEGIRLAWKHTDILLNPSPF-TTCD
DSBB_SODGM       CALYGVVAAGLVGAIA-PATP-LRFSGLAIWLYSAWEGLQLAMKHTDIQLHPSPF-VTCD
DSBB_BLOPB       CALCGIGIAGLIGTIA-PFTP-LRFFSIPIWIYSAWKGLLLAKEYTDIQLHPSPF-FMCD
DSBB_BLOFL       CSLFGITIAGLIALIS-PKTTLLRLFSIFIWLYSAIKGLYFSNIHMQTTLHPSSS-LTCD
DSBB_HAEDU       VALTGLLIAGLIALIA-PNFFLFRWLALVLWGFSAFKGLSLSIKHYDYQANPSPW-NQCE
DSBB_ACTP2       LAIFGLLIAGLVGAIS-PRFFLTRWLALLLWGFSAFKGLALAIKHHDYQANPSPW-NQCE
DSBB_HAEIN       LAMIGLFVAGTIALLQ-PRVFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPW-KQCE
DSBB_HAEI8       LAMIGLFVAGIIALLQ-PLAFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPW-KQCE
DSBB_HAES1       VAILGILFSGLIGCIA-PKWLVLRILALLIGLGSAVKGLLLAIKHLDYQINVYPW-NQCA
DSBB_MANSM       VALGGILFAGIIGAIA-PSSWFFRFLGIIIGLGASVKGFLLALKHVDYQLNPAPW-NQCA
DSBB_PASMU       VAILGIAFSGLLGLLY-PSSMLLRLVALLIGLSSAIKGLMISITHLDLQLYPAPW-KQCS
DSBB_SHESM       LAVFGILAAGLIGMTA-PKYRIVRILGALGWAVSATWGLKLALALVDMQNNPSPF-STCS
DSBB_SHESR       LAVFGILAAGLIGMTA-PKYRIVRILGALGWAVSATWGLKLALALVDMQNNPSPF-STCS
DSBB_SHESA       LAVFGILASGLIGMTA-PKFLIVRILGAIGWAVSATWGLKLALALVDMQNNPSPF-STCS
DSBB_SHEON       LAVFGILAAGLVGMTA-PKYRIIRILGVLGWAISATWGLKLALALVDMQNNPSPF-STCS
DSBB_SHESW       LAVFGILVAGLIGMTA-PKYRLIRILGASCWAVSATWGLKLALALVNMQNNPSPF-ATCS
DSBB_SHEAM       VAVFGLLGAGLFGFMA-PANRVIRALGALLWGISAAWGLKLALELVDMQNNPNPF-STCS
DSBB_SHELP       LAVLGVLTAGLIGVVG-HQFRLLRFLGVLLWGVSAAWGLKLALELVEMQTNPSPF-STCS
DSBB_SHEDO       VAVLGLILAGLVGSIA-PRFWIVRFLGMSLWGVSSAWGAKLSFELYQMQANPSPF-STCS
DSBB_SHEFN       VAVLGIILAALIGILQ-PKVWLLRLVGMAGWAVSAVWGFKLAYELNQMQVNPSPF-ATCS
DSBB_VIBVU       VAMLGVGGAALFGLIA-PNNPLVRWLGLAAWGASAYKGLALSLQHVDYQFNPSPF-ATCD
DSBB_VIBVY       VAMLGVGGAALFGLIA-PNNPLVRWLGLAAWGASAYKGLALSLQHVDYQFNPSPF-ATCD
DSBB_VIBPA       VAMMGIGGAAIIGLIA-PNNALFRWLGLIGWGLSSYKGLMLAMQHVDYQFNPSPF-ATCD
DSBB_ALIF1       VAMMGIGGAAIIGLLN-PNNLIIRWCGFIAWGISAGWGLKLALEHVDFQLNPSPF-STCD
DSBB_PHOPR       VAMMGIAFAALLGAIA-PQYAIIRWAGLIAWGYSAVRGLQLSIEHVGYQFNPSPF-ATCD
DSBB_VIBCH       IAMLGIGVAALIGAIA-PQNPVVRWLGFAAWGASSYKGLMLAIEHVNYQFNPSPF-ATCD
DSBB_AERHH       IATLGVLTAGLLGMVA-PQKWYVRWSALLLWGSSAFWGLKLALKHVDYQVNPSPF-NVCE
DSBB_AERS4       LAILGVLSAGLLGMVA-PEKWYLRWSALLLWGYSAFRGLQLALKHVDYQMNPSPF-NVCS
DSBB_PSYIN       LAMLGILLAGLIGASS-PNNVFIRLSAFLLWGISAVWGILLAIKHTDYQLHPSPF-FTCD
DSBB_COLP3       LAILAIFSAGAIGAIG-HQNIVARILAYVLWGVGAIWGLIIALEHVEMQKNSGSLFFSCE
DSBB_PSET1       TAVLGLLIAGIIGTSN-PEHRGVRLLAYSVWAVSSVWGFIIAREHIEMQTTTDPFAFSCE
DSBB_PSEA6       TAIFGIMFA-CVPVLA-ANNMLTRLFAFTVWGISAIWGGLIAWEHYDIQNAANPFFATCE
DSBB_IDILO       MAVIGIGLSAIVGLFG-SGLWLTRWAALIGWLYSSYQGLLIAYDHWDLQTSKNAFFAVCE
DSBB2_PSEAE      LDVLGLVLAGIVGSLA-PRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGSCK
DSBB1_PSEAB      LDVLGLVLAGIVGSLA-PRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGSCK
DSBB_ALKEH       GVFGLMSLVALVGLVYFP-RGWGRWPLAGALGLSALTGVIIALRHLYIQANPDAV--SCG
DSBB_DECAR       LLYIMIGFVGLLGFVL----PAGRLLWSTLAAGLGVLGFGVAAYQTWMQAFPDLAPECGF
                                                      .                      

DSBB_BURCA       T-LQPIVDSLPPAQWFPGMFKV-AGLCETVYPPIFGILLPGWALIGFAVILVAVVASLWR
DSBB_BURCH       T-LQPIVDSLPPAQWFPGMFKV-AGLCETVYPPIFGILLPGWALIGFAVILVAVVASLWR
DSBB_BURCE       T-LQPIVDSLPPAQWFPGMFKV-AGLCETVYPPIFGILLPGWALIGFAVILVAVVASLWR
DSBB1_BURL3      T-LQPIVDSLPPAQWFPGMFKV-AGLCETVYPPIFGILLPGWSLIGFAVILIAVVASLWR
DSBB_BURCM       T-LQPIVDSLPPAQWFPGMFKV-AGLCETVYPPIFGILLPGWALIGFAVILVAVASSLWR
DSBB_BURMA       A-LQPVVDSLPPARWLPGVFKV-AGLCETVYPPIFGILLPGWALIAFVLIAVPVAVSLLR
DSBB_BURPS       A-LQPVVDSLPPARWLPGVFKV-AGLCETVYPPIFGILLPGWALIAFVLIAVPVAVSLLR
DSBB_BURP0       A-LQPVVDSLPPARWLPGVFKV-AGLCETVYPPIFGILLPGWALIAFVLIAVPVAVSLLR
DSBB_BURTA       A-LQPVVDSLPPAHWLPGVFKV-AGLCETVYPPIFGILLPGWALIAFALIVVPVAASLLR
DSBB_PARXL       A-LQPLVDSLPPAHWLPGVFKV-AGLCETAYPPILGLTLPQWSLVAFVIAFIPLALSLVR
DSBB1_PSEPK      T-LQPIVDDLPLAKLWPLAFQV-DGFCSTPYPPILGLSLAQWALVAFVLTAVLVPLGIYR
DSBB1_PSEE4      T-LQPIVDDLPLAKLWPLAFQV-DGFCSTPYPPILGLSLAQWALVAFVLTTVLVPLGIYR
DSBB1_PSE14      V-LQPIVDGLPLATLFPTGFQV-SGFCTTPYPPVLGLSLAQWALAAFVLTAVLVPACIIR
DSBB1_PSEU2      V-LQPIVDGLPLATLFPTGFQV-SGFCTTPYPPVLGLSLAQWALTAFVLTAVLVPACIIR
DSBB_PSESM       I-LQPIVDGLPLATLFPTGFQV-SGFCTTPYPPVLGLSLAQWALTAFVLTAILVPACIIR
DSBB1_PSEF5      V-LQPIVDSLPLAKIFPLGFQV-DGFCSTPYPPILGLSLAQWALVAFVLTVILVPLGVVR
DSBB1_PSEPF      V-LQPIVDDLPLAKIFPLGFQV-DGFCSTPYPPILGLSLAQWALVAFVLVVILVPLLTSR
DSBB2_BURL3      A-LQPVIDSLPPAHWLPPVFKV-GGLCETLYPPILGLSLPMWALVGFSAIAVALGWRIRA
DSBB_HERAR       P-LETSLNTIPTAKLLPFLLQA-DGLCTTEYAPIMGLSIPQWALVWFIVIALFLLHTAFR
DSBB_CUPNH       P-LENWVNALPTAKALPQVFYA-DGLCTAPLPPVLGLSVPAWSLIWLFILTLTLAVGLIR
DSBB_CUPPJ       P-LENWVNALPTAKVLPQVFYS-DGLCTAPLPPVLGLSVPAWSLIWLFILTLTLAVGLIR
DSBB_CUPMC       P-LENWVNSLPTAKLLPQVFYS-DGLCTAPTPPILGLSIPAWSLIWLLILTLTLAVGLIR
DSBB_RALSO       P-IENWVNALPTAKWLPQVFES-DGLCTAPLPPVLGVSIPLWSLIWMVILALTLVVAMIR
DSBB_NITEU       P-EEAFLNELPLARWWPDMFEA-NGDCTDGTWQFLSLTIPDWSLLIFLAFSLIAGLLWRS
DSBB_NITEC       P-EEAFLNGLPLAQWWPNMFEA-NGDCNDGTWQFLSLTLPDWSLLIFAAFGIIAGLLWHK
DSBB_NITMU       P-EEAFLNALPLARWWPVMFEA-NGDCADVTWKFASLTLPDWSAIFFMILAALSIYVLLV
DSBB_HAHCH       PGLEYMLEAFPFSEVLTMMLTG-TGECAEVQWTFLGLSIPGWTLVAFIGFTAVWAFAWVR
DSBB_MARHV       PSVDYMLEVLPWFEVLQTALKG-TGDCAEVVWRFLGLSIPGWTAVFFSLLIVLGLFVMLR
DSBB_CHRVO       PGLEFLMESFPLWEVLSKVLKG-SGECAAIQGRFLGMTMPFWVAVFFAGVIVWTLWLVGR
DSBB_METCA       PGLSYMFRNFPLGDTLKAMLSG-TGDCAKVDWTFLGLSMPAWVLICFLGLGAFSLLQWWN
DSBB_NITOC       PGLNFMLDNFPLTETLELVFRG-SGECAEVQWSFLGLTIPGWTLVAFLFLGVISLWQMGR
DSBB_SACD2       PDLAYMFDAFPLLDALKLLFAG-DGNCADVVASFLGLSIPGWTFVAFVGLIAISVWQGLR
DSBB_ACIBT       PGLNYLIDALPMKTVLQEVLSG-SGECAAIDWTFLGQSLPVWSLAYFLLLLLVCLWQLFR
DSBB_ACIAD       PGLNYLLDALPLKTVLQQVLQG-SGECAAIHWTFLGQSLPVWSLAYFSLILLVCVWQLLR
DSBB_PSYA2       PGLDYWLDTLPMQQVLKEVFAG-SGECASIEWTFLGLSIPEQSLILFSILILTHLLILWR
DSBB_PSYCK       PGLDYWLDTLPMQQVLKEVFAG-SGECASIDWTFLGLSIPEQSLILFSILILTHLLILWR
DSBB_ALCBS       PGLDYMLEVFPLQNVLQQVLAG-SGECAEMDWSFLGLSLPGWSMVVFAGLLLVGLIQMFR
DSBB_CHRSD       PGLDYMMEVLPLWDVLSRVLAG-SGECAEIHGSLLGMSIPQWTLLGFAVLLLIPLGMLAG
DSBB_XANAC       PPLSFLSETMGPFEVFRTVLTG-TGDCGNIDWRFLGLSMPMWSMVWFVGLALWALYAGFK
DSBB_XANC5       PPLSFLSETMGPFEVFRTVLTG-TGDCGNIDWRFLGLSMPMWSMVWFVGLALWALYAGFK
DSBB_XANOR       PPLSFLSETMGPFEVFRTVLTG-TGDCGNIDWRFLGLSMPMWSMVWFVGLALWALSAGFK
DSBB_XANOM       PPLSFLSETMGPFEVFRTVLTG-TGDCGNIDWRFLGLSMPMWSMVWFVGLALWALSAGFK
DSBB_XANCP       PPLSFLSETMGPFEVFRTVLTG-TGDCGNIDWRFLGLSMPMWSMVWFVGLALWALYAGFK
DSBB_XANC8       PPLSFLSETMGPFEVFRTVLTG-TGDCGNIDWRFLGLSMPMWSMVWFVGLALWALYAGFK
DSBB_XYLFA       SPLSFLSETMGPFEVFRTVLTG-TSDCGNIDWRFLGLSMPMWSMFWFVALALLGLLVGFK
DSBB_XYLFT       SPLSFLSETMGPFEVFRTVLTG-TSNCGNIDWRFLGLSMPMWSMFWFVALALLGLLVGFK
DSBB_METFK       AGFDYIMETFPLKKALDLIFKG-TGECSAIDWTLFGLTIPQLSLIAFVGLGLFAVLLAFH
DSBB1_PSEAE      PSLDYMMQALPFQEVIRLVLHG-TADCAQVSWTLFTLSIPEWSLLAFVAYLGFSIVQFLR
DSBB2_PSEAB      PSLDYMMQALPFQEVIRLVLHG-TADCAQVSWTLFTLSIPEWSLLAFVAYLGFSIVQFLR
DSBB_PSEU5       PSLEYMMEALPFQEIARLVLHG-TAECAEVSWTMLGMSIPEWSLLGFIGMAIVCLWQLLR
DSBB2_PSEPF      PNPEEMFSSLPWLCALMRMFND-TADCAELSWTLFDLSIPEWSLLFFVGMSILAVYQLLR
DSBB2_PSEPK      PVPIGRVFEQSWSEAARQLLLG-GPDCRSLAWSFLDLTLPEWSLLAFLLLAVLPLSCLLA
DSBB2_PSEE4      HLPVEQVLQRPLGEILQMFLLG-SPDCVSISWSFLDLTLPEWSLLAFLLLAAMPLSWLVA
DSBB_LEGPL       PGLDVLIQYFPWQTVAKALFWG-AGDCAEVTWTMFGVSMPGWAAMYFLSMAIMGLFLFFR
DSBB_LEGPA       PGLDVLIQYFPWQTVAKALFWG-AGDCAEVTWTMFGISMPGWAAMYFLFMAIMGLFLFFR
DSBB_NEIMB       APWTFRLKGWPLFDWFEPVVRG-FGNCAEPDY-LLGIALPVWSVAYFLAVVLTVWWAWAR
DSBB_NEIMF       APWTFRLKGWSLFDWFEPVVRG-FGNCAEPDY-LLGVALPVWSAAYFLAVVLTVWWAWAR
DSBB_NEIMA       APWTFRLKGWPLFDWFEPVVRG-FGNCAEPDY-LLGVALPVWSVAYFLAVALTVWWAWAR
DSBB_NEIG1       APWTFRLKGWPLFDWFEPVVRG-FGNCAEPDY-LLGVALPVWSAAYFLAVVLTVWWAWAR
DSBB_ACIAC       RDFYGMIENFPISRAIPMIFRG-SGDCAAIDWTFLGGSIANWSFVCFVVMALVLLVMLLR
DSBB_ACISJ       RDFYGMIENYPISRAIPMIFRG-SGDCTAVDWTFLGGSIANWSFVWFLLFAVLLLVLLVR
DSBB_VEREI       RDFYGMIESFPLSRAIPMILRG-SGDCAAVDWSLLGGSIANWSFLCFALLGLLLLALLAR
DSBB_POLNA       RDFYGMIETFPLQRAIPMIFKG-SGDCAKVDWTFLGGSIANWSFVCFAVIGLTALTLIAR
DSBB_POLSJ       RDFYGMIETFPLKRAIPMIFKG-SGDCTKIDWTFLGLSIANWSFLCFVAIALVGLVLITR
DSBB_RHOFT       RDFYGMIETFPLQRAIPMIFKG-SGDCSKVDWTFLGGSIANWTFVVFGLIVLLSLALIWR
DSBB_AZOSB       PGLEYMLESFPLTSALPMIFRG-AGDCSAIDWTFLGLSLANWSLLNFGAAALLALWLLFG
DSBB_AROAE       PDLEFMLGSFPLADALPMIFQG-AGDCSKVDWAFLGLSIANWSLVCLTLVAVFAIMMIAR
DSBB_ECOLI       F-MVRFPEWLPLDKWVPQVFVAS-GDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVIS
DSBB_ECO57       F-MVRFPEWLPLDKWVPQVFVAS-GDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVIS
DSBB_SHIDS       F-MVRFPEWLPLDKWVPQVFVAS-GDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVIS
DSBB_SHIFL       F-MVRFPEWLPLDKWVPQVFVAS-GDCAERQWDFLGMEMPQWLLGIFIAYLIVAVLVVIS
DSBB_SHIF8       F-MVRFPEWLPLDKWVPQVFVAS-GDCAERQWDFLGMEMPQWLLGIFIAYLIVAVLVVIS
DSBB_SHIBS       F-MVRFPEWLPLDKWVPQVFVAS-GDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVMIS
DSBB_SHISS       F-MVRFPEWLPLDKWVPQVFVAS-GDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVMIS
DSBB_ECOUT       F-MARFPEWLPLDKWVPQVFVAS-GDCAERQWEFLGLEMPQWLLGIFIAYLIVAVLVVIS
DSBB_ECOK1       F-MARFPEWLPLDKWVPQVFVAS-GDCAERQWEFLGLEMPQWLLGIFIAYLIVAVLVVIS
DSBB_ECOL6       F-MARFPEWLPLDKWVPQVFVAS-GDCAERQWEFLGLEMPQWLLGIFIAYLIVAVLVVIS
DSBB_ECOL5       F-MARFPEWLPLDKWVPQVFVAS-GDCAERQWEFLGLEMPQWLLGIFIAYLIVAVLVVIS
DSBB_SALTY       F-MARFPDWLPLGKWLPQVFVAS-GDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAVVIA
DSBB_SALTI       F-MARFPDWLPLGKWLPQVFVAS-GDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAVVIA
DSBB_SALCH       F-MARFPDWLPLGKWLPQVFVAS-GDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAVVIA
DSBB_SALPA       F-MARFPDWLPLGKWLPQVFVAS-GDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAVVIA
DSBB_YERPE       F-FVNFPSWLPLDKWLPAVFAAS-GDCSERQWQFMSLEMPQWLVGIFAAYLVIAVLVLIS
DSBB_YERPA       F-FVNFPSWLPLDKWLPAVFAAS-GDCSERQWQFMSLEMPQWLVGIFAAYLVIAVLVLIS
DSBB_YERPN       F-FVNFPSWLPLDKWLPAVFAAS-GDCSERQWQFMSLEMPQWLVGIFAAYLVIAVLVLIS
DSBB_YERPP       F-FVNFPSWLPLDKWLPAVFAAS-GDCSERQWQFMSLEMPQWLVGIFAAYLVIAVLVLIS
DSBB_YERPS       F-FVNFPSWLPLDKWLPAVFAAS-GDCSERQWQFMSLEMPQWLVGIFAAYLVIAVLVLIS
DSBB_YERE8       F-FVSFPSWLPLDKWFPAVFVAS-GDCAVKQWEFLSLEMPQWLVGIFAAYLFIAILVLIS
DSBB_PHOLL       F-FVNFPSWLALNQWLPSVFEAT-GDCSVRQWQFLTLEMPQWLVGIFAAYLVVAALVLIS
DSBB_PECAS       F-FVSFPSWLPLDKWLPAIFNAT-GDCSERQWSFLSMEMPQWLLGIFAAYLLIAVLVLIA
DSBB_SODGM       F-FVSFPAWLPLDKWLPSVFSAS-GDCAVRQWHFLSLEMPQWMIVIFGAYLAVAVLILLA
DSBB_BLOPB       L-FVQFPHWLPLNKWWPSMFDAD-GDCAEYKWYFLSLEISQWMLIIFANYLIIAILVSLS
DSBB_BLOFL       L-FVSFPNWLPLNKWYPIIFDSKISNCYSYPQYLLYLEISQWMLLFFLIYLIIAIFTIIS
DSBB_HAEDU       F-KPQFPQTIPLDEWFPNIFAAGTVNCSEKQWQMLGWGMPEWLIVAFSLFMLFFLIVFMS
DSBB_ACTP2       F-KPEFPQTMPFDQWFPSIFAPGPVNCSEKQWEMFGLGMPEWLILAFSIFALMFVIVLLS
DSBB_HAEIN       F-IPNFPETLPFHQWFPFIFNP-TGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIA
DSBB_HAEI8       F-IPNFPETLPFHQWFPFIFNP-TGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIA
DSBB_HAES1       M-VPDFPQTLPLDKWFPNIFMP-SGSCSDITWSFLGFSMVQWIIVIFACYFLFFIILSIS
DSBB_MANSM       Y-LPEFPQTLPLDQWFPYLFKP-IGSCSDIQWSFLGFSMAQWILVMFAFYSILLAIILIS
DSBB_PASMU       A-VAEFPETLPLDQWFPALFLP-SGSCSEVTWQFLGFSMVQWIVVIFALYTLLLALIFIS
DSBB_SHESM       F-LPEFPAWMPLHEWFPSVMLP-TGMCTDVPWQFMGVTMAEWMVVAFSGYLVALLLFIVP
DSBB_SHESR       F-LPEFPAWMPLHEWFPSVMLP-TGMCTDVPWQFMGVTMAEWMVVAFSGYLVALLLFIVP
DSBB_SHESA       F-LPEFPAWMPLHEWFPSVMLP-TGMCTDVPWQFMGVTMAEWMVVAFSGYLVALLLFIVP
DSBB_SHEON       F-LPEFPAWMPLHEWFPAIMLP-TGMCTDVPWQFIGVTMAEWMVVAFSGYLVVLLLFIVP
DSBB_SHESW       F-LPEFPTWMPLHEWFPAVMLP-TGMCTDLPWRFMDVTMAEWMVVVFSTFLVIWLLFIVP
DSBB_SHEAM       F-LPEFPSWLQLHEWLPSVFMP-TGMCTDIPWEFAGVTMGEWMIVAFSVYLLAWLAFIVP
DSBB_SHELP       F-LPEFPEWMPLHEWFPSVFLP-TGMCTDIPWEMFGITMSQWMVVAFSTYLIALVVFIVP
DSBB_SHEDO       F-YPEFPTWMPLDAWMPSIFMP-TGMCSDIPWTMMSLSMTQWTLIAFVGYSIAFLLFIYP
DSBB_SHEFN       F-YPEFPSFMPLDTWLPSVFSP-TGMCSDSPWSWLSVSMAQWMMLGFAIYGVIWLLMLLP
DSBB_VIBVU       L-FVTFPDWAPLNQWAPWMFEA-YGDCSKIVWQFMTLSMPQWLVIIFAGNLVALAFIVIA
DSBB_VIBVY       L-FVTFPDWAPLNQWAPWMFEA-YGDCSKIVWQFMTLSMPQWLVIIFAGNLVALAFIVIA
DSBB_VIBPA       L-FVTFPSWAPLNQWVPWMFEA-YGDCSKIVWQFFDLSMPQWLVVIFAGNLVALALIVIA
DSBB_ALIF1       L-FVTFPSWAPLNKWAPWMFEA-YGDCSKIVWQFLTLTMPQWLVIIFAGNLIALAIFVIA
DSBB_PHOPR       L-FVQFPNWAPLNKWVPWMFEA-YGNCAEVVWTFLGQSMPQWLVIIFAGNLVALALIVIA
DSBB_VIBCH       L-FVTFPAWAPLNQWAPNLFEA-YGDCSKVVWQFLTLSMPQWLVVIFAANLLALAIFVVA
DSBB_AERHH       G-FVDFPSWAPLDQWIPWMFYP-DGDCSEVTWQFLSFSMPQWLVAIFAVYLLVFVVVAIG
DSBB_AERS4       P-FADFPSWAPLDQWLPWLFFP-DGDCSEISWQFLSFSMPQWLVAIFAAYLLVFVVVTIG
DSBB_PSYIN       F-FPNFPAWAPLHEWLPWLFNP-TGDCSDIVWQFLGYSMPQWLIVSFSLYTLLFIIFAIS
DSBB_COLP3       F-IPNFPTWAPLHEWIPFLFEA-TGDCGEISWRFFNYSMPQWMVVVYALFSIVFSIVLIN
DSBB_PSET1       F-EPNFPAFMPLHEWIPSFFAA-TGDCGNIDWQFAGLSMPAWMEVIFALFAATLFLLVTS
DSBB_PSEA6       I-VPNFPSWLPLHEWLPNLFAA-TGDCGNIDWVFMDMSMPQWMMVVFAIYSSIWFVVLAS
DSBB_IDILO       S-APNFPDWAPMHEWMPGLFAA-PGLCGDIDWQWLGLGMPGWMTVIFAGLLLIGIIVTIC
DSBB2_PSEAE      M-FMGFPEWIPLDTWLPQVFQP-EGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLAF
DSBB1_PSEAB      M-FMGFPEWIPLDTWLPQVFQP-EGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLAF
DSBB_ALKEH       MSPEVLAQFLPWWEVLLEILSG-TTDCTQVDA-VLGVPLPGWTLVGYLALGALGLYAVLA
DSBB_DECAR       TDPNAIERLVDWLGMEWPSMFLATGFCTSRDWELLGLSMANWSVLIFAGIVAYAVLLFVR
                                    .      *           :                     

DSBB_BURCA       HRRKLAS---------------
DSBB_BURCH       HRRKLAS---------------
DSBB_BURCE       HRRKLAS---------------
DSBB1_BURL3      HRRKLVG---------------
DSBB_BURCM       HRRKLAG---------------
DSBB_BURMA       HRGRLR----------------
DSBB_BURPS       HRGRLR----------------
DSBB_BURP0       HRGRLR----------------
DSBB_BURTA       HRGRLR----------------
DSBB_PARXL       NRRRIA----------------
DSBB1_PSEPK      NRRQA-----------------
DSBB1_PSEE4      NRRRG-----------------
DSBB1_PSE14      NRRKPY----------------
DSBB1_PSEU2      NRRKPY----------------
DSBB_PSESM       NRRKPY----------------
DSBB1_PSEF5      NRKKTY----------------
DSBB1_PSEPF      NRKALR----------------
DSBB2_BURL3      QAVIRTA---------------
DSBB_HERAR       KKS-------------------
DSBB_CUPNH       REKNFR----------------
DSBB_CUPPJ       REKNFR----------------
DSBB_CUPMC       REKHFR----------------
DSBB_RALSO       RERR------------------
DSBB_NITEU       RSISSSNLK-------------
DSBB_NITEC       KYNSINQ---------------
DSBB_NITMU       RENQRE----------------
DSBB_HAHCH       R--PR-----------------
DSBB_MARHV       RYSPRDWLQS------------
DSBB_CHRVO       R--RRG----------------
DSBB_METCA       AER-------------------
DSBB_NITOC       TGGGAGKLT-------------
DSBB_SACD2       KA--------------------
DSBB_ACIBT       FYPVFKTAKK------------
DSBB_ACIAD       RYPVIVTKKK------------
DSBB_PSYA2       IVRPSTPKPLAR----------
DSBB_PSYCK       IVRPATPKPLAR----------
DSBB_ALCBS       PLTR------------------
DSBB_CHRSD       IVIRRR----------------
DSBB_XANAC       VRRSSVHH--------------
DSBB_XANC5       ARRSSVHH--------------
DSBB_XANOR       ARRSSLHH--------------
DSBB_XANOM       ARRSSLHH--------------
DSBB_XANCP       HRGPRKLF--------------
DSBB_XANC8       HRGPRKLF--------------
DSBB_XYLFA       AERRKPLFS-------------
DSBB_XYLFT       AERRKPLFS-------------
DSBB_METFK       KKA-------------------
DSBB1_PSEAE      RA--------------------
DSBB2_PSEAB      RA--------------------
DSBB_PSEU5       RD--------------------
DSBB2_PSEPF      QVWMALQRPLSGQPSHPALVRD
DSBB2_PSEPK      YRFRTLART-------------
DSBB2_PSEE4      YRFRKRAMA-------------
DSBB_LEGPL       TRTIN-----------------
DSBB_LEGPA       TRTIN-----------------
DSBB_NEIMB       AK--------------------
DSBB_NEIMF       AK--------------------
DSBB_NEIMA       AK--------------------
DSBB_NEIG1       AK--------------------
DSBB_ACIAC       APRPARGGFSAA----------
DSBB_ACISJ       GGRGAPDTLARA----------
DSBB_VEREI       GVRGARQRAPAPV---------
DSBB_POLNA       LARQR-----------------
DSBB_POLSJ       LARQR-----------------
DSBB_RHOFT       RVSRRVS---------------
DSBB_AZOSB       RRVR------------------
DSBB_AROAE       KRGG------------------
DSBB_ECOLI       QPFKAKKRDLFGR---------
DSBB_ECO57       QPFKAKKRDLFGR---------
DSBB_SHIDS       QPFKAKKRDLFGR---------
DSBB_SHIFL       QPFKAKKRDLFGR---------
DSBB_SHIF8       QPFKAKKRDLFGR---------
DSBB_SHIBS       QPFKAKKRDLFGR---------
DSBB_SHISS       QPFKAKKRDLFGR---------
DSBB_ECOUT       QPFKAKKRDLFGR---------
DSBB_ECOK1       QPFKAKKRDLFGR---------
DSBB_ECOL6       QPFKAKKRDLFGR---------
DSBB_ECOL5       QPFKAKKRDLFGR---------
DSBB_SALTY       QAFKPKKRDLFGR---------
DSBB_SALTI       QAFKPKKRDLFGR---------
DSBB_SALCH       QAFKPKKRDLFGR---------
DSBB_SALPA       QAFKPKKRDLFGR---------
DSBB_YERPE       QFVKPKRRDLFGR---------
DSBB_YERPA       QFVKPKRRDLFGR---------
DSBB_YERPN       QFVKPKRRDLFGR---------
DSBB_YERPP       QFVKPKRRDLFGR---------
DSBB_YERPS       QFVKPKRRDLFGR---------
DSBB_YERE8       QFVKPKRRDLFSR---------
DSBB_PHOLL       QFFSRK----------------
DSBB_PECAS       QPFRSKRRDLFSR---------
DSBB_SODGM       QFFPPRKRDLFSR---------
DSBB_BLOPB       QIIDLKKWNNK-----------
DSBB_BLOFL       QCHNLFQKK-------------
DSBB_HAEDU       QFKRAKPQYRSVFR--------
DSBB_ACTP2       QFKRAKPQYRSVFR--------
DSBB_HAEIN       QVIKTR-KQRRLFN--------
DSBB_HAEI8       QVIKTR-KQRRLFN--------
DSBB_HAES1       QFKKVR-KNRMLFR--------
DSBB_MANSM       QVKAGKPKHREIFR--------
DSBB_PASMU       QVKRLKPKQRRLFH--------
DSBB_SHESM       ILSGSNKPSLYK----------
DSBB_SHESR       ILSGSNKPSLYK----------
DSBB_SHESA       ILSGSNKPSLYK----------
DSBB_SHEON       ILSGSNKPSLYK----------
DSBB_SHESW       ILSGSTKPSLYK----------
DSBB_SHEAM       MLKKSA----------------
DSBB_SHELP       ALMPTKKA--------------
DSBB_SHEDO       GLLYKKPTNPYS----------
DSBB_SHEFN       ALKSAK----------------
DSBB_VIBVU       QFFKSK----------------
DSBB_VIBVY       QFFKSK----------------
DSBB_VIBPA       QFFPVKRKNPIR----------
DSBB_ALIF1       QFFNKK----------------
DSBB_PHOPR       QFFSKKTNTILDM---------
DSBB_VIBCH       QLAKTSR---------------
DSBB_AERHH       NLVKGRCCS-------------
DSBB_AERS4       NLVKGRCCS-------------
DSBB_PSYIN       AVLKTKKQLF------------
DSBB_COLP3       RLVCAKKP--------------
DSBB_PSET1       RLMTKRSL--------------
DSBB_PSEA6       RLIGNRAI--------------
DSBB_IDILO       HIISSFTKKDGLVLYHK-----
DSBB2_PSEAE      GRRTA-----------------
DSBB1_PSEAB      GRRTA-----------------
DSBB_ALKEH       RRA-------------------
DSBB_DECAR       KDRA------------------