CLUSTAL format seed alignment for MF_00291_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS2_UREP2       --------------------------------------MSQMENSTKKVESVANVEVVTT
RS2_MYCPE       MPKKAEAKTGSSSKTTKRTVAKKDVKAEVNETNKTAEKVSSKKVNKTANSVDTNESSSNS
RS2_MYCPN       ------------------------------------------------------------
RS2_MYCGA       ------------------------------------------------------------
RR2_STIHE       ------------------------------------------MTLSTNNSKNDFLDKTGP
RR2_EUGLO       ------------------------------------------------------------
RS2_MYCAP       ------------------------------------------------------------
RS2_MYCPU       ------------------------------------------------------------
RS2_MYCH7       ------------------------------------------------------------
RS2_MYCMO       ------------------------------------------------------------
RS2_MYCS5       ------------------------------------------------------------
RR2_PLETE       ------------------------------------------------------------
RS2_OPITP       ------------------------------------------------------------
RS2_PARUW       ------------------------------------------------------------
RS2_CHLMU       ------------------------------------------------------------
RS2_CHLPN       ------------------------------------------------------------
RR2_BIGNA       ------------------------------------------------------------
RR2_OSTTA       ------------------------------------------------------------
RS2_RHOBA       ------------------------------------------------------------
RS2_MESFL       ------------------------------------------------------------
RS2_MYCCT       ------------------------------------------------------------
RS2_SALRD       -------------------MADETTTDTPDVQDEDAPDEDAPQTPDDTASDSTGEAAAAD
RS2_CHLTE       ------------------------------------------------------------
RS2_SULMW       ------------------------------------------------------------
RS2_CYTH3       ------------------------------------------------------------
RS2_FLAPJ       ------------------------------------------------------------
RS2_GRAFK       ------------------------------------------------------------
RS2_PORGI       ------------------------------------------------------------
RS2_BACV8       ------------------------------------------------------------
RS2_PARD8       ------------------------------------------------------------
RS2_NEOSM       ------------------------------------------------------------
RS2_ORITB       ------------------------------------------------------------
RS2_DICNV       ------------------------------------------------------------
RS2_RUTMC       ------------------------------------------------------------
RS2_FRAP2       ------------------------------------------------------------
RS2_COXBR       ------------------------------------------------------------
RS2_LEGPH       ------------------------------------------------------------
RS2_METCA       ------------------------------------------------------------
RS2_BORA1       ------------------------------------------------------------
RS2_POLAQ       ------------------------------------------------------------
RS2_CHRVO       ------------------------------------------------------------
RS2_RHOFT       ------------------------------------------------------------
RS2_NITEC       ------------------------------------------------------------
RS2_NITMU       ------------------------------------------------------------
RS2_THIDA       ------------------------------------------------------------
RS2_JANMA       ------------------------------------------------------------
RS2_DECAR       ------------------------------------------------------------
RS2_XYLFT       ------------------------------------------------------------
RS2_WIGBR       ------------------------------------------------------------
RS2_BUCCC       ------------------------------------------------------------
RS2_BLOPB       ------------------------------------------------------------
RS2_IDILO       ------------------------------------------------------------
RS2_BUCBP       ------------------------------------------------------------
RS2_BAUCH       ------------------------------------------------------------
RS2_PSEA6       ------------------------------------------------------------
RS2_ECOLI       ------------------------------------------------------------
RS2_NITOC       ------------------------------------------------------------
RS2_ALKEH       ------------------------------------------------------------
RS2_HALHL       ------------------------------------------------------------
RS2_ACIAD       ------------------------------------------------------------
RS2_HYDCU       ------------------------------------------------------------
RS2_CHRSD       ------------------------------------------------------------
RS2_ALCBS       ------------------------------------------------------------
RS2_SACD2       ------------------------------------------------------------
RS2_PSEU5       ------------------------------------------------------------
RS2_MARMS       ------------------------------------------------------------
RS2_DEIRA       ------------------------------------------------------------
RS2_THET8       ------------------------------------------------------------
RS2_RICBR       ------------------------------------------------------------
RS2_WOLTR       ------------------------------------------------------------
RS2_EHRRW       ------------------------------------------------------------
RS2_ANAPZ       ------------------------------------------------------------
RS2_ANAMM       ------------------------------------------------------------
RS2_RUBXD       ------------------------------------------------------------
RS2_TROWT       ------------------------------------------------------------
RS2_BIFLO       ------------------------------------------------------------
RS2_SALTO       ------------------------------------------------------------
RS2_CLAMS       ------------------------------------------------------------
RS2_LEIXX       ------------------------------------------------------------
RS2_FRAAA       ------------------------------------------------------------
RS2_RHOJR       ------------------------------------------------------------
RS2_COREF       ------------------------------------------------------------
RS2_CORJK       ------------------------------------------------------------
RS2_NOCSJ       ------------------------------------------------------------
RS2_KINRD       ------------------------------------------------------------
RS2_RENSM       ------------------------------------------------------------
RS2_CUTAK       ------------------------------------------------------------
RS2_THEFY       ------------------------------------------------------------
RS2_ZYMMO       ------------------------------------------------------------
RS2_ERYLH       ------------------------------------------------------------
RS2_ROSDO       ------------------------------------------------------------
RS2_PARDP       ------------------------------------------------------------
RS2_ACICJ       ------------------------------------------------------------
RS2_MAGSA       ------------------------------------------------------------
RS2_RHORT       ------------------------------------------------------------
RS2_HYPNA       ------------------------------------------------------------
RS2_MARMM       ------------------------------------------------------------
RS2_METRJ       ------------------------------------------------------------
RS2_BEII9       ------------------------------------------------------------
RS2_RHOP5       ------------------------------------------------------------
RS2_AZOC5       ------------------------------------------------------------
RS2_CAUSK       ------------------------------------------------------------
RS2_PARL1       ------------------------------------------------------------
RS2_BARBK       ------------------------------------------------------------
RS2_CHESB       ------------------------------------------------------------
RS2_DEHM1       ------------------------------------------------------------
RS2_BDEBA       ------------------------------------------------------------
RS2_SULDN       ------------------------------------------------------------
RS2_CAMHC       ------------------------------------------------------------
RS2_SULNB       ------------------------------------------------------------
RS2_ARCB4       ------------------------------------------------------------
RS2_NITSB       ------------------------------------------------------------
RS2_HELPY       ------------------------------------------------------------
RS2_WOLSU       ------------------------------------------------------------
RS2_BORAP       ------------------------------------------------------------
RS2_MAGMM       ------------------------------------------------------------
RS2_SORC5       ------------------------------------------------------------
RS2_TREPA       ------------------------------------------------------------
RS2_LEPBJ       ------------------------------------------------------------
RS2_ROSS1       ------------------------------------------------------------
RS2_CHLAA       ------------------------------------------------------------
RS2_DESAG       ------------------------------------------------------------
RS2_LAWIP       ------------------------------------------------------------
RS2_ONYPE       ------------------------------------------------------------
RS2_DESPS       ------------------------------------------------------------
RS2_PETMO       ------------------------------------------------------------
RS2_ANADF       ------------------------------------------------------------
RS2_MYXXD       ------------------------------------------------------------
RS2_PELPD       ------------------------------------------------------------
RS2_PELCD       ------------------------------------------------------------
RS2_KORVE       ------------------------------------------------------------
RS2_SOLUE       ------------------------------------------------------------
RS2_FUSNN       ------------------------------------------------------------
RS2_AQUAE       ------------------------------------------------------------
RS2_SYNFM       ------------------------------------------------------------
RS2_ACHLI       ------------------------------------------------------------
RS2_SYNAS       ------------------------------------------------------------
RS2_PSELT       ------------------------------------------------------------
RS2_THEMA       ------------------------------------------------------------
RS2_THEM4       ------------------------------------------------------------
RS2_FERNB       ------------------------------------------------------------
RS2_OENOB       ------------------------------------------------------------
RS2_LACP7       ------------------------------------------------------------
RS2_LEUCK       ------------------------------------------------------------
RS2_LACH4       ------------------------------------------------------------
RS2_PEDPA       ------------------------------------------------------------
RS2_LACRD       ------------------------------------------------------------
RS2_OCEIH       ------------------------------------------------------------
RS2_STAS1       ------------------------------------------------------------
RS2_LYSSC       ------------------------------------------------------------
RS2_STRTD       ------------------------------------------------------------
RS2_ENTFA       ------------------------------------------------------------
RS2_SYMTH       ------------------------------------------------------------
RS2_CALS4       ------------------------------------------------------------
RS2_SYNWW       ------------------------------------------------------------
RS2_CLOK5       ------------------------------------------------------------
RS2_HUNT2       ------------------------------------------------------------
RS2_CARHZ       ------------------------------------------------------------
RR2_EUGGR       ------------------------------------------------------------
RR2_CYACA       ------------------------------------------------------------
RR2_CHLVU       ------------------------------------------------------------
RR2_OLTVI       ------------------------------------------------------------
RR2_TUPAK       ------------------------------------------------------------
RR2_NEPOL       ------------------------------------------------------------
RR2_CYAM1       ------------------------------------------------------------
RR2_PHATC       ------------------------------------------------------------
RS2_GLOVI       ------------------------------------------------------------
RR2_CHLAT       ------------------------------------------------------------
RR2_EMIHU       ------------------------------------------------------------
RS2_SYNJA       ------------------------------------------------------------
RR2_RHDSA       ------------------------------------------------------------
RR2_PYRYE       ------------------------------------------------------------
RR2_GRATL       ------------------------------------------------------------
RS2_SYNR3       ------------------------------------------------------------
RS2_SYNY3       ------------------------------------------------------------
RS2_MICAN       ------------------------------------------------------------
RR2_CYAPA       ------------------------------------------------------------
RS2_THEEB       ------------------------------------------------------------
RS2_SYNE7       ------------------------------------------------------------
RS2_ACAM1       ------------------------------------------------------------
RS2_TRIEI       ------------------------------------------------------------
RR2_CHAVU       ------------------------------------------------------------
RR2_ZYGCR       ------------------------------------------------------------
RR2_CRYJA       ------------------------------------------------------------
RR2_CHAGL       ------------------------------------------------------------
RR2_PELHO       ------------------------------------------------------------
RR2_PSINU       ------------------------------------------------------------
RR2_ANEMR       ------------------------------------------------------------
RR2_CUSOB       ------------------------------------------------------------
RR2_ADICA       ------------------------------------------------------------
RR2_TRACE       ------------------------------------------------------------
RR2_MAIZE       ------------------------------------------------------------
RR2_STAPU       ------------------------------------------------------------
RR2_ANGEV       ------------------------------------------------------------
RR2_HUPLU       ------------------------------------------------------------
RR2_ANTAG       ------------------------------------------------------------
RR2_CYCTA       ------------------------------------------------------------
RR2_EPIVI       ------------------------------------------------------------
RR2_PHAVU       ------------------------------------------------------------
RR2_AMBTC       ------------------------------------------------------------
                                                                            

RS2_UREP2       EN--------AKVEQKPTSPADAIQLKVNANSTI--KNLKTLVSIV--------------
RS2_MYCPE       TPSTGSKFELSSFKEKVAEIENNILQKIKENPTITGKPFRKLVSVN--------------
RS2_MYCPN       -------------------------MSELITTPVETTAKAELVSLA--------------
RS2_MYCGA       ------------------MFLFEDLNVESAQAVKAEESPAQTVQSKEEQVPANSTDKVLV
RR2_STIHE       VSILGTSKGKKALLRRRLLIIQNVRNILIKKIINFDNFSNPIETYK--------------
RR2_EUGLO       --------------------------------------MFNDKIIK--------------
RS2_MYCAP       -------MENENLKVEQATTAENNMAEKADDSKASKEVKPTIVSRE--------------
RS2_MYCPU       -------------------MAEKTLRKSNEDKQVKTENIYKIIPNS--------------
RS2_MYCH7       -------MEKLVTQQVQNVDPKQSEILNISEIPAENPTETPIISKQ--------------
RS2_MYCMO       --------------------MNINDMNDAPEVSSSESQKNEIVSKQ--------------
RS2_MYCS5       ---------------MNTKKEEVVSSPEATVEKKQTQSQTPIVSRD--------------
RR2_PLETE       --ME------IIKKTDSFVKKLPRKTTSFSARNWEEKQVIDKKLIK--------------
RS2_OPITP       ----------------------------------------MNVTPK--------------
RS2_PARUW       --------------------------------MAQNKNQTLPISIK--------------
RS2_CHLMU       ------------------------------------MVLSCELTLK--------------
RS2_CHLPN       -----------------------------------MESQSCKLTIK--------------
RR2_BIGNA       ------------------------MNFELKNFNTIRINKNQTILIKTTNLENSSKEDTYQ
RR2_OSTTA       ------------------------------MFIKFEKVKKLLNMLQ--------------
RS2_RHOBA       ---------------------------------------MANEIVK--------------
RS2_MESFL       -------------------------------------MAYKEVTRD--------------
RS2_MYCCT       --------------------------------------MSREITRE--------------
RS2_SALRD       TDADAPDENAPDEDAPDAAPQDKDDGDDAPEESSSEEETSHRVTIE--------------
RS2_CHLTE       --------------------------------------MPTKFQLE--------------
RS2_SULMW       -----------------------------------------MYNIE--------------
RS2_CYTH3       --------------------------------------MAKKIEYK--------------
RS2_FLAPJ       --------------------------------------MANKIEVK--------------
RS2_GRAFK       --------------------------------------MANKVDVK--------------
RS2_PORGI       ---------------------------------------MSRISFD--------------
RS2_BACV8       ---------------------------------------MSRTNFD--------------
RS2_PARD8       ---------------------------------------MSRVNFD--------------
RS2_NEOSM       -----------------------------------MQSIFDRVTVK--------------
RS2_ORITB       -------------------------------MSNNNISTLSSVTIS--------------
RS2_DICNV       ---------------------------------------MTQVSMR--------------
RS2_RUTMC       ---------------------------------------MAKTSMK--------------
RS2_FRAP2       -----------------------------------------MSLMK--------------
RS2_COXBR       ---------------------------------------MTDITMR--------------
RS2_LEGPH       ---------------------------------------MNNVSMR--------------
RS2_METCA       ---------------------------------------MTSVTMR--------------
RS2_BORA1       -----------------------------------------MSLMR--------------
RS2_POLAQ       ----------------------------------------MSVTMR--------------
RS2_CHRVO       --------------------------------------MSTNVTMR--------------
RS2_RHOFT       ----------------------------------------MAITMR--------------
RS2_NITEC       ----------------------------------------MSVTMR--------------
RS2_NITMU       ----------------------------------------MSVTMR--------------
RS2_THIDA       ----------------------------------------MSVTMR--------------
RS2_JANMA       ----------------------------------------MSVTMR--------------
RS2_DECAR       ----------------------------------------MSVTMR--------------
RS2_XYLFT       ---------------------------------------MPQVTMR--------------
RS2_WIGBR       ---------------------------------------MLNLSMK--------------
RS2_BUCCC       ---------------------------------------MDIALMK--------------
RS2_BLOPB       ---------------------------------------MENISIR--------------
RS2_IDILO       ---------------------------------------MANVSMR--------------
RS2_BUCBP       ----------------------------------------MMVSMR--------------
RS2_BAUCH       ---------------------------------------MVTVLMH--------------
RS2_PSEA6       ---------------------------------------MANVSMR--------------
RS2_ECOLI       ---------------------------------------MATVSMR--------------
RS2_NITOC       ---------------------------------------MANVTMR--------------
RS2_ALKEH       ---------------------------------------MANVSMR--------------
RS2_HALHL       ---------------------------------------MADVSMR--------------
RS2_ACIAD       -------------------------------------MADYNVSMR--------------
RS2_HYDCU       ---------------------------------------MAKVTMR--------------
RS2_CHRSD       ---------------------------------------MAQVNMR--------------
RS2_ALCBS       ---------------------------------------MSSVTMR--------------
RS2_SACD2       ---------------------------------------MPTVSMR--------------
RS2_PSEU5       ---------------------------------------MSQVTMR--------------
RS2_MARMS       ---------------------------------------MPTVSMR--------------
RS2_DEIRA       ---------------------------------------MSYISMK--------------
RS2_THET8       --------------------------------------MPVEITVK--------------
RS2_RICBR       ------------------------------------MSKIPPVNVK--------------
RS2_WOLTR       ----------------------------------MNMANLPEVTVR--------------
RS2_EHRRW       ------------------------------------MVDLPKFTMR--------------
RS2_ANAPZ       ------------------------------------MGSIPEFSIR--------------
RS2_ANAMM       ------------------------------------MGNLPEFSIR--------------
RS2_RUBXD       ------------------------------------MESTQSIGIR--------------
RS2_TROWT       ---------------------------------MFWRGGLPLVTIR--------------
RS2_BIFLO       ---------------------------------------MAQITMS--------------
RS2_SALTO       ---------------------------------------MAVVTMR--------------
RS2_CLAMS       ---------------------------------------MAVVTIR--------------
RS2_LEIXX       ---------------------------------------MAVVTMR--------------
RS2_FRAAA       ---------------------------------------MAVVTMK--------------
RS2_RHOJR       ---------------------------------------MAVVTMK--------------
RS2_COREF       ---------------------------------------MAVVTMR--------------
RS2_CORJK       ---------------------------------------MAVVTMR--------------
RS2_NOCSJ       ---------------------------------------MAVVTMR--------------
RS2_KINRD       ---------------------------------------MAVVTMR--------------
RS2_RENSM       ---------------------------------------MPVVTMR--------------
RS2_CUTAK       ---------------------------------------MAVVTTR--------------
RS2_THEFY       --------------------------------------MATVVTIR--------------
RS2_ZYMMO       -------------------------------------MAVPTVTMQ--------------
RS2_ERYLH       -------------------------------------MAAPTVTMQ--------------
RS2_ROSDO       -------------------------------------MALPEFSMR--------------
RS2_PARDP       -----------------------------------MDMALPEFSMR--------------
RS2_ACICJ       -------------------------------------MAMPDVSLR--------------
RS2_MAGSA       -------------------------------------MALPTFTMR--------------
RS2_RHORT       -------------------------------------MALPTFSMR--------------
RS2_HYPNA       -------------------------------------MALPDFSMR--------------
RS2_MARMM       -------------------------------------MALPDFSMR--------------
RS2_METRJ       --------------------------------------MAVDFSMR--------------
RS2_BEII9       -------------------------------------MSLPEFSMR--------------
RS2_RHOP5       -------------------------------------MALPEFSMR--------------
RS2_AZOC5       -------------------------------------MALPDYSMR--------------
RS2_CAUSK       -------------------------------------MALPEFSMR--------------
RS2_PARL1       -------------------------------------MALPDFSMR--------------
RS2_BARBK       -------------------------------------MALPDFTMR--------------
RS2_CHESB       -------------------------------------MALPDFSMR--------------
RS2_DEHM1       ---------------------------------------MPTTNIK--------------
RS2_BDEBA       ---------------------------------------MAQVTMK--------------
RS2_SULDN       -----------------------------------------MVTMK--------------
RS2_CAMHC       -----------------------------------------MVTMR--------------
RS2_SULNB       -----------------------------------------MVTMK--------------
RS2_ARCB4       -----------------------------------------MVTMK--------------
RS2_NITSB       -----------------------------------------MVTMK--------------
RS2_HELPY       -----------------------------------------MVTMK--------------
RS2_WOLSU       -----------------------------------------MVTMK--------------
RS2_BORAP       ---------------------------------------MAIITMK--------------
RS2_MAGMM       ---------------------------------------MAKYSVR--------------
RS2_SORC5       ------------------------------MQAVAPQPGDFPLPLR--------------
RS2_TREPA       ---------------------------------------MAVVTIK--------------
RS2_LEPBJ       ---------------------------------------MSVISMK--------------
RS2_ROSS1       ----------------------------------MTQGAQRLVSMR--------------
RS2_CHLAA       ----------------------------------MTQALPRVVTIR--------------
RS2_DESAG       ---------------------------------------MAYVTMK--------------
RS2_LAWIP       ---------------------------------------MAYVSMK--------------
RS2_ONYPE       ---------------------------------------MAVVTTK--------------
RS2_DESPS       ---------------------------------------MSQVTVK--------------
RS2_PETMO       ---------------------------------------MSVVSMK--------------
RS2_ANADF       -------------------------------MASALTTQGTAITMK--------------
RS2_MYXXD       ------------------------------------MAAAGGITMR--------------
RS2_PELPD       ---------------------------------------MSSISMK--------------
RS2_PELCD       ---------------------------------------MAQVSMK--------------
RS2_KORVE       ---------------------------------------MANITMK--------------
RS2_SOLUE       ---------------------------------------MPAISMK--------------
RS2_FUSNN       ---------------------------------------MSVVSMK--------------
RS2_AQUAE       ---------------------------------------MPVVSMK--------------
RS2_SYNFM       ---------------------------------------MAVISMK--------------
RS2_ACHLI       ---------------------------------------MAVVSMK--------------
RS2_SYNAS       ---------------------------------------MAIISMK--------------
RS2_PSELT       ---------------------------------------MPVITMK--------------
RS2_THEMA       ---------------------------------------MPVVTMK--------------
RS2_THEM4       ---------------------------------------MAVVTMK--------------
RS2_FERNB       ---------------------------------------MPVVTMK--------------
RS2_OENOB       ---------------------------------------MAAISMK--------------
RS2_LACP7       ---------------------------------------MSVISMK--------------
RS2_LEUCK       ---------------------------------------MAVISMK--------------
RS2_LACH4       --------------------------------------MADVVTMK--------------
RS2_PEDPA       ---------------------------------------MSVISMK--------------
RS2_LACRD       ---------------------------------------MSVVSMK--------------
RS2_OCEIH       ---------------------------------------MAAISMK--------------
RS2_STAS1       ---------------------------------------MAVISMK--------------
RS2_LYSSC       ---------------------------------------MSVISMK--------------
RS2_STRTD       ---------------------------------------MAVISMK--------------
RS2_ENTFA       ---------------------------------------MAVISMK--------------
RS2_SYMTH       ---------------------------------------MSVISMK--------------
RS2_CALS4       ---------------------------------------MSIVSMK--------------
RS2_SYNWW       ---------------------------------------MSVVTMK--------------
RS2_CLOK5       ---------------------------------------MSIISMK--------------
RS2_HUNT2       ---------------------------------------MSVISMK--------------
RS2_CARHZ       ---------------------------------------MAVISMK--------------
RR2_EUGGR       -----------------------------------------MITVE--------------
RR2_CYACA       ----------------------------------------METSLS--------------
RR2_CHLVU       --------------------------------------MLQKVKLE--------------
RR2_OLTVI       ----------------------------------------MKVSIE--------------
RR2_TUPAK       ------------------------------MITKLKPYLQMTLTLE--------------
RR2_NEPOL       -----------------------------------------MATLE--------------
RR2_CYAM1       -----------------------------------------MMKIQ--------------
RR2_PHATC       ---------------------------------------MSDISLS--------------
RS2_GLOVI       ---------------------------------------MSVVSLP--------------
RR2_CHLAT       ---------------------------------------MRSVTLE--------------
RR2_EMIHU       ---------------------------------------MTVVTLG--------------
RS2_SYNJA       ---------------------------------------MSVVSLP--------------
RR2_RHDSA       ---------------------------------------MAVVTLA--------------
RR2_PYRYE       ---------------------------------------MAIVTLA--------------
RR2_GRATL       ---------------------------------------MSIVSLS--------------
RS2_SYNR3       ---------------------------------------MAVVTLS--------------
RS2_SYNY3       ---------------------------------------MPVVSLA--------------
RS2_MICAN       ---------------------------------------MPVVSLA--------------
RR2_CYAPA       ---------------------------------------MAIVTLD--------------
RS2_THEEB       ---------------------------------------MAVLSLA--------------
RS2_SYNE7       ---------------------------------------MAIISLA--------------
RS2_ACAM1       ---------------------------------------MPVISLA--------------
RS2_TRIEI       ---------------------------------------MPVVSLA--------------
RR2_CHAVU       -----------------------------------MNHLYSKTNLE--------------
RR2_ZYGCR       -----------------------------------MKEENWNNNLE--------------
RR2_CRYJA       -----------------------------------MTKKNWNINLK--------------
RR2_CHAGL       -------------------------------------MNSWNINLE--------------
RR2_PELHO       -----------------------------------MTKRSWNIRLE--------------
RR2_PSINU       -----------------------------------MQQTNWNIELI--------------
RR2_ANEMR       -----------------------------------MKQKSWDIHLE--------------
RR2_CUSOB       -----------------------------------MKKKYWNIKLE--------------
RR2_ADICA       -----------------------------------MQQKNWTIDLE--------------
RR2_TRACE       -----------------------------------MTRRYWNITLD--------------
RR2_MAIZE       -----------------------------------MTRRYWNINLK--------------
RR2_STAPU       -----------------------------------MKTESLTISLE--------------
RR2_ANGEV       -----------------------------------MQQKNWNINLE--------------
RR2_HUPLU       -----------------------------------MEPKYWNINLE--------------
RR2_ANTAG       -----------------------------------MKQKYWNINLE--------------
RR2_CYCTA       -----------------------------------MTKRYWNINLE--------------
RR2_EPIVI       -----------------------------------MTRRYWNIDLE--------------
RR2_PHAVU       -----------------------------------MTKRYWNIILE--------------
RR2_AMBTC       -----------------------------------MARRYWDINLE--------------
                                                                            

RS2_UREP2       ---KLTESGAHIGLNPKKWNPKMASYIHAK---R--SNN-H-VIDILKTILF---LDRAY
RS2_MYCPE       ---KLMETGAHIGLTTRKWNPKMKKFIYTK---K--GNN-H-IIDLLHTVIS---LNVAY
RS2_MYCPN       ---KLGEMRTHVGMVKRYWNPKMGFFIEPE---RKHNND-HFVLELQRQS-----LQTAY
RS2_MYCGA       THTKLLDVGAFNGVAKRKWNPKMKHYIIPRNAAQ--FSA-Q--FDLINSDLLNLKLHEAF
RR2_STIHE       ---IMLRKSLHFGHPVIQCDSGMKKYIRGQ---S--NGK-H-FINLFRTKRY---IRKAL
RR2_EUGLO       ---EMFFARLHLGHFSTKWNPKMKKYVFCK---Q--NGK-Y-IIDLIQTVYY---LKKVC
RS2_MYCAP       ---KLLEAGTYFGHKKSMWNPKMKEFLYPQ--SK--RGM-H-MINTNVTLQR---LEFAY
RS2_MYCPU       ---KFLEAGVYFGHRTQQWNPKMKKFIHSK---R--RGI-H-ILDVSKTSKA---LEWAY
RS2_MYCH7       ---KLLEAGVYFGHKASQWHPKMAQFLLKK--KR--NET-H-IIDVLKTQKM---LEIAY
RS2_MYCMO       ---KLLEAGTYFGHKASLWNPKMKPFIHSK---K--MGT-H-IIDIAQTRKA---LEYAY
RS2_MYCS5       ---KLLEAGAYFGHKKQMWHPKMKEFIVPK---RLNKNA-H-IIDIVKTQKY---LEFAY
RR2_PLETE       ---SMFEAGLHRGDLTQNWNPKMAPYIRGE---F--KGK-H-VINLVQTLLY---LEEVC
RS2_OPITP       ---DLLDAGVHFGHQTKRWNPRSKPFVFDH---R--QGI-S-IIDLGKTHAA---LEKAC
RS2_PARUW       ---DLLEAGAHFGHQTSRWNPKMKRFIFEE---R--NGL-Y-IIDLAKTLQQ---IRNAV
RS2_CHLMU       ---ELLESGAHFGHQTSRWNPKMKPFIFEE---K--NGL-Y-IIDLAKTLAQ---LKKAV
RS2_CHLPN       ---DLMSAGAHFGHQTRRWNPKMKLYIFEE---K--NGL-Y-IINLAKTLQQ---LRNAL
RR2_BIGNA       FILKMLKAGVHFGHKIKKWNPKMSPFIYQK---L--QGI-H-IIDIIQSYTY---LKKAC
RR2_OSTTA       ---SMLEAGVHFGHQSRRWNPKMAPYIYEE---K--NGI-H-ILDVVQTIGE---LEKAR
RS2_RHOBA       ---EMIEAGVHFGHRTSLWNPKMAPYIFGK---K--NQI-H-ILDIRETLRG---LLRAK
RS2_MESFL       ---ELSAAGVQYGHQTKRWNPKMAPFIYGS---K--SKN-H-VIDLEKTLIQ---LRQAE
RS2_MYCCT       ---ELSAAGVQYGHQTKRWNPKMKSYIYGV---K--NKN-H-IIDLEKTITH---LNAAQ
RS2_SALRD       ---ELLKAGAHFGHLTSRWNPRMEKYIFME---R--NNI-H-IIDLMQSQVL---LDEAA
RS2_CHLTE       ---EMLRAGVHFGHLARRWNPKMKPYIFME---K--NGV-H-IIDLKKTLVM---AEEAL
RS2_SULMW       ---KFIKVGAHFGHTTSKWNPNMRKYIFMK---K--GGI-H-IIDISKTIKK---INEAC
RS2_CYTH3       ---DLLDAGVHFGHLTRKWNPKMAPYIFME---K--NGI-H-LIDLNKTLVC---LDEAN
RS2_FLAPJ       ---DLLEAGVHFGHMTRKWDPNMAPYIYME---R--NGI-H-IINLYKTAAK---IEEAN
RS2_GRAFK       ---ELLDAGVHFGHLTRRWNPNMAPYIYME---R--NGI-H-IINLYKSAAK---MQEAG
RS2_PORGI       ---QLLEAGAHFGHLKRKWNPAMAPYIFME---R--NDI-H-IIDLHKTVAK---VDEAA
RS2_BACV8       ---TLLEAGCHFGHLKRKWNPSMAPYIFME---R--NGI-H-IIDLHKTVAK---VDEAA
RS2_PARD8       ---QLLEAGVHFGHLKRKWNPAMAPYIFME---R--NGI-H-IIDLYKTVAK---VDEAA
RS2_NEOSM       ---NLFEVGAHLGHKTRFWNPKMVSYIYGT---S--NAKTH-IVDLQKTVPM---LRTAL
RS2_ORITB       ---ELLDAGIHYGHKASRWNPKMAPYIYGK---R--DDV-H-IINLDYTVSQ---IDVIS
RS2_DICNV       ---DLFEAGAHFGHRARFWNPKMAPYIYGK---R--GDI-H-IINLEQTVPM---LNDAL
RS2_RUTMC       ---KMLEAGVHFGHRSRFWSPKMGRFIYGT---R--NGV-H-IINLEKTLPL---FNDAL
RS2_FRAP2       ---EMLSAGVHFGHKKAFWNPQMKEYIFGI---N--HGV-H-IINLEKTVPL---FQDAV
RS2_COXBR       ---QLLEAGVHFGHQTRYWNPKMAPYIYGA---R--QKI-H-IINLEETLPA---FRDAL
RS2_LEGPH       ---ELLEAGAHFGHRTRFWNPKMSEYIFGS---R--NKI-H-IINLEKTLPM---LSDVT
RS2_METCA       ---QMLEAGVHFGHQTRYWNPKMAPFIFGA---R--SNI-H-IINLEKTLPL---FNDAM
RS2_BORA1       ---EMLEAGVHFGHQTRYWNPKMAPYIFGH---R--NKI-H-IINLEQTVAK---YQEAT
RS2_POLAQ       ---QMLEAGCHFGHQTRFWSPKMAPFIFGH---R--NKI-H-IINLEKTLPM---FQDAL
RS2_CHRVO       ---QMLEAGVHFGHQTRFWNPKMAKYIFGS---R--NKI-H-IINLEKTLPL---FVEAQ
RS2_RHOFT       ---EMLEAGVHFGHQTRFWNPKMAPFIFGH---R--NKI-H-IINLEKSLPM---FQEAA
RS2_NITEC       ---QMLEAGVHFGHQTRFWNPKMAPYIFGQ---R--NKI-H-IVNLEHTLVM---FRDAL
RS2_NITMU       ---QMLEAGVHFGHQTRFWSPKMAPYIFGH---R--NKI-H-IINLEKTLVM---YQEAM
RS2_THIDA       ---QMLEAGVHFGHQTRFWNPRMAPFIFGH---R--NKI-H-IVNLEKSLPM---FQEAQ
RS2_JANMA       ---EMLEAGVHFGHQTRFWNPKMAPFIFGH---R--NRI-H-IVNLEKTMGM---YQEAM
RS2_DECAR       ---EMLEAGVHFGHQTRFWSPKMAPYIFGA---R--NKI-H-IVNLEKTLAK---YNEAM
RS2_XYLFT       ---QMLEAGVHFGHQTRYRHPKMSPNIFGA---R--GKI-H-IINLEKTVPL---FNDAM
RS2_WIGBR       ---DMIQSGVHFGHQTRYWNPNMKPFIFCK---K--NKV-H-IINLEKTLIM---FEIAM
RS2_BUCCC       ---NMIKAGVHFGHQTRYWNPKMKPFIFGI---K--NKV-H-IINLEKTLPL---FRLAI
RS2_BLOPB       ---DMLQAGVHFGHQTRYWNPKMKPFIFGV---R--NKI-H-IIDLETTSVM---FRQAL
RS2_IDILO       ---DMLKAGVHFGHQTRFWNPKMKPYIFGA---R--NKI-H-IINLEKTVPM---FNDAL
RS2_BUCBP       ---DMLNAGVHFGHQTRYWNPKMKPFIFGS---K--NKV-H-IINLEKTMTM---FNFAL
RS2_BAUCH       ---DMFHAGVHFGHQTRYWNPRMKPFIFGV---R--NKI-H-IINLEQTAPM---FNNAL
RS2_PSEA6       ---DMLQAGVHFGHQTRYWNPKMKPFIFGA---R--NKV-H-IINLEKTVPL---FNNAL
RS2_ECOLI       ---DMLKAGVHFGHQTRYWNPKMKPFIFGA---R--NKV-H-IINLEKTVPM---FNEAL
RS2_NITOC       ---QMLEAGVHFGHQARYWNPKMAPYIFGK---R--NNI-H-IINLEETLPL---YMEAT
RS2_ALKEH       ---DMLEAGVHFGHQTRYWNPKMAPYIFGQ---R--NKI-H-IINLEKTLPL---YQEAM
RS2_HALHL       ---QMLEAGVHFGHQTRFWDPKMRPYIFGE---R--NKI-H-IINLEKTLPL---YKDAL
RS2_ACIAD       ---DLLQAGAHFGHQTRFWNPKMRQYIFGA---R--NKI-H-IINLEHTVPA---LNDAL
RS2_HYDCU       ---QMLEAGVHFGHQTRYWNPKMGEYIFGA---R--NKI-H-IVNLEKTLPM---FNDAL
RS2_CHRSD       ---DLLKAGAHFGHQTRYWNPKMSKYIFGA---R--NKI-H-IINLEHTLPA---LNDAL
RS2_ALCBS       ---DMLKAGVHFGHQTRYWNPKMNTYIFGA---R--NKI-H-IINLEQTLPL---FNDAM
RS2_SACD2       ---DMLQAGVHFGHQTRYWNPKMGKYIFGA---R--NKI-H-IINLEHTVPA---FNEAL
RS2_PSEU5       ---DMLKAGVHFGHQTRYWNPKMDKYIFGA---R--NKI-H-IINLEKTLPM---FNDAL
RS2_MARMS       ---DLLLVGSHFGHQTRYWNPKMKPFIFGA---R--NKI-H-IINLEHTVPA---LNNAL
RS2_DEIRA       ---QLLEAGVHFGHETKRWNPKFKKFIFAE---R--NGI-F-IIDLQKTLKQ---VDRSF
RS2_THET8       ---ELLEAGVHFGHERKRWNPKFARYIYAE---R--NGI-H-IIDLQKTMEE---LERTF
RS2_RICBR       ---DLLDAGVHFGHKTSRWNPKMAPYIYGE---R--DEV-H-IIDLRQTAAL---MNVAL
RS2_WOLTR       ---DLARSGVHFGHKISRWNAKMAPYIYGV---HQENRI-H-IIDLRKTLPL---LQAAM
RS2_EHRRW       ---DLVECGVHFGHKTSRWNPKMAPYIYGV---H--NDI-H-IINLQSTVFL---LKNAL
RS2_ANAPZ       ---DLMEAGVHLGHKAGRWNPAMAPYIYGV---HRYKDI-H-IIDLRKTAVL---LRNAL
RS2_ANAMM       ---DLVEAGVHLGHKAGRWNPAMAPYIYGV---HKYKDI-H-VIDLRKTLVL---LRDAL
RS2_RUBXD       ---ELLEAGVHFGHQAKRWNPKMKRYIFAE---R--AGV-H-IIDLDQTLDL---LERAL
RS2_TROWT       ---NLLDNGVHFGHTTQRWNPKMKGFILTE---R--CGS-Y-ILDMRETIRG---IVTAV
RS2_BIFLO       ---DMLKAGLHFGHQTRRWNPKMKQFILTQ---R--NGI-H-IINLFKSLDM---IDKAY
RS2_SALTO       ---QLLESGVHFGHQTRRWNPKMKRFIFTE---R--NGI-Y-IIDLRQTLDY---IEKAY
RS2_CLAMS       ---QLLDCGVHFGHPKTRWNPKMKRFIFTE---R--SGI-Y-IIDLQQSLAL---IDKAY
RS2_LEIXX       ---QLLDSGVHFGHQTRRWNPKMKRFILTE---R--SGS-Y-IIDLQQSLTY---IDKTY
RS2_FRAAA       ---QLLESGVHFGHQTKRWNPKMKRYIFTE---R--NGI-Y-IIDLQQTLSY---IDRAY
RS2_RHOJR       ---QLLDSGTHFGHQTRRWNPKMKRFIFTD---R--NGI-Y-IIDLQQTLTY---IDKAY
RS2_COREF       ---ELLDAGVHFGHQTRRWNPKMRRFIFTE---R--NGI-Y-IIDLQQTLTY---IDQAF
RS2_CORJK       ---ELLDAGVHFGHQTRRWNPKMKRFIFTD---R--NGI-Y-IIDLQQTLTY---IDEAY
RS2_NOCSJ       ---QLLESGVHFGHQTRRWNPKMKRFIMTE---R--NGI-Y-IIDLQQSLAY---IDRSY
RS2_KINRD       ---QLLESGVHFGHQTRRWNPKMKRFLFTE---R--NGI-Y-IIDLQQSLSF---IDRAY
RS2_RENSM       ---QLLNSGVHFGHQTRRWNPKMKRFILTE---R--NGI-Y-IIDLQQSLSY---IDRAY
RS2_CUTAK       ---QLLESGVHFGHQTRRWNPKMKRFIFTE---R--NGI-Y-IIDLHQSLTY---IDKAY
RS2_THEFY       ---QLLESGVHFGHQTRRWNPKMKRFIFTE---R--NGI-Y-IIDLQKSLSY---IDRAY
RS2_ZYMMO       ---SLLDVGAHFGHQTHRWNPKMKPYIFGD---R--NGI-H-IMDLSQTVPL---FTRAL
RS2_ERYLH       ---QLIEAGSHFGHQTHRWNPRMKPYIFGA---R--NGV-H-IIDLSQTVPL---MARAL
RS2_ROSDO       ---QLLEAGVHFGHQTQRWNPRMGPFIYGA---R--NGI-H-IMDLTQTVPM---LDQAL
RS2_PARDP       ---QLLEAGVHYGHQTQRWNPRMAEFIYGE---R--NGI-H-IVDLTQTVPM---LDAAL
RS2_ACICJ       ---QLLEAGVHFGHNTRRWNPRMAPFLFGV---R--NQV-H-IIDLQQTVPM---LERAL
RS2_MAGSA       ---QLVEAGVHFGHNTRRWNPKMASYLFGI---R--NGI-H-IIDLQQSVPM---LHRAM
RS2_RHORT       ---QLIEAGCHFGHNTRRWNPKMAPYLYGQ---R--DNV-H-IIDLQQTVPM---LYRAM
RS2_HYPNA       ---QLLEAGVHFGHQTHRWNPRMKPYIYGE---R--SGI-H-IMDLSHTVPA---LHQSL
RS2_MARMM       ---QLLEAGCHFGHQTHRWNPKMKDFIFGE---R--SNI-H-IIDLSQTVPL---LHQAL
RS2_METRJ       ---QLLEAGAHFGHQAHRWNPKMQPYIFGT---R--NNI-H-IIDLAQTVPA---MHQAL
RS2_BEII9       ---GLLESGAHFGHQAHRWNPKMAPYIFGA---R--NNI-H-IIDLAQTVPL---LHQAL
RS2_RHOP5       ---QLLEAGVHFGHQSHRWNPKMAEYIFGA---R--NNI-H-IIDLAQTVPL---LHNAL
RS2_AZOC5       ---QLLEAGVHFGHQSHRWNPKMSQYIFGV---R--NNI-H-IIDLSQTVPA---LHRAL
RS2_CAUSK       ---QLLEAGAHFGHQTHRWNPKMDRYIFGS---R--SNI-H-IIDLSQSIPL---LHQAL
RS2_PARL1       ---QLLEAGVHFGHQTHRWNPKMEPFLFGD---R--NNI-H-IIDLAQTVPL---LHQAL
RS2_BARBK       ---QLLEAGVHFGHQTQRWNPKMARYIYGQ---R--NNV-H-IIDLSQTVPL---LYQAL
RS2_CHESB       ---QLLEAGVHFGHQTHRWNPKMTPYIFGE---R--NNI-H-IIDLSQTVPL---LHQAL
RS2_DEHM1       ---ELLEAGAHFGHQTSRWHPRMKKYIFTK---R--NGI-H-IIDLEKTVVM---LDKAC
RS2_BDEBA       ---EMLDAGVHFGHQTQRWNPKMKPYVYTA---R--GGI-H-IIDLQKTVVR---ANKAA
RS2_SULDN       ---DLLECGVHFGHQTRRWNPKMKKYIFGV---R--KNI-Y-IIDLQKTLRY---FRNTY
RS2_CAMHC       ---DLLECGVHFGHQTRRWNPKMKKFIFGE---R--KGI-Y-IIDLQKTIRY---FRYTY
RS2_SULNB       ---DLLECGVHFGHQTRRWNPKMKKFIFGA---R--KNI-Y-IIDLQKTLRY---FKYTY
RS2_ARCB4       ---DLLECGVHFGHQTRRWNPKMKKFIFGV---R--KNI-Y-IIDLQKTLRY---FRYTY
RS2_NITSB       ---DLLECGVHFGHQTRRWNPKMKPFIFGV---R--KNI-H-IIDLQKTLRY---FRYTY
RS2_HELPY       ---DLLECGVHFGHQTRRWNPKTKKFIFGV---R--KNI-H-IIDLQKTLRY---FRYTY
RS2_WOLSU       ---DLLECGVHFGHQTRRWNPKMKKYIFGV---R--KNI-H-IIDLQKTLRY---FRYTY
RS2_BORAP       ---SLLEAGVHFGHQVKRLDPRMKRFIFSE---R--NEI-H-ILDLQKTLQG---IKDSY
RS2_MAGMM       ---ELLEAGFHFGHQTKRWNPKMKRHIFGA---R--NGV-H-IINLQKSVVM---LRDAC
RS2_SORC5       ---SLLDAGVHFGHQTKRWNPKMRPFIYGA---R--NGI-H-IIDLDQTTRL---FKRAY
RS2_TREPA       ---NLLESGVHFGHQVRRWDPRMKKYIFAE---R--NGI-H-IIDLQKTITA---IREAY
RS2_LEPBJ       ---NLLETGVHFGHQTRKWNPKMAPYVFTA---R--NGI-H-IIDLQKTVQK---AKEAY
RS2_ROSS1       ---ALLESGAHFGHQTKRWNPKMRPYIFTA---R--NGI-H-IIDLQKTITG---LTEAY
RS2_CHLAA       ---ELLEAGAHFGHPTNRWNPKMKPYIFTA---R--NGI-H-IIDLQKTVTG---LSRAY
RS2_DESAG       ---GMLETGVHFGHQTRRWNPKMGTYIFGA---R--NGI-H-IIDLQQTVKL---FRTAH
RS2_LAWIP       ---QMLETGVHFGHQTRRWNPKMRPYIFGA---R--NGI-H-IIDLQQTVKL---YRAAH
RS2_ONYPE       ---QLLESGVYFGHATRKWNPKMKPYIFTS---R--NGI-H-IINLKKTSEE---IEKAY
RS2_DESPS       ---DMLQAGLHFGHQTRRWNPKMKPYIYGP---R--NGI-Y-IVNLDLTKRL---FDKAC
RS2_PETMO       ---QLLEAGAHFGHRTRRWNPKMQPYIFTA---R--KGI-H-IIDLQKTLKS---IDEAY
RS2_ANADF       ---QLLEAGVHFGHQTKRWNPKMKPYIFGA---R--NGI-Y-IIDLQKTVGL---ARGAL
RS2_MYXXD       ---QLLEAGVHFGHQTKRWNPKMKPFIFGA---R--NGI-Y-IIDLQKTVVM---ARSAF
RS2_PELPD       ---ELLEAGVHFGHQTKRWNPKMKPYIFGA---R--NGI-Y-IIDLQKTVRY---FKSAY
RS2_PELCD       ---QLLEAGVHFGHQTKRWNPKMKPYIFGA---R--NGI-Y-IIDLQKTVRY---FKSAY
RS2_KORVE       ---ELLEAGVHFGHQTKRWNPKMKEYIFGE---R--NGI-Y-IIDLQKTLKM---FKEAS
RS2_SOLUE       ---ELLEAGVHFGHQTKRWNPKMKEYIFGE---R--NGI-Y-IIDLQKTLKM---FKDAA
RS2_FUSNN       ---QLLEAGVHFGHQAKRWNPKMAKYIFTE---R--NGI-H-VIDLHKSLKK---IEEAY
RS2_AQUAE       ---ELLEAGVHFGHSKSRWNPKMAPYIYGV---R--HGI-H-IIDLNKTIVM---LEDAY
RS2_SYNFM       ---QLLEAGVHFGHQTRRWNPKMKTYIFGA---R--NGI-Y-IIDLQRTVRL---FHTAY
RS2_ACHLI       ---QLLESGVHFGHQTRRWNPKMAPYIFTS---R--KDI-H-IIDLKRTALE---IEKAY
RS2_SYNAS       ---QLLEAGVHFGHQTNKWNPKMKPYIFGA---R--NNI-Y-IIDLQQTVGL---FQNAY
RS2_PSELT       ---QLLEAGVHFGHRTRRWNPKMAPYIYGA---R--KGI-Y-IIDLQKTLKL---VEEAC
RS2_THEMA       ---QLLEAGVHFGHRTRRWNPKMAPYIYTE---R--KGI-Y-IIDLQKTQQL---LEEAY
RS2_THEM4       ---QLLEAGVHFGHRTQRWNPKMKEYIFGA---R--KGI-Y-IIDLQKTSKL---LEEAY
RS2_FERNB       ---QLLEAGVHFGHRTQRWNPKMKPYIYGA---R--KGI-Y-IIDLQKTVKL---IDEAY
RS2_OENOB       ---ELLEAGAHFGHQTRRWDPRMDEYIFTS---R--NGI-H-IIDLQKTLRM---ADDAY
RS2_LACP7       ---QLLEAGVHFGHQTRRWNPKMAEYIYTE---R--NGI-Y-IIDLQKSVGK---VDEAY
RS2_LEUCK       ---ELLEAGVHFGHQTRRWDPKMDEYIFTE---R--NGI-H-IIDLQKTVKL---VDEAY
RS2_LACH4       ---QLLEAGVHFGHQTRRWNPKMAPYIFTQ---R--NGI-Y-IIDLQKTIKM---LDDAY
RS2_PEDPA       ---QLLEAGVHFGHQTRRWNPKMKPFIFTE---R--NGI-Y-IIDLQKTVKL---IDNAY
RS2_LACRD       ---QLLEAGVHFGHQTRRWNPKMEEYIFTE---R--NGI-Y-IIDLQKTVKL---IDTAY
RS2_OCEIH       ---QLLEAGVHFGHQTRRWNPKMKKYIFTE---R--NGI-Y-IIDLQKTVKK---VDEAY
RS2_STAS1       ---QLLEAGVHFGHQTRRWNPKMKRYIFTE---R--NGI-Y-IIDLQKTVKK---VEEAY
RS2_LYSSC       ---QLLEAGVHFGHQTRRWNPKMKKYIFVE---R--NGI-Y-IIDLQKTVKK---LEEAY
RS2_STRTD       ---QLLEAGVHFGHQTRRWNPKMAKYIFTE---R--NGI-H-VIDLQQTVKM---VDTAY
RS2_ENTFA       ---QLLEAGVHFGHQTRRWNPKMKKYIFTE---R--NGI-Y-IIDLQKTVKL---VDAAY
RS2_SYMTH       ---QLLEAGVHFGHQTRRWNPKMKEYIFTE---R--NGI-Y-IIDLQKTVRM---VEIAY
RS2_CALS4       ---QLLEAGVHFGHQTRRWNPKMAPYIFTE---R--NGI-Y-IIDLQQTVEK---LEQAY
RS2_SYNWW       ---QLLEAGVHFGHQTRRWNPKMATYIYME---R--NGI-Y-IIDLQQTVKK---FDAAY
RS2_CLOK5       ---QLLESGVHFGHQTRRWNPKMASYIFTE---R--NGI-Y-IIDLQKTVRK---IEEAY
RS2_HUNT2       ---QLLEAGVHFGHQTRRWNPKMAEYIFTE---R--NGI-Y-IIDLQKTVKK---VEEAY
RS2_CARHZ       ---QLLEAGVHFGHQTRRWNPKMAEYIFTD---R--NGI-Y-IIDLQKTAKK---LEEAY
RR2_EUGGR       ---KMLNSSVHLGHKVKQWNPRMRIYIYGE---R--KGL-H-IIDLLQTIVC---LKKAC
RR2_CYACA       ---ELLDASAHIGHSTSKWNPKFFPFIHMT---K--KGI-H-IIDLIKTIQQ---ISVAC
RR2_CHLVU       ---DMIQSGMHFGHSTREWNPRMAPYIYGE---R--NGR-H-ILDLVQTYYL---LNKVL
RR2_OLTVI       ---EMVQVGMHFGHQSRKWNPKMAPFIYTE---R--NGI-H-IIDLIQTHAY---LKQVS
RR2_TUPAK       ---QMVAAGMHFGHQARKWNPKMKPFIYAQ---K--DSI-H-IIDLISTYTH---LNEAS
RR2_NEPOL       ---QMLDVGVHFGHQARKWNPKMAPYIFGE---R--KGI-H-ILDILQTAIL---LDKAR
RR2_CYAM1       ---QLLEAGVHLGHQAKRWNPKMLPYLYTQ---R--MGI-H-IIDLVQTAHL---LNQAC
RR2_PHATC       ---QLLEAGVHFGHKAYRWNPKMFPYIYSE---V--NNI-H-ILDLVQSATL---LKEAN
RS2_GLOVI       ---QMLEAGVHFGHQTRRWNPKMRRYIFTD---R--NGI-H-IIDLTQTAHL---LDEAY
RR2_CHLAT       ---EMMEAGVHFGHQTRGWNPKMAPYIYGE---R--NGI-H-LIDLIQTARL---LSEAS
RR2_EMIHU       ---ELLDAGVHFGHQASRWNPKMFPYIYAE---R--NGI-H-VIDLVQTARL---LTHAY
RS2_SYNJA       ---QLLEAGVHFGHKASRWNPKMRPYIFAE---R--NGI-H-IIDLVQTARY---LNEAY
RR2_RHDSA       ---ELLEAGVHFGHQSRRWNPKMFPYIYAE---R--NGI-H-IIDLVQTAQL---LTQAC
RR2_PYRYE       ---ELLEAGVHFGHQARRWNPKMFPYIYTE---R--NGI-H-IIDLVQTAQL---LTEAC
RR2_GRATL       ---ELLEAGAHFGHQARRWNPRMFPYIYTE---R--NGI-H-IIDLVQTAQL---LTEAC
RS2_SYNR3       ---EMMEAGAHFGHQTRRWNPKMQRYIHCA---R--NGV-H-IIDLVQTAVC---MNNAY
RS2_SYNY3       ---DLLESGVHFGHQTRRWNPRMDQYIYTA---R--NGV-H-IIDLVQTAQL---MEDAY
RS2_MICAN       ---ELLESGVHFGHQTRRWNPKMSQYIYTA---R--NGV-H-IIDLVQTAQL---IEEAY
RR2_CYAPA       ---EMLEAGVHFGHQSRRWNPKMSQYIFTE---R--NGI-H-IIDLVQTAQL---LAEAY
RS2_THEEB       ---QMLEAGVHFGHQARRWNPRMAPYIFTV---R--NGV-H-IIDLVQTAQL---VEEAY
RS2_SYNE7       ---EMMESGVHFGHQTRRWNPRMAPYIYTA---R--NGV-H-IIDLVKTAQC---VETAY
RS2_ACAM1       ---QMLESGVHFGHQARRWNPKMDPYIFTE---R--NGV-H-IIDLVQTAQL---MDEAY
RS2_TRIEI       ---QLLESGVHFGHQTRRWNPRMSQYIFTE---R--NGV-H-IIDLVQTAQL---MDEAY
RR2_CHAVU       ---EMLEAGVHFGHQSHKWNPRMAPYIFSE---R--KGV-H-IIDLIQTSNL---LHEAC
RR2_ZYGCR       ---QMMEAGVHFGHQARKWNPKIAPYLLKD---T--KKI-R-IIHITHTARL---LADAC
RR2_CRYJA       ---EMVKVGVHFGHETRKWNPKMAPYIFKE---R--KDN-H-ILNLTYTARF---LSEAC
RR2_CHAGL       ---DMMEAGVYLGHQARKWNPKMAPYIFAE---R--KGI-H-IINLTQTARF---LTEAC
RR2_PELHO       ---DMVAARVHLGHDIKKRNPRMAPYISAK---L--KDT-D-ITNLKKTARF---LSETC
RR2_PSINU       ---EMLKAGVHFGHQTRKWNPKMAPHIFME---R--KGV-H-ILNLIQTARF---ISEAC
RR2_ANEMR       ---EMMEAGIHFGHQVRKWNPKMAPFIFTE---R--KSV-H-IINLTQTARF---LSEAC
RR2_CUSOB       ---DMLEARVHLGHSTQNWNPKMAPYISAK---R--KGI-H-IINLTRTARF---LSEAC
RR2_ADICA       ---GMMAAGIHFGHQTQRWNPKMSPYIFTE---R--KGV-H-ILDLTQTARL---LSEAC
RR2_TRACE       ---EMMDASVHLGHDTKQWNPKMAPYIFPKCTTR--KGI-H-LTNLFTTARF---LSEAC
RR2_MAIZE       ---EMIEAGVHFGHGIKKWNPKMAPYISAK---R--KGT-H-ITNLARTARF---LSEAC
RR2_STAPU       ---EMMEAGVHFGHQTRKWNPKMAPYIFTK---R--RGI-Y-ILHIFKTARL---LAEAC
RR2_ANGEV       ---EMMEAGIHFGHRTQKWNPKMSPYIFTE---R--KGV-H-ILNLTQTARF---LSEAC
RR2_HUPLU       ---EMMEAGVHSGHQARKWNPKMAPYIFAE---R--KGI-H-IINLTRTARF---SSEAC
RR2_ANTAG       ---EMMEAGIHFGHQAAKWNPKMKPYIFTE---R--RGI-H-ILNVTKTARL---LSEAC
RR2_CYCTA       ---EMMEAGVHFGHQARKWNPRMAPYIFTE---R--RGI-H-IINLTRTARF---LSEAC
RR2_EPIVI       ---EMIGAGVSFGHGTRKWNPKMAPYISVK---H--KGI-H-FTNLTKTARF---LSEAC
RR2_PHAVU       ---EMMEAGVHFGHGTRKWNPKMSPYISAN---R--KGI-H-ITNLIRTARF---LSESC
RR2_AMBTC       ---EMMGAGVHFGHGTRKWNPRMAPYISGK---R--KGI-H-ITNLTRTARP---LSEAC
                    :       *       .     :                                 

RS2_UREP2       KFL--QEV-----SQNG--GTVMFVGTRGRV-VKELIKAEAERTNS------FYVTQRWL
RS2_MYCPE       NFL--LDLVKANSNSES--SPVLIVGTRGKT-IKNHVKEQAKRSHA------FYINERWL
RS2_MYCPN       NYV--KEV-----AQNN--GQILFVGTKNDY-VKKLVNNIAKRVDV------AFITQRWL
RS2_MYCGA       NYL--TEA-----AKAK--KNILFVGTKSKA-VQELIQSIAERTNS------FYINQRWL
RR2_STIHE       WYL--TKY-----AYKR--KNILFVGTAIPS--ARYVATTALKTKS------FFVNFRWL
RR2_EUGLO       NFI--KKL-----SIEG--KKILFVSARMLI--VDKLKHFANVTKS------FYITEDWL
RS2_MYCAP       NIL--NKF-----VAKNPRTTFIFVGTKKQA--KDTIKDNALRTGS------FYVSERWL
RS2_MYCPU       KII--NAA-----AAKG--ATFIFVGTKKHA--KEIVKEQAQRTNS------YYVTERWL
RS2_MYCH7       KLV--EKF-----AQKG--AKFIFVGTKKQA--KKVVEEQAVRTNS------IYVSGRWL
RS2_MYCMO       KLI--EKY-----AQKG--ASFIFVGTKKQA--KDVVKAQALRTNS------IYVSERWL
RS2_MYCS5       SLV--EKL-----AAKG--VSFIFVGTKRQA--KKTVKEAAERTNS------LYVSERWL
RR2_PLETE       AFL--EKE-----ALKG--KKFLFVGTQTHS--SVVVKKTAIRTNS------FFVNEKWL
RS2_OPITP       TFL--EDT-----VGNG--GNVLFVGTKRQA--KDIIREAATSTNM------PFCVDRWL
RS2_PARUW       DIV--RDV-----VAKH--KSILFVGTKKQA--KAVLRELSEQCGE------FYVCERWL
RS2_CHLMU       SCI--QKT-----VEQG--KSILFVGTKKQA--KQIIKEAAIECGE------FFASERWL
RS2_CHLPN       PHI--RKV-----IQDN--KTVLFVGTKKQA--KCVIREAAIEAGE------FFIAERWL
RR2_BIGNA       KLVYSKSL-----TDNY--NTFLFVGTKKQSPIPNSIFYHASRCNS------FYINNKWL
RR2_OSTTA       TAF--KSA-----------KNVIFVGTRPAI--APLIEQVATKTGS------NYVNTRWV
RS2_RHOBA       KYL--SQV-----AAGG--SLILFVGTKRQA--GEAVEEQSLRCGM------PFVSERWL
RS2_MESFL       KLV--QSI-----GAKG--EKVLFVGTRRSA--KLAVKEAALRSGN------YYVNQRWL
RS2_MYCCT       KLL--EFL-----GSKQ--QKILFVGTKRSG--KNAVKEAALRSGN------FYINNRWL
RS2_SALRD       EAA--KRF-----ARRG--KKILFAGTKKQA--EDIVREHAEECGM------PHMVDRWL
RS2_CHLTE       KAI--EAI-----ASTG--REIMLVGTKKQA--KVIIAEQAERAGM------PYVCERWL
RS2_SULMW       KFI--KNI-----VSSG--KKILFVATKKQA--KDIVSDYAKKVNM------PYITERWL
RS2_CYTH3       AAL--KTI-----VRSG--RKVLFVATKKQA--QEVVTAEAKRLKM------PYATERWL
RS2_FLAPJ       EAL--KKI-----AASG--RKILFVATKKQA--KDIVAEKAAAANM------PYITERWP
RS2_GRAFK       DAL--AKI-----AASG--RKILFVATKKQA--KEIVAEQAEKANM------PYITERWP
RS2_PORGI       EVI--KGM-----AKNG--KKILFVATKKQA--KEPIAELAKSVGM------PYVVERWP
RS2_BACV8       DAL--KQI-----AKSG--KKVLFVATKKQA--KQVVAEKAASVNM------PYVIERWP
RS2_PARD8       EVM--KNL-----AKQG--KKVLFVATKKQA--KQVVADKAASVGM------PYVIERWP
RS2_NEOSM       NAI--SDV-----AANS--GRVLFVGTKMQA--CDIIKEEATRCGQ------YYVNLRWP
RS2_ORITB       KVIY-KEI-----KEKN--GRILFVDTRRH---RDIVAQYAENCGQ------YYVTHRWL
RS2_DICNV       NFL--SAV-----VGNG--GRVMFVGTKRSA--SDAISEAASRCGM------PYVNFRWL
RS2_RUTMC       NFA--SKI-----TAVG--RSILFVGTKRAA--SNIIKQEAMRCGM------PYVNHRWL
RS2_FRAP2       NFV--GKT-----VANG--GKVLFVGTKRQA--QDIIEAEAKRCGM------PFVSHRWL
RS2_COXBR       KFV--KEV-----ASKR--GKVLFVGTKFAA--REIVKEEATRCGM------PYVDYRWL
RS2_LEGPH       NYV--SRL-----AANK--AKILFVGTKRAA--QDSIREHAKRCGM------PYVDHRWL
RS2_METCA       KYL--EQV-----AANR--GKILFVGTKKTM--RKVIEEEARRCGM------PYVNHRWL
RS2_BORA1       KFV--KQL-----AARG--GNILFVGTKRAA--RELVATEAERCGM------PFVDARWL
RS2_POLAQ       KFA--KQV-----ASNR--GTILFVGTKRQS--REIIAEEAARAGM------PYIDSRWL
RS2_CHRVO       EYV--RRL-----AANK--GTVMFVGTKRQA--REIVREEAARCGM------PFVDHRWL
RS2_RHOFT       KFA--SQV-----SARR--GTVLMVGTKRQA--RETVALEAQRAGV------PYVDQRWL
RS2_NITEC       DYA--RRL-----AANK--ETILFVGTKRQA--RDIVKEEAIRCGA------PYVNQRWL
RS2_NITMU       NYV--RQL-----AANK--GTILFVGTKRQA--RDIVREEAMRCGS------PFVDQRWL
RS2_THIDA       KFV--RQL-----SANK--GNVLFVGTKRAA--RDIVREEAQRAGM------PYVDQRWL
RS2_JANMA       KYI--RQL-----SSNR--GTVLFVGTKRQA--RETIAAEAQRAGM------PYVDQRWL
RS2_DECAR       AFV--KKL-----ASSR--GTILFVGTKRQA--REIIGEEALRAGA------PFVDQRWL
RS2_XYLFT       NFL--SAV-----AQKR--GSVLFVGTKRSA--RDAIKEEAERCGM------PYMIQRWL
RS2_WIGBR       NEL--SKI-----SKRD--GKILFIGTKRAA--SEAIKNSAINCNQ------FFVNYRWL
RS2_BUCCC       NEL--KKT-----IKFN--GKILFVGTKRSA--SAAIKSIALSCNQ------FYVNHRWL
RS2_BLOPB       IEL--NKI-----AALK--GKILFVGTKRAA--SESVKKTALACNQ------FFVNHRWL
RS2_IDILO       SYM--QHV-----ASNK--GKILFVGTKRAA--AEAVKEAAINCGQ------YYVNHRWL
RS2_BUCBP       FEL--KKI-----SLRK--GKILFVGTKQSA--SKIIKESAILCKQ------FYVNHRWL
RS2_BAUCH       FEL--NKI-----ASRK--GKILFVGTKRAA--SEAIKEAARSCDQ------FFVNHRWL
RS2_PSEA6       NYI--GSV-----ASKK--GKILFVGTKRAA--SDSVRDAAVKCDQ------FYVNKRWL
RS2_ECOLI       AEL--NKI-----ASRK--GKILFVGTKRAA--SEAVKDAALSCDQ------FFVNHRWL
RS2_NITOC       NYL--GRL-----AANK--GTVLFVGTKRAA--QEPVREEAGRCGM------PYVNSRWL
RS2_ALKEH       NYV--GRL-----AAEG--GKVLFVGTKRSA--RKAVREEASRCGM------PYVDHRWL
RS2_HALHL       NFA--GRL-----ASNG--GKILFVGTKRPA--RELVREHAARCGM------PYVDHRWL
RS2_ACIAD       NFA--NQL-----ASKK--NKVLFVGTKRAA--SNIIREQAQRAGQ------PYVDHRWL
RS2_HYDCU       NFL--GGI-----AAKK--GTVLFVGTKRAA--GDLVAQEAKRCGM------PYVNHRWL
RS2_CHRSD       AVI--EKM-----VASN--NKILFVGTKRAA--SKIVKEEARRAGQ------PFVNHRWL
RS2_ALCBS       AFL--NKL-----AASN--NKILFVGTKRAA--QKAVSEEAQRCGM------PYVDHRWL
RS2_SACD2       AIV--KQL-----GSQK--KKVLFVGTKRAA--QKSIKEQAERSNM------PFVSHRWL
RS2_PSEU5       RFV--EKL-----AAGK--NKILFVGTKRSA--GKIVREEAARCGS------PYVDHRWL
RS2_MARMS       ELV--KKM-----AENK--NKVLFVGTKRAA--SKTIKEQAARSGM------PYVNHRWL
RS2_DEIRA       DYI--KDL-----AERG--GVILFVGTKKQA--QEIVELEARRTGM------PYVTSRWL
RS2_THET8       RFI--EDL-----AMRG--GTILFVGTKKQA--QDIVRMEAERAGM------PYVNQRWL
RS2_RICBR       NAI--YET-----VKND--GKVLFVSTKIQA--SDIIAEYAEKCGQ------YYVNHRWL
RS2_WOLTR       KVL--YNV-----AFQG--GRILFVGTKFQA--LDIIASEAIRCGQ------YYVNYRWL
RS2_EHRRW       SAL--YDI-----VLKR--GRVLFIGTKVQA--SAIIADEATRCGQ------YYINNRWL
RS2_ANAPZ       SVL--YDV-----VHRR--GRVLFVGTKVQA--SNVIAEEAARCGQ------YYVNHRWL
RS2_ANAMM       SVL--YDV-----VLKR--GRVLFVGTKVQA--SNIVAEEATRCGQ------YYVNHRWL
RS2_RUBXD       NFI--RGV-----AEAG--QDVLFVGTKKQA--QITIAEQAIRCGQ------PYVAERYI
RS2_TROWT       DFI--RDT-----VARG--GEVLFIGTKRQA--QQVIFKQASRVGQ------HYIAHRWL
RS2_BIFLO       DFI--KTT-----VAHN--GTVLFVGTKKQA--QEAIANQATRVNM------PYVSERWL
RS2_SALTO       EFV--RGT-----VAEG--GSILFVGTKKQA--QEAIAEQATRVGQ------PYVNHRWL
RS2_CLAMS       DFV--KET-----VAHG--GTILFVGTKKQA--QESIAEQAQRVGQ------PYVNQRWL
RS2_LEIXX       DFV--RET-----VAHG--GTILFVGTKKQA--QQAIAEQATRVGQ------PYVNQRWL
RS2_FRAAA       DFV--KET-----VAHG--GTVLFIGTKKQA--QEAIEEQAARVGM------PYVKERWL
RS2_RHOJR       EFV--KET-----VAHG--GTVLFVGTKKQA--QESIAAEATRVGM------PYVNQRWL
RS2_COREF       EFV--KET-----VAHG--GTILFVGTKKQA--QEAVQVEAERVGM------PYVNHRWL
RS2_CORJK       EFV--KET-----VAHG--GNILYVGTKKQA--QEAVANEAERVGM------PYVNHRWL
RS2_NOCSJ       AFV--KET-----VAKG--GTIMFVGTKKQA--QEAIAEQATRVGM------PYVNQRWL
RS2_KINRD       DFV--KET-----VAHG--GSIMFIGTKKQA--QESIAEQARRVGM------PFVNQRWL
RS2_RENSM       EFV--KAT-----VAHG--GTVLFVGTKKQA--QEAIAEQSTRVGQ------PYVNHRWL
RS2_CUTAK       AFV--KET-----VAKG--GQILFVGTKKQA--QESIVEQATRVGM------PYVNQRWL
RS2_THEFY       EFV--KET-----VAHG--GTILFVGTKKQA--QEAIYEQARRVGM------PYVNQRWL
RS2_ZYMMO       DFI--SQT-----VAHG--GKVLFVGTKRQA--QEPIADAARRSGQ------FFVNHRWL
RS2_ERYLH       DFV--HAT-----ANAG--GKVLFVGTKRQA--QEPIAEAARSSGQ------HFVNHRWL
RS2_ROSDO       QAI--RDT-----VAKG--GSILFVGTKRQA--QQPIADAAEKCAQ------YYMNHRWL
RS2_PARDP       QVV--RDT-----VAKG--GRVLFVGTKRQA--QKAVADAAERSAQ------FYMNHRWL
RS2_ACICJ       REI--RNV-----TAGG--GRVLFVGTKRAA--AEHVAYAAKRCGQ------YYVNHRWL
RS2_MAGSA       QAV--RDV-----TAGG--GRVLFVGTKHQA--SDVVAESAKRCGQ------YFVNHRWL
RS2_RHORT       QAV--RDV-----TAGG--GRVLFVGTKRQA--QDVVAEHARRCGQ------YYVNHRWL
RS2_HYPNA       VFV--RDT-----VAKG--GRVLFVGTKRQA--QEPVAEAAQRCAQ------YYMNHRWL
RS2_MARMM       VKV--RET-----AAKG--GRVLFVGTKRQA--QDPLAQAAGRCAQ------YYMNQRWL
RS2_METRJ       QAV--SDT-----VAKG--GRVLFVGTKRQA--ADTIAEAAKRSAQ------YYVNSRWL
RS2_BEII9       KAI--SDT-----VARG--GRVLFVGTKRQA--QEAIADAAQRSAQ------YYVNSRWL
RS2_RHOP5       KAV--SDT-----VAKG--GRVLFVGTKRQA--QDVVADAAKRSAQ------YFVNSRWL
RS2_AZOC5       QAV--SDT-----VAQG--GRVLFVGTKRQA--QDQVADAARRSAQ------YYVNSRWL
RS2_CAUSK       VKV--REV-----AAAG--GRVLFVGTKRQA--SDPVATAAKRCAQ------YYVNHRWL
RS2_PARL1       VTV--RDV-----VAGG--GRVLFVGTKRQA--SDPVAAAARQCAQ------YYINHRWL
RS2_BARBK       KLV--SDT-----VVRG--GRVLFVGTKRQA--SDIIADAASRSAQ------YHVNARWL
RS2_CHESB       KVV--SDT-----VGRG--GRLLFVGTKRQA--SDIVADAARRSAQ------YYVNSRWL
RS2_DEHM1       NYI--NQV-----VSEG--GKVLFVGTKKQA--QEILAEEAKRCGM------YFINQRWT
RS2_BDEBA       EFV--KEI-----AANG--GRLIFVGTKKQA--IEPIQEAAAKCGQ------YYVTKRWL
RS2_SULDN       TIV--MDA-----AAEG--KTVLFVGTKKQA--RASVRDAAIACGM------PYVDNRWL
RS2_CAMHC       NIV--RDA-----AAEG--KTILFVGTKKQA--GAAIKEFAEKCEM------PYVNHRWL
RS2_SULNB       NVV--RDA-----AAEG--QTVLFVGTKKQA--RQAVKEHAERAGM------PYVATRWL
RS2_ARCB4       NVV--RDR-----AAEG--QTMIFVGTKKQA--SETIKKAAISCGM------PYVNHRWL
RS2_NITSB       NIV--RDA-----AKEG--KTILFVGTKKQA--KNAIEEYAKKCGM------PYVNSRWL
RS2_HELPY       NIV--RDA-----SAQG--KSIMFVGTKKQA--NETLKEFAESIQV------PYVNYRWL
RS2_WOLSU       NVV--RDA-----AAEG--KTVMFVGTKKQA--SETIKQYADTINA------PYVNYRWL
RS2_BORAP       ELV--QRV-----IKDG--KKVLFIGTKKQA--SEIIEQEARRSDM------PYVNNRWL
RS2_MAGMM       NFV--RDT-----VQGG--GTVLFVGTKRQA--VELVSAEARRTGQ------FYVNHRWL
RS2_SORC5       DFL--TDA-----VGRG--GHVLFVGTKRQA--QDIVQEEARRAGM------YFVTNRWL
RS2_TREPA       DMV--RRT-----VSSG--KSVLFVGTKKQS--QQTIAKEAQRCGM------FYVTNRWL
RS2_LEPBJ       DAL--KKL-----TSEG--KKVLFVGTKKQA--RGAIEREALHSNM------FFINNRWP
RS2_ROSS1       QFI--VET-----VAAG--QKVLFVGTKKQA--QETIAEEATRAGQ------FYVTQRWL
RS2_CHLAA       QFI--TEL-----TARG--EKVLFVGTKKQA--QEAVMEEAVRSGQ------FYINQRWL
RS2_DESAG       DKV--VDT-----VARG--GKVIFIGTKRQA--QEAVQTEAGRAGQ------YYVTNRWM
RS2_LAWIP       DKI--VET-----VAAG--GSVLFVGTKRQA--QEAIATEATRAGQ------YYVANRWM
RS2_ONYPE       QEL--LNI-----ITSG--GKALFLGTKKQI--QSAIREEAQRSQQ------YYVDHRWL
RS2_DESPS       EFI--SSN-----VKNE--GSVLFVGTKRQA--QSIIKEEARRCGQ------YYVDHRWL
RS2_PETMO       DFL--KNS-----VMEK--KRVLFVGTKKQA--QQIVADEARRCGE------FFVNNRWL
RS2_ANADF       RFV--SDA-----VAKG--GMVLFVGTKKQA--QDAIREEASRSGQ------YHVTNRWL
RS2_MYXXD       RFV--ADI-----TARG--GSVLFVGTKKQA--QDVVREEASRAGQ------FFVTSRWL
RS2_PELPD       NFV--KES-----VLNG--DTVLFVGTKKQA--QDSVCEEAQRCGM------HYVNQRWL
RS2_PELCD       QFI--RET-----VQNG--DKVLFVGTKKQA--QEAIREETARADQ------FYIDNRWL
RS2_KORVE       KFV--SDV-----AAEG--KLVLFVGTKRQA--QDAIAEEAKRCGM------FYINQRWL
RS2_SOLUE       RFV--GEM-----AAQG--KNVLFVGTKRQA--QEAIAEEANRCQM------YYVNQRWL
RS2_FUSNN       EEM--RKI-----AEDG--GKVLFVGTKKQA--QEAIKEQAERSGM------YYVNSRWL
RS2_AQUAE       HFV--SDV-----IAQG--GEILFVGTKKQA--KDIIKEEAERCGA------FYVNERWV
RS2_SYNFM       QFV--TQT-----VGSG--EHVLFVGTKQQA--RDTIAEEAQRCGM------YYINQRWL
RS2_ACHLI       AAL--YDI-----AKDG--GTVLFVGTKKQA--SEAIKEEAIRAGQ------FYVDHRWL
RS2_SYNAS       NFV--IDT-----VSEG--GEIMFIGTKKQS--QDSIHDEATRCGM------PYVNQRWL
RS2_PSELT       DFV--KSK-----ASEG--ATMIFVGTKKQA--QHVVKEEAGKCGA------FYVNNRWL
RS2_THEMA       YFV--REK-----ASEG--ATILFVGTKKQA--QGVIKAEAERCGA------FYVNNRWL
RS2_THEM4       NFV--RDK-----AAEG--GTILFVGTKKQA--QQVIKQEAERCGA------FYVNHRWL
RS2_FERNB       DFV--RDV-----ASKG--GTILFVGTKKQA--QQVVKNEAERCGG------FYVNNRWL
RS2_OENOB       NWV--KGE-----AADG--ANFLFVGTKKQA--TEAIEEEAKRAGV------AYVNHRWL
RS2_LACP7       YAI--KDV-----VANG--GKVLFVGTKKQA--QDSVKSEAERCGM------YYVNERWL
RS2_LEUCK       NFM--RNA-----STDG--ANFLFVGTKKQA--SDAIAEEAARAGQ------YFINHRWL
RS2_LACH4       NFM--KTV-----AEDG--GVFLFVGTKKQA--QDSIAEEATRAGQ------YYVNQRWL
RS2_PEDPA       NFV--KDV-----AAND--GVVLFVGTKKQA--QTAIEEEAKRAGQ------YFVNHRWL
RS2_LACRD       NYM--KDV-----AAND--GVALFVGTKKQA--QDAIEEEATRAGQ------YYVNHRWL
RS2_OCEIH       NYV--KEI-----ASNG--GTILFVGTKKQA--QDSVRDEAIRSGM------YFVNQRWL
RS2_STAS1       NFI--KQV-----SEDG--GKVLFVGTKKQA--QDSVKAEAERAGQ------FYVNQRWL
RS2_LYSSC       DFM--RQV-----GQDG--GKVLFVGTKKQA--QEAIKDEAERSGN------YYINQRWL
RS2_STRTD       EFV--REA-----AAND--AVILFVGTKKQA--AEAVAEEATRAGQ------YYINHRWL
RS2_ENTFA       DYM--KNV-----AEEG--GVALFVGTKKQA--QEAIKDEAIRAGQ------YYVNHRWL
RS2_SYMTH       NAV--RQM-----AADG--GKILFIGTKKQA--QDAVREEAERCGM------FYVNQRWL
RS2_CALS4       EFV--KKL-----VMDG--GTILFVGTKKQA--QESIKEEAERCGM------FYVNQRWL
RS2_SYNWW       EFV--KSV-----AAAG--KGVLFVGTKKQA--QETIREEASRCGM------YFVNQRWL
RS2_CLOK5       EFV--KKI-----ASEG--KDILFIGTKKQA--QEAIKEEAKRSNM------HYVNNRWL
RS2_HUNT2       YFL--REV-----AMNG--QGVLFVGTKKQA--QDSIREEAQRADQ------YYVNARWL
RS2_CARHZ       SFV--REL-----SAQG--GTILFVGTKKQA--QDAIKEEAERCGM------FYVNQRWL
RR2_EUGGR       NFL--IRS-----VRKG--KRALFVCTKRFF--SILTQKIALKCNS------FFVTKRWL
RR2_CYACA       MFL--KKE-----VRNG--KRVLFVGTKNQA--SKVVEREAKKCQE------FYINQRWP
RR2_CHLVU       AFL--EEQ-----AAQG--KTFLFVGTKQQA--APLIAKTALACES------FYVNQRWL
RR2_OLTVI       QFL--TES-----SAAG--KTILFVGTKKQA--SGLIAKVALQCNS------PYVNQRWL
RR2_TUPAK       KFL--TDS-----VSIG--QKILFVGTKKQV--SQLIAKAALECDS------FYVNGKWL
RR2_NEPOL       VYA--RRQ-----AASN--GSFLFVGTKNQA--ASIVRFAAERCQKNDRSQAHYVNHRWL
RR2_CYAM1       ETL--TVQ-----VSEG--KRVLFVGTKPQA--SVVVEEEATRCGE------FFINQRWL
RR2_PHATC       LYL--ESA-----AREN--KTFLFVGTKRQA--STLIAQEAKRCDS------YYVNHRWL
RS2_GLOVI       SYL--REA-----SDQG--KKILFVGTKRQA--APVIAQEAKRCGM------FWVNQRWL
RR2_CHLAT       DFV--LNA-----AKEG--KEFLFIGTKNQA--ADIISSEALRCRS------HFVNQRWL
RR2_EMIHU       EFV--QKA-----SQEK--KSFLFVGTKRQA--ASIIAEEAQRCGG------HYVNNRWL
RS2_SYNJA       EYV--REG-----AEKG--WRFLFVGTKRQA--AGIIAHEATRCGS------YYVNQRWL
RR2_RHDSA       DFV--RTA-----SEQG--KSFLFVGTKRQA--AAVVAQEAERCGA------YYVNQRWL
RR2_PYRYE       ELI--KQA-----SSDG--KKVLFLGTKRQA--AGIVAQEAQRCDS------YYVNQRWL
RR2_GRATL       QFI--RDA-----SQEG--KKFLFLGTKRQA--AGVIAEQAIRSNS------YYVNQRWL
RS2_SYNR3       KWV--RSA-----ARSG--KRFLFVGTKKQA--AEVVALEASRCGA------SYVNQRWL
RS2_SYNY3       EYV--RSS-----TING--KKFLFVGTKRQA--AGIISQEAQRCGA------HYVNQRWL
RS2_MICAN       EFV--RGE-----ADRG--KRFLFIGTKRQA--AAIIKQEALRSGS------HFVNQRWL
RR2_CYAPA       DFL--RIS-----AEEG--KKVLFIGTKRQA--ANIIAQEATRCGA------FYINQRWL
RS2_THEEB       NYI--RNA-----AEKG--KRFLFIGTKRQA--AGIVEQEALRCGS------YYVNQRWL
RS2_SYNE7       RWV--RTN-----AEQG--KRFLFVGTKRQA--AGIIAEEATRCGS------YYINQRWL
RS2_ACAM1       HYV--RSA-----SESG--KKFLFVGTKRQA--AGIIAQEAARCGG------YYVNQRWL
RS2_TRIEI       NYI--RTA-----SEQG--KKFLFVGTKRQA--AGIIAQEATRCGG------YYINQRWL
RR2_CHAVU       DFL--ANA-----ASNK--KEFLLVGTKFQA--SDLIKSEALKSRC------HYVNQRWL
RR2_ZYGCR       DFA--TNA-----AREG--KQFMLVGTRYQT--AGLVATTAKKARC------HYVNTKWL
RR2_CRYJA       DFV--FDG-----AKRG--KQFMIVGTKHQT--ADAAKLAALAARC------HYVNKKWL
RR2_CHAGL       DLL--FNT-----AKNG--EQFLIVGTKYQA--ADLVALTAKKSRC------HYVNQKWL
RR2_PELHO       DLV--FEA-----ASKG--KKFLIVGTKKEV--ANSVAQAARTAGC------HYVNQKWL
RR2_PSINU       DLV--YNA-----ASEG--KQFLLVGTKPRI--AHLISSAAIKARC------HYVNYKWI
RR2_ANEMR       DLA--ANA-----ASRG--KQFLIVGTKYQA--ADLVVSAASGARC------HYINQKWL
RR2_CUSOB       DLV--FYA-----ASKG--KKFLIVGTNNAA--DEAVARASKRARC------HYVNKKWL
RR2_ADICA       DLV--FDA-----AVEG--KEFLMVGTKNQV--TDLIVSAALKSQC------HYVNEKWL
RR2_TRACE       DVV--FNA-----ASRE--NQFLIVGTKKKA--ADSVLRAAIRAQC------HYVNKKWL
RR2_MAIZE       DLV--FDA-----ASQG--KSFLIVGTKKRA--ADLVASAAIRSRC------HYVNKKWF
RR2_STAPU       EFS--ANA-----ASQG--KQFLIVGTKYQA--ADLVSAAAKKARC------HYVNQKWL
RR2_ANGEV       DLV--FHA-----ANEG--KQFLIVGTKYQV--SDLIASAAIKARC------HYVNQKWL
RR2_HUPLU       DSV--ANV-----ASEG--KQFSMVGTKYQA--ADLTASAAIKARC------HYVNKKWL
RR2_ANTAG       DFV--ANA-----ASKG--KQFLIVGTKYQA--ADLVASAALKARC------HYVNQKWL
RR2_CYCTA       DLV--FDA-----AGKG--KQFPIVGTKYQA--ADSVASAAIKARC------HYVNKKWL
RR2_EPIVI       DLV--FYA-----ASRG--KQFLIVDTKNKA--ADSAAWAAIKARC------HCVNKKWP
RR2_PHAVU       DLV--FHA-----ASGG--KQFLIVGTKKKA--ADSVARAAIRARC------HYVNKKWL
RR2_AMBTC       DLV--FDA-----ASRG--KHFLIVGTKDKA--ADSVASAAIRARC------HYVNKKWL
                                          :             :                 : 

RS2_UREP2       GGTLTNFTNISRSLKKFNSNLALLE-SEEINK-Y-SKKEQIAINKETAKLEKFYGGIKNM
RS2_MYCPE       GGTLTNFSTITKSVAKFNNLILIHK-NGEINK-Y-TKKEQVELKKKTEKYAKYFSGIRTM
RS2_MYCPN       GGTLTNFKTLSISINKLNKLVEKQA-ENAADL---TKKENLMLSREIERLEKFFGGVKSL
RS2_MYCGA       GGTLTNFKTISNSINQLKRLIHTR--DNDLTK-Y-TKKEQIMIMKKLAKLERFFGGIKDM
RR2_STIHE       GGMLNNWKTLRKLLQKLKTLQKEQK-NKIWKN-L-PKKEGIARLKEKQRLEKYLKGIQMI
RR2_EUGLO       GGTFTNWITTKGCIDKLNYYSVDG--LKLYDS-L-TKRERLISRKQQSKLAKYYFGIKQM
RS2_MYCAP       GGTLTNASTIFKRVKVMEELEAQA--AKKFQG-Y-TKKEGLIKQKELDKLHKNLDGIRKM
RS2_MYCPU       GGTLTNSKTIFSRVRRLFDLEKMA--ENNFEG-Y-TKKEGIEFKKELSKLQKNFEGIREM
RS2_MYCH7       GGTLTNNRTILSRLKTMENLEKQA--AENFQG-Y-TKKEKLAKQKQLAKLQKNLNGIKGL
RS2_MYCMO       GGTLTNSRTIMNQVRTLSDLEKLE--ESGYEG-Y-TKKEGVEFSKKLAKLQRNLTGIRNM
RS2_MYCS5       GGTLTNNSVIMKRVQKMNELDKKA--EQGFKG-Y-TKKEALLLQKQLDKLHQNLDGIKNM
RR2_PLETE       GGMLTNWKTAKRLVRRLNFLLMLEK-TTYIQK-L-SKKERNDFKKEKNKLKKYFLGLRSM
RS2_OPITP       GGTLTNYETVKRSIAKYKKYQQMET-SGDMNK-L-ASKEVAAIKREMVRMQKNFSGIVDM
RS2_PARUW       GGMLTNLSTIRQSVKKLERIEKRIS-TGGEGL---TKKEISLLTKDQIKLEKNLSGVRSM
RS2_CHLMU       GGMLTNMATIRNSVKTLNNIEIDLASSNSV---L-TKKETALLAKRHRKLLNNLEGVRHM
RS2_CHLPN       GGMLTNMTTIRNSIKTLDKIEKDLSRNQAY---L-TKKEAALLAKRHQKLLRNLEGIRYM
RR2_BIGNA       SGMLTNWENTTRSINTLKYLKVYQK-TNMFSK-L-SMKTHSIIDKKKNRLEKYFGGIQNM
RR2_OSTTA       GGLLTNWTTMTMCLEKLGRLDAQLE-TATPKKGF-TKKDILSLTRERERLEKFFGGLRNL
RS2_RHOBA       GGTLTNFRTIRSRLGRLEELEALRAGDGINDY---SKKMQSSLNREYRKMYRNLNGLRTM
RS2_MESFL       GGTLTNFKTIVKRIKALWEIEESEK-NGQLAL-R-TKKEQILILKEKANLEKSLGGIKQM
RS2_MYCCT       GGTLTNLKTILIRIKALWEIEEEEK-KGRLSL-R-TKKEQIKILKEKAKLEKALGGIKQM
RS2_SALRD       GGTMTNFQTIRKSIRRMEEIERMDR-DGTLDK-L-KKKEKLMRLREHEKLEETLGGIRDM
RS2_CHLTE       GGMLTNFSTIRQSIRRMNAIERMET-DGTFDM-I-TKKERLMLIREKDKLVRILGGIANM
RS2_SULMW       GGILTNMSTIRQSVKKMNVIDRQKI-DGTYNM-M-SKKEKLLIDRLKNKLKKNIGSISKM
RS2_CYTH3       GGMLTNFATVRKSLKKMSSMEKMMK-DEAFSS-L-NKKERLVLSREKEKLEKVLGGIADL
RS2_FLAPJ       GGMLTNFVTIRKAVKKMSTIDRMKK-DGTFMT-L-SKKERLQVDRLRAKLEKNLGSISDM
RS2_GRAFK       GGMLTNFVTIRKAVKKMASIDRMKK-DGTFNS-L-SKKERLQVDRLRAKLEKNLGSISDM
RS2_PORGI       GGMLTNFPTIRKAVKKMTQIDKMTA-DGTFDN-L-SKREKLQITRQRAKLEKTLGSIADM
RS2_BACV8       GGMLTNFPTIRKAVKKMATIDKLTN-DGTYSN-L-SKREVLQISRQRAKLEKNLGSIADL
RS2_PARD8       GGMLTNFPTIRKAIKKMATIDKMTK-DGTFDN-L-SKREKLQITRQRAKLEKTLGSIVDL
RS2_NEOSM       SGMFTNWNTVSKSVKKLVHYEKLLEQEGDV---L-SKKERLSINRKRERIEKYLGGVRKM
RS2_ORITB       GGMLTNWVTVSKAINKLDQLEKKLADPEKIVG-Y-TKREILSMQRMRDNLHRSFGGIRNM
RS2_DICNV       GGMMTNFKTIRQSIRRLEEIEKMAE-DGTYDK-L-SKKEVIVLEREREKLARALTGIRSM
RS2_RUTMC       GGMMTNYKTIKVSIKRLKDLEFLAE--ENFNQ-F-GKKEALMMTREMEKLERSLGGIKDL
RS2_FRAP2       GGMLTNYKTVRQSIKRLAQLEKMKE-DGTFES-L-TKKEMLQNIRTIEKLEKVLGGIKEM
RS2_COXBR       GGMLTNYKTIRQSIKRLKELEERLENEENLVG-M-TKKEILNLMREKEKLSANLAGIKNM
RS2_LEGPH       GGMLTNYKTVRQSIFRLKELKEMKE-KGLFND-M-IKKEALMLTRELEKLERSLGGIENM
RS2_METCA       GGMLTNFKTIKASIARMKDLQAMRD-DGRLNR-F-SKKEALGMMRELEKLVCNVGGIGDM
RS2_BORA1       GGMLTNFKTVKSSIKRLKEMEVMVA-DGSVER-L-TKKEGLLFQRELDKLNKAIGGIKDM
RS2_POLAQ       GGTLTNFKTVKGSLKRLKDMAVAKE-AGDWEK-L-SKKEALTNDRDLDKLQKALGGIQDL
RS2_CHRVO       GGMLTNYKTVKQSIKRLEEKRAILE-GAGETG-Y-NKKELLDLQREVEKLERSLGGIKDM
RS2_RHOFT       GGMLTNFKTVKTSIKRLKDMKIQQE-AG-LDS-L-SKKEQLMFARELAKLERDIGGIQDM
RS2_NITEC       GGMLTNFKTIRQSIKRLQDMEKMVQ-DGTLNK-L-VKKEALDFQRELEKLNASLGGIKEM
RS2_NITMU       GGMLTNFKTIKQSVKRLHDMETMME-DGTLDK-L-SKKEALDLQRELEKLNRSLGGIKDM
RS2_THIDA       GGMLTNFKTVKQSIKRLNDLEAQI---AEPGR-L-SKKEILTVQREVDKLNRSLGGIREM
RS2_JANMA       GGMLTNFKTIKTSIKRLKEMEASIE-DGSVQK-L-SKKEALMFEREKIKLEKSIGGIKDM
RS2_DECAR       GGMLTNFKTVKTSIKRLKDMEVAVE-AGELEK-M-PKKEALTFRRELEKLQKSIGGIKEM
RS2_XYLFT       GGTLTNFRTVKQSVARLKELELAET-DGTFSK-L-VKHEVLRLRRESGKLQASLGGIKDM
RS2_WIGBR       GGMLTNWKTVRQSIKRLKELESQSK-DGTFKK-L-TKKEALIRTRTLNKLENSLGGIKNM
RS2_BUCCC       GGMLTNWKTVRQSINKLKDLEKQSL-DGTFDK-L-TKKEVLLRIRLLNKLENSLGGIKNM
RS2_BLOPB       GGMLTNWKTVRQSIKRLKDLEIQSQ-DGTFKK-L-TKKEALILNRELINLENSLGGIKNM
RS2_IDILO       GGMLTNWKTVRQSIKRLKDLETMSQ-DGTFEK-L-TKKEALVNTREMEKLEKGLGGIKNM
RS2_BUCBP       GGMLTNWKTVRQSIKRLKDLESQSQ-DGTFNK-L-TKKEVLLRMRELSKLENSLGGIKEM
RS2_BAUCH       GGMLTNWKTVRQSIKHLKELETQSQ-DGTLDK-L-TKKEAIICNRKLEKLEKSLGGIKDL
RS2_PSEA6       GGMLTNWKTVRQSIKRLKDLEQQSQ-DGTFDK-I-TKKEVLMLQREMAKLENSLGGIKNM
RS2_ECOLI       GGMLTNWKTVRQSIKRLKDLETQSQ-DGTFDK-L-TKKEALMRTRELEKLENSLGGIKDM
RS2_NITOC       GGMLTNFQTVRRSIKRLHDLEAMIQ-DGSLDR-L-KKREALTVRRDRDKLENNLGGIKNM
RS2_ALKEH       GGMLTNFRTVKGSIRRLKDLEAQAE-DGTFDK-L-TKREALSLSREMEKLNRTLSGIKDM
RS2_HALHL       GGMMTNFRTVKHSIARLKDLETQAE-DGTFDK-V-TKREALALSREREKLDRSLSGIKNM
RS2_ACIAD       GGMLTNWKTLRQSINRLKDLQTQSQ-DGTFAK-L-TKREALERTREMEKLERSLGGVKNM
RS2_HYDCU       GGMLTNFKTIKQSIKNLKDLEVQEQ-DGTFEK-I-TKKEALMRSRQKAKLELSLGGIKDM
RS2_CHRSD       GGMLTNFKTIRVSIKRLRELEAMHE-DGTFEK-L-TKKEVLMATREQDKLERSVGGIKDM
RS2_ALCBS       GGMLTNWKTIRQSIKRYRELEAQFQ-DGTFDK-L-TKKEALMRKREMDKLERSIGGIKDM
RS2_SACD2       GGMLTNYKTIRASIRRYRELETQSQ-DGTFEK-L-TKKEALVRTRIMEKLEKSIGGIKDM
RS2_PSEU5       GGMLTNYKTIRASIKRLRELEAQSQ-DGTFEK-L-TKKEALMRTRDLEKLERSLGGIKDM
RS2_MARMS       GGMLTNYKTIRASIKRLRELETQMS-DGTFDK-L-TKKEALMRTRELEKLELSMGGIKDM
RS2_DEIRA       GGMLTNFKTMRTRIDRLNELDDLFESERINDR---PKAERIQLASERERLLRFVGGIRKM
RS2_THET8       GGMLTNFKTISQRVHRLEELEALFA-SPEIEE-R-PKKEQVRLKHELERLQKYLSGFRLL
RS2_RICBR       GGMLTNWKTISGSIEKLNKLEQTLENEEACIG-Y-TKKEILDMNRKKDKLLLSLAGIREL
RS2_WOLTR       GGMLTNWGTISSSIKTLVQYEKVL--NAENSI-L-TKKELGNIEKKRQKLDKALGGIREM
RS2_EHRRW       GGMLTNWETISLSIKKLREYEKLLQ---NVDNQF-TKKELLLFEKKRAKLDRSIGGICNM
RS2_ANAPZ       GGMLTNWETVSSSIRRLLDFEKLLN-DTDAKF---TKKELLMFDKKREKLERSLGGIREM
RS2_ANAMM       GGMLTNWETVSSSIRRLVEFERLIN-NNEGQF---TKKELLMLDKQRGKLERSLGGIREM
RS2_RUBXD       GGLLTNFRTIRPRIEYFKQLSREVEETPEEER---SGKEWFARLREYQKLRRNFAGITEM
RS2_TROWT       GGLLTNFSTVSKSLVRMKELEEARL-DDSVS----TKKEQLIRGRELQKLRRSLGGIRNM
RS2_BIFLO       GGMLTNFQTVSKRVNRLKELEEMDFTDVHGSG-L-TKKELLLLEREKDKLNKQLGGIRNM
RS2_SALTO       GGMLTNFQTVYKRLQRMKELEALGDLSGTAAG-Y-TKKETLQLNREKGKLSRTLGGLRDM
RS2_CLAMS       GGLLTNFQTVHKRLNRLKELDLVDF-DDTTRG-F-TKKELLIQRRERDKLEKSLGGIRNL
RS2_LEIXX       GGLLTNFQTVSKRLARMKELEELDF-EGTTSG-F-TKKELLIKKRELDKLHKSLGGIRNL
RS2_FRAAA       GGMLTNFSTVYKRLQRLKELEEIEV-TGGTEV-R-TKKEQLVLTREKAKLERTLGGIRDM
RS2_RHOJR       GGMLTNFTTVHKRLLRLKELEAMEQ-TGGFEG-R-TKKEILMLTREMTKLDRTLGGIRDM
RS2_COREF       GGMLTNFQTVSKRLHRMKELQAMDAAEDGYEG-R-TKRETLMLTRERVKLERVLSGIADM
RS2_CORJK       GGMLTNFQTVAKRLHRLKELQAMDAAEDGYKG-R-TKKEVLMLTRERNKLERVLGGIADM
RS2_NOCSJ       GGMLTNFSTVHQRINRLKELDEIDFDDVAGSS-R-TKKELLQMRRERDKLNKSLGGIREM
RS2_KINRD       GGMLTNFQTVNKRIARMRELEQVDFDDVAGSG-L-TKKELLVLRREYDKLTKTLGGIREM
RS2_RENSM       GGMLTNFQTVAKRIQRMKELEEINFEDVASSG-H-TKKELLLLKRELTKLEGNLGGIRNL
RS2_CUTAK       GGMLTNFQTISKRIARLKELEAMDFDKVSGSG-L-TKKELLMLSREKDKLEKDLGGIRDM
RS2_THEFY       GGMLTNFSTVHKRLQRLKELEEIDFDDVASSG-L-TKKELLGLRREKEKLERTLGGIRDM
RS2_ZYMMO       GGMLTNWRTISGSIKRLKSLEEKL--SGDTAG-F-TKKEILQLTRERDKLELSLGGIRDM
RS2_ERYLH       GGMLTNWQTISKSIKELKSLEEQL--SGETHG-L-TKKEVLNLTRKRDKLELSLGGIRDM
RS2_ROSDO       GGTLTNWQTVSQSINRLKAIDEQS--ERGFEG-L-TKKERLGMERDQGKLQASLGGIREM
RS2_PARDP       GGTLTNWKTVSQSIQRLKALDETLG-SGAEGL---TKKERLQMEREQAKLQASLGGIREM
RS2_ACICJ       GGMLTNWKTITNSIRKLRQMEETL--AGDGQG-L-TKKEMLNLMRERDKLDRALGGIKEM
RS2_MAGSA       GGMLTNWKTISNSIRRLRELDEQLA-SGALAG-L-TKKEQLVLSREKEKLDRALGGIKDM
RS2_RHORT       GGMLTNWKTISHSIKRLRDLEERFG-GGDLLG-L-TKKEQLNLGREKDKLDMALGGIKEM
RS2_HYPNA       GGTLTNWSTVSNSIKQLRELNAMFE-SGGGSG-L-TKKELLDLQRRRDKLQKSLGGIADM
RS2_MARMM       GGTLTNWRTISNSIARLRELEGMFENEGGMAG-L-TKKEQLMLTREREKLDRSLGGIKDM
RS2_METRJ       GGMLTNWKTISGSISRLRKVTETLE-TGGPGL---TKKERLMLSREKEKLEKALGGIKDM
RS2_BEII9       GGMLTNWKTISASIQRLRKLDEILA-SGAGGL---TKKERLMMSRERDKLEKALGGIKDM
RS2_RHOP5       GGTLTNWKTISASIKRLRHLDEMLN-SGDAGS-Y-TKKERLTLQRERDKLDRSLGGIKDM
RS2_AZOC5       GGMLTNWKTISNSIARLKKLEEML--SGPEQGGY-TKKERLTLSREKEKLERALGGIRDM
RS2_CAUSK       GGTLTNWRTVSGSIARLRELEGIM--GGESAG-R-SKKELLQLTRERDKLELSLGGIKDM
RS2_PARL1       GGMLTNWKTISNSIRRLRQLDEML--AGEAKG-L-TKKEVLNLTRERDKLERAIGGIKDM
RS2_BARBK       GGMLTNWKTISNSIHRLRKLDKIL--AAEARG-F-TKKERLNLERDREKLNRALGGIKDM
RS2_CHESB       GGMLTNWKTISNSIQRLRRLDEMLS-SENLGL---TKKERLNLERERDKLERALGGIRDM
RS2_DEHM1       GGILTNFHSIQSRIDYLVRLEDQQA-RGDFNR-L-PKKEAQKLAEEIARLNRTMGGFKEM
RS2_BDEBA       GGMMTNFETIKSSIDRLRKIDTMKE-KGEFNY-L-TKKERAKLEKEYLRLTDFLAGIRDM
RS2_SULDN       GGMLTNFPTIQKSIRKLDVISEMQE-NGQIDL-L-TKKEALMLSRQKEKLESYFGGIRNM
RS2_CAMHC       GGMLTNFDTIKQSIRKLEVIEQMET-DGSMDL-L-TKKEAGMLKSKKAKLELYLGGIRNM
RS2_SULNB       GGMLTNYPTMKKSIRKLEIIEQMEE-NGQLDM-L-TKKEALMLLRKKEKLSSYLEGFRYM
RS2_ARCB4       GGMLTNFGTIKKSIRKLEIIKKMRE-EGQLDL-L-TKKEALMLTRKEEKLELYLGGIKEM
RS2_NITSB       GGTLTNFNTIKKSIRKLEIIEEMEK-TGQMDL-L-TKKEALMLRRKKEKLENFLGGIRDM
RS2_HELPY       GGMLTNFSTIRKSVRKLEIIEEMEN-SGQIDL-L-TKKEKLMILRKKEKLDKYLGGVRHM
RS2_WOLSU       GGMLTNFSTIKKSIRKLEVIEEMEA-SGQIEL-L-TKKEKLMLTRKKEKLEKYLGGVRHM
RS2_BORAP       GGMLSNFNTIRKSVQKLKKLEKMEV-DGTFDM-I-SKKEISQLNREKLKLAKNLSGIKDM
RS2_MAGMM       GGTLTNWRTIQGSIRRLKEIDKMRV-DGTFEA-L-TKRETQQLDREGQKIERALGGIKDM
RS2_SORC5       GGTLTNFRTIKQGLDRLRTLERMKE-DGTYEQ-L-LKKEVVRLEKERERLEKYLGGLKGM
RS2_TREPA       GGMLTNFSTIRKSLSRLKKIERMEI-DGTFEH-L-SKKEVASLRKEHAKLEKNLGGIKEM
RS2_LEPBJ       GGLLTNWNTVKKSIARLKKLEAMEA-DNSFEKEVKTKKEVLTLRRELEKLRKTLGGIKDM
RS2_ROSS1       GGTLTNFATMRKRLRYLNDLEDQRA-RGEFNK-L-TKAEALKLDAEIEKLNKVFGGMKTM
RS2_CHLAA       GGTLTNFATIKRRLKLLSDLEEQRD-RGDFAR-L-TKAEAAKLEEKIVRLNRVFAGLKGM
RS2_DESAG       GGTLTNFQTIRKSIDRLKKLEVMFE-DGTVNR-Y-QKKEVLRLRREMDKLNLVLGGIKDM
RS2_LAWIP       GGTLTNFSTIQKSIERLNRLETMFS-DGSVNR-Y-QKKEILTLNREMDKLELTLGGIKNM
RS2_ONYPE       GGTLTNFKTILKRIELLHLLHKQEE-EGLWKK-L-PKKEVVQLKRKRDKLEKFLGGIKDM
RS2_DESPS       GGMLTNFQTIKNSIDRLKSIEAMQE-DGSINR-F-PKKEILLMGKERVKLERNVGGIKDM
RS2_PETMO       GGLLTNFKTIKSRIDKLEQLTEYVE-SEEFSK-L-PKKEQATIRRNLEKLEKNLGGLRGM
RS2_ANADF       GGTLTNFKTVKQGIDRLKTIEKMAA-DGTYER-L-PKKEVAQLEREREKLEKNLGGIKEM
RS2_MYXXD       GGTLTNFKTIKQGIDRLKTLEKMAE-DGTFER-L-PKKEVAQLEREREKLEKNLGGVKEM
RS2_PELPD       GGMLTNFTTVKQSIDRLKRIDAMFE-DGTIEA-Y-PKKEALQFEKERVKLQKILGGIKGM
RS2_PELCD       GGMLTNFATIKKSIERLKKIEVMAQ-DGTYEL-L-TKKEALNLEREREKLEKTLGGIKGM
RS2_KORVE       GGLLTNWVTVQKSVKRLKELDEMAT-DGRYEL-L-PKKEVIKLERERKHLQANLAGIKNL
RS2_SOLUE       GGLLTNMLTVQKSIKRLKELEAMASVEGGYAG-R-PKKEVIRLERERKHLDQNLSGIKDM
RS2_FUSNN       GGMLTNFSTIKKRIERMKELEKLDA-EGILDTDY-TKKEAAEFRKELSKLSKNLSGIRDM
RS2_AQUAE       GGLLTNFQTVRKSIMKLQTLERMEE-DGIFDV-L-PKKEVRNLRRKMEKLRKLYNGIRDM
RS2_SYNFM       GGMLTNFKTIKLRVDRLKELDAMVE-DGSINR-F-PKKEILQLMGEREKLEKNLGGIKNM
RS2_ACHLI       GGTLTNFKTIRQRIKLLHSLYAAEA-DGTWAK-L-PKKEVLGLSRQRIKLERFLGGIKDM
RS2_SYNAS       GGMLTNFVTIKKRIDRLNYLDQIFE-DDSVRA-F-PKKEIMGLQKEREKLVKVLGGIQKM
RS2_PSELT       GGLITNFKTIKPRIDKLIELEEMEK-NGELAK-L-PKKEQSRLRKALEKLRKNLGGLKAM
RS2_THEMA       GGLLTNFKTIRSRIDKLIELEEMEQ-SGKLEE-L-PKKEQSRIRRVLEKLRKNLGGLKEM
RS2_THEM4       GGLLTNFQTIRKRIDKLIELEEMEA-NGEFDN-L-PKKEQSRLRRILDKLRKNLGGLKEM
RS2_FERNB       GGLLTNFQTIQSRIQRLIELEEMEA-NGELDK-L-PKKEQSKLRKTLEKLRKNLGGLKNM
RS2_OENOB       GGTLTNWNTIKTRINKLKELRAAEE-DGSFDK-L-PKKEASQLGKQKAKLEKFLGGIADM
RS2_LACP7       GGMLTNFKTIQSRIKRLKEIETMAN-DGTFEV-L-PKKEVIELKKEWEKLEKNLGGIKDM
RS2_LEUCK       GGTLTNWNTIKTRIQRLKDLEAMAE-DGTFEQ-L-PKKEVVLLNKQREKLNKFLGGIKDM
RS2_LACH4       GGTLTNWTTIQSRVKRLKQLKEMSQ-DGTFDV-L-PKKEVALLTKEMDKLERFLGGIEDM
RS2_PEDPA       GGTLTNWNTIQKRIKRLKDLKAMEE-DGTFDR-L-PKKEVALLNKQKDKLEKFLGGIEDM
RS2_LACRD       GGTLTNWKTIQSRIARLKELKKMSE-DGTFDV-L-PKKEVAVLTKQREKLERFLGGIEDM
RS2_OCEIH       GGTLTNFQTIRKRINRLKSIEKMEE-DGTFEV-L-PKKEVVNLLKEKERLVKFLGGIKEM
RS2_STAS1       GGILTNYKTISKRIKRISEIEKMEE-DGLFEV-L-PKKEVVELKKEYDRLIKFLGGIRDM
RS2_LYSSC       GGTLTNFGTIQKRVARMKQIEKMEE-EGTFEV-L-PKKEVIQLKKEHERLIKFLGGIRDM
RS2_STRTD       GGTLTNWNTIKKRIARLKEIKQMEA-DGTFEV-L-PKKEVALLNKQRARLEKFLGGIEDM
RS2_ENTFA       GGTLTNWDTIQKRIARLKKINAMEE-DGTFEV-L-PKKEVAGLNKERERLEKFLGGIADM
RS2_SYMTH       GGMLTNFETIKKRIARLNELEEIEG-TEYWSK-L-TKKEQAQLLHEKEKLEKNLGGIKGM
RS2_CALS4       GGTLTNFKTIKTRIQRLKELKRMEE-DGTFEV-L-PKKEVIRLRKEKERLQKFLGGIENM
RS2_SYNWW       GGMLTNYKTIKRRVLRLKELEKQEA-EGAFEV-L-SKKEVARLLNERERLERFLGGIKEM
RS2_CLOK5       GGMLTNFLTIRNRIGKLEELEKMEE-DGTFEV-L-SKKEVIKLRNEKQKLERNLGGIKAM
RS2_HUNT2       GGMLTNFKTIKGRINRLKELTKMEE-EGVFDV-L-PKKEVTKLRAEKEKLEKYLGGIKEM
RS2_CARHZ       GGTLTNFKTIRKRVERLIEIEKMEQ-EGALSV-L-PKKEVAKILKEKEKLSRFLSGIKEM
RR2_EUGGR       GGILTNWITIKNCINKLKQLSKQK--EKHHNL-L-TKKERLVLKKKKLKLKKYFSGMRDM
RR2_CYACA       GGLLTNWPTIKLSLKKLQLLEEKEK-LDHLGS-T-SKKEEASMKREIQKLNKYLNGIKGM
RR2_CHLVU       GGMLTNWRTIQKSLRKLQEYRRAEE-RGDWNL-L-KKQEVARKRREKDRLEKYLSGVENM
RR2_OLTVI       GGMLTNWKTIQTSIKKLNEFDYQEK-TGGFDL-L-SKQEAAQARKEKARLQKYLGGMKHM
RR2_TUPAK       GGQLTNWQTIKLSIQKLKSLETKER-HGLLGK-I-PKKEAALLKKEKEKLGKYLDGIKNM
RR2_NEPOL       GGMLTNWPTMQLCIKRLLELESNHE-RGGFQQ-F-PKKEAAVARKQLARLEKHLGGVKNM
RR2_CYAM1       GGLLTNWTTVQSRLKRWRELLEAD-----MDH-L-TKKEASALRRELNQLNRQMRGIQNM
RR2_PHATC       GGMLTNWSTLKERIAHLKDLEQQEA-NNTFDL-L-TKKEGALRRKELKKLRRHLDGIKDM
RS2_GLOVI       GGMLTNWDTIRTSVDQLKELETMEA-NGTLDL-L-PKKEASVTRKKLERLTKYLGGLKNM
RR2_CHLAT       GGMLTNWPTIKTRIKRLKDLEQSEK-NGTLDN-L-PKKESAVLKRQLDKLRKYLGGLQDM
RR2_EMIHU       GGILTNWSTVQKRVEYLKELDAKEE-DGTLDR-L-PKKEAAFLRREQEKLSHNLRGLINM
RS2_SYNJA       GGMLTNWATIKTRIDRLKEIEEMQS-SGLLDR-L-PKQEAARLKRELAKLEKYLGGIKTM
RR2_RHDSA       GGILTNWFTIRTRVERLKDLENKEE-SGYLDQ-L-PKKETAILRRELEKLRKNLDGIKTM
RR2_PYRYE       GGMLTNWVTIKSRVSRLRQLEEQDK-SGMIDQ-L-PKKEAAVLRRELDKLRKHLNGIKNM
RR2_GRATL       GGMLTNWMTIKSRVERLQRLEMDEQ-AGLIDM-L-PKKEAAINRRELDKLRKNLNGIKNM
RS2_SYNR3       GGMLTNWSTMRARIERLKDLERMES-SGAIAM-R-PKKEASVLRRELDRLQKYLGGLKNM
RS2_SYNY3       GGMLTNWETIRKRVDRLKELEALEA-SGGIDR-R-GKKEGSMLRRELGKLQKYLGGIKNM
RS2_MICAN       GGMLTNWETIRGRVERLKELEELEN-SGALDK-R-PKKEASVLRRELGKLEKYLGGIKTM
RR2_CYAPA       GGTLTNWTTIQSRVEYLKELEMREE-SGALDL-L-PKKEAAILRRQLEKLRKSLGGIQTM
RS2_THEEB       GGMLTNWTTIKTRVDRLKELESMEE-SGLIDL-R-PKQEASALRRELARLQKYLGGIKQM
RS2_SYNE7       GGMLTNWATIKGRVDRLKELERMEE-TGALAL-R-PKKEAAVLRRELERLQKYLGGIKNM
RS2_ACAM1       GGMLTNWTTIKTRIERLKDLERRYE-SGIFDL-L-PKQEASMLRRELDKLQKYLGGLKQM
RS2_TRIEI       GGMLTNWTTIKTRVERLKDLERREE-SKALDL-L-PKKEASVLRREMAKLQKYLGGIKNM
RR2_CHAVU       GGMLTNWMTIETRIQRLKNLETQEK-LGAFHH-L-PKKDAAHLKRQLNQLQKYLGGMKYM
RR2_ZYGCR       GGMLTNWSTIKTRLQKFEQLEAQEI-AGAFNH-L-PKKEVAVMKRQLSQLRKYFHGIKYM
RR2_CRYJA       AGMLTNWFTTEARLEKFKNLTKKKN-TGGFDG-F-TKKEAAILKRELNKLQEDLGGIRYM
RR2_CHAGL       GGMLTNWTTIKKRLKKLQELESLES-INGFDR-F-PKKEASNLKRQLAQLRKYLGGIRHM
RR2_PELHO       GGMLTNWSTTKKRLHKFRDLIRQQ---GRLNR-L-PKRDAAILKRQLFHLQKSLGGVKYM
RR2_PSINU       GGMLTNWSTIEKRLQKLRSLEIRKR-MGGLDN-L-SKEEAAILRGQLSKLHKYLGGILYM
RR2_ANEMR       GGMLTNWSTIETRLQKFRNLEKEKL-AGIFER-L-PKKEVADSERRLSRLRKYFGGIKYM
RR2_CUSOB       GGMLTNWSTTETRLQKFRDLRMEQK-KGGLNN-L-PKKEATMLKRKLARLQKYLGGIQYM
RR2_ADICA       AGTLTNWVTTETRLRRFQHLQTGGD-LGEFDR-L-PKREAAILKGQLVRLKKCLGGIQYM
RR2_TRACE       SGMLTNWSTTETRLHKFRDLRIKEK-RGRLKR-L-PKRDAAILKRQLSHLQRSLGGIKYM
RR2_MAIZE       SGMLTNWSITKTRLSQFRDLRAEEK-MGKFHH-L-PKRDAAILKRKLSTLQRYLGGIKYM
RR2_STAPU       GGMLTNWSTIETRVTRLKQLEDQEN-AGVLNQ-L-PKKEAAVLKRQLIQLRKYLEGIKYM
RR2_ANGEV       GGMLTNWSTMETRLQRFQDLENKAN-TGGFNR-L-PKREAAILKRQLSQLQKYLGGIKYM
RR2_HUPLU       GGMLTNWSTMEKRLQKLRDLENKEK-TGGFDR-L-PEKEAAISKGQLAKLKKYLGGIEYM
RR2_ANTAG       GGMLTNWSTIEKRLRKFEDLQTKKN-MGALDE-L-PKKEAANLERQLAQLQKYLGGIRYM
RR2_CYCTA       GGMLTNWSTTGTRPRKFKDLKKEQD-TGQSNR-L-PKKEAAMLKRQLAQLQKYLGGIKYM
RR2_EPIVI       GGMLTNWSTTETRLHKLRDLIMEQK-AGRLNR-L-KKKDEAAVKRQLARLQTYLGGIKYM
RR2_PHAVU       GGMLTNWYTTKTRLQKFRDLRMQQK-TGRFDC-F-PKKDAAILKRHLAQLETYLGGIKYM
RR2_AMBTC       GGMSTNWSTTETRLHKFRDLRAEQK-MGRFKR-L-PKRDAAMLKRQLSHLQTYLGGIKYM
                .*  .*                                                 ..  :

RS2_UREP2       K-QRP---DVLILVDPVNDVNAIKEARKLNIPVIALANTNADPQLIDYIIPVNNYSVKSI
RS2_MYCPE       K-ELP---KVIILTDPEINKIAIKEARNLGIPVIAICNTNANPDLVDYVIPANNHSIKSV
RS2_MYCPN       K-RLP---NLLIVDDPVYEKNAVAEANILRIPVVALCNTNTNPELVDFIIPANNHQPQST
RS2_MYCGA       Q-GLP---HVLVIDDPIKEKNAVTEARKLRIPVIALCNTNSDPNVITLPIPANNYNIRSV
RR2_STIHE       K-GFP---EVVIMTSQTKDLSAARECKKMGIWNLSILDTNCDPRLADLMVPANDDSASSV
RR2_EUGLO       K-KIP---DVVFLIGQSDLKKAIGECLKLNVPTISILDTDCDPTMTNFFIPANDDSISSI
RS2_MYCAP       Q-SLP---SFMIVADPNVDAIAVKEARSKGVKVIGILDSNSNPDAVDFGIPANDDSAKSI
RS2_MYCPU       K-TQP---NFMIVVDPNVDRIAVKEARDKGVKIIGILDSDANPDFVDLGIPANDDSIKSI
RS2_MYCH7       K-DVPLFSLIMLVADPLKDAIAVKEARKKGIKIIGITDSNVDPSLVDFGIPANDDSTKSI
RS2_MYCMO       K-HLP---QVMIVADVNTDKIAIKEAQRKNIKIIGILDTNSDPSLVNFGIPANDDSVKSL
RS2_MYCS5       R-RLP---QVMIVTDLVEDKIAIQEAKKKKIKIIGIVDTNVDPTVIDFGIPANDDSSKSI
RR2_PLETE       Q-KLP---GVVILASQNQEMNALKECQRLKIPSVTILDTNSDPTLSDYFIPGNDDSYKSL
RS2_OPITP       P-GLP---TAMFVVDVNHEKIAVAEAARSGIPCVGICDTNSDPSTLSHPIPGNDDAVKSI
RS2_PARUW       R-KPP---GLVIVVDPSKEHLAVAEANKLGIPVMGLVDTNCDPDPIEHVIACNDDALKSI
RS2_CHLMU       N-SLP---GLLVVIDPGYERIAVAEAGKLGIPVMALVDTNCDPTPINHVIPCNDDSIKSI
RS2_CHLPN       K-KAP---GLLVVVDPSYEKIAVAEAKKLGIPVLALVDTNCDPTPIDHVIPCNDDSLKSI
RR2_BIGNA       T-SLP---STVILVGQHNEITASKECRKLGINNITILDTDCNPEFVDLFIPANDDSSSSL
RR2_OSTTA       K-TLP---DLVVIVGQPNERNAVLECQKLNIPTITLLDSNCDPTFVSYGIPANDDSARSV
RS2_RHOBA       N-RLP---EVMFIVDPGKERNAVREAKRLGITTVALIDTDSDPSQIDLPIPGNDDGIRSV
RS2_MESFL       R-KLP---AALIVVDPKSDEIAVKEAIKLNIPVIGLCDTNVDPDIVTLPIPANDDLQESV
RS2_MYCCT       H-KLP---AAIVVVDPKGDEIAVKEAKKLNIPVIAICDTNADPDMVDYVIPGNDDLQESV
RS2_SALRD       A-NLP---SAIYIVDVQREDIAVSEANNLGIPIIAMVDTNGNPKNIDYPIPVNDDALSSI
RS2_CHLTE       N-RLP---AALFVVDIKKEHIAVKEARSLGIPIFAMVDTNCDPDEVDYVIPANDDAIRSI
RS2_SULMW       N-SLP---ACVIIVDVKKEKIAVKECINLCIPIIGIVDTNCDPRNIDYPIPANDDSSKSI
RS2_CYTH3       T-RLP---AAIFVVDVKKEHIAIAEAKKLGIPVFAIVDTNSDPTIVDFPIPANDDAFKSI
RS2_FLAPJ       S-RLP---AALFVVDIKAEHIAIKEAQKLNIPVFAMVDTNSDPRLVEYVIPANDDASKSI
RS2_GRAFK       S-RLP---AALFVVDTTREHIAIKEAHKLNIPIFAMVDTNSDPREVDYLIPSNDDASKSI
RS2_PORGI       N-RLP---SALFVVDVMKEHIAVREANRLGIPVFAMVDTNSDPSLIDYVIPSNDDALKAI
RS2_BACV8       T-RLP---SALFVIDVLKENIAVREANRLGIPVFAIVDTNSDPSNVDFVIPANDDATKSV
RS2_PARD8       T-RLP---SALFVVDVMKEHIAVREANRLGIPVFGMVDTNSNPNNIDYVIPANDDATKSV
RS2_NEOSM       G-GLP---NIIFVIDPKKEHIAVEEAWKLGIPVVAVVDTNCDPSKITYAIPGNDDSLRCI
RS2_ORITB       G-GKP---TLLIVMDINKDHIAVKEARREKIPIIAIVDTNSDPDLVDYPIPGNDDAIRSI
RS2_DICNV       K-HLP---DVLFVVDVGHERIAIQEAMKLGIPVVGVVDTNNDIEGVDYIIPGNDDSVRAI
RS2_RUTMC       N-DIP---DVIFVIDIGVEKNAVAEAKKLHLPIIGIVDTNHSPEGIDYVIPGNDDSIRAI
RS2_FRAP2       G-GLP---DAIVVIDSNKEHIAIQEAQKLGIKVVSIVDTNSNPEGIDYIIPGNDDAVKSI
RS2_COXBR       G-SLP---DVLFVIDVEHERNAVQEANRLGITVLGIVDTNASPDNIDHVIPGNDDAIRAI
RS2_LEGPH       G-GLP---DALFVVDVGFEHIAVEEARRLRIPVIGVVDTNNSPDNIDYVIPGNDDSMRAV
RS2_METCA       D-RLP---DVMFIIDTGYEKNAVSEARKLGIPVVGVVDTNNSPVGIDYVIPGNDDSIRAV
RS2_BORA1       N-GLP---DALFVIDVGYHKIAVAEARTLGIPVVAVVDTNHSPDGVDYIIPGNDDSARAI
RS2_POLAQ       N-GVP---DAIFVVDVGYHKIAITEANKLGIPVIAVVDTNHSPEGVDYIIPGNDDSSKAV
RS2_CHRVO       K-GLP---DAIFVIDTGYQKGTIVEAKKLGIPVIGVVDTNNSPDGIDYVVPGNDDSSRAI
RS2_RHOFT       T-VLP---DAIFVIDVGFHKIAIAEAKKLGIPLIAVVDTNHSPEGIDYIIPGNDDSSKAV
RS2_NITEC       K-GLP---DAMFVIDVGYQKGTIIEANKLGIPVVGVVDTNHNPAGIQYVIPGNDDSSQAI
RS2_NITMU       K-NLP---DAMFVIDVGYQKGAITEARKLGIPIVGIVDSNHSPAGVDYVIPGNDDSSQAI
RS2_THIDA       G-GLP---DALFIIDVGYQKGAVVEAKKLGIPVIGVVDTNNSPEGVDYVIPGNDDSARAI
RS2_JANMA       G-GIP---DAIFVVDVGYHKGAITEAAKLGIPVIGVVDTNHSPEGVTYVIPGNDDSSKAI
RS2_DECAR       A-GLP---DAIFVIDVGYHKIAITEAEKLGIPVIGVVDTNHSPDGVAYVIPGNDDSSRAI
RS2_XYLFT       N-RIP---DAIFVIDIGHEDIAIKEAKKLGIPVVAVVDTNYDPSLVDYPIPGNDDAIRAV
RS2_WIGBR       G-GLP---DAIFVIDVEHEKTSIKEANKLGIPIFAIVDTNSNPKDIKFVIPGNDDSIRAI
RS2_BUCCC       G-GLP---DAIFIIDTAYEHIAIREANHLGIPVFAIVDTNSSPDGVNYIIPGNDDAIRSI
RS2_BLOPB       G-GLP---DAIFAVGATHEHIAIKEANSLGIPVFAIVDTNSNPDGIDFVIPGNDDAVRAI
RS2_IDILO       G-GLP---DVLFVIDADHEHISIKEANNLGIPVVSVVDTNSNPDGVDYIVPGNDDAIRAV
RS2_BUCBP       G-SLP---DALFVVDADHEHIAIREANNLGISVFSIVDTNSDPDGVDFIIPGNDDAIRAV
RS2_BAUCH       G-GLP---DALFVIDAEREKIAVKEANNLGIPVFAVVDTNTDPNGIDFIIPGNDDAIRAI
RS2_PSEA6       G-GLP---DCLFVVDADHEHIAITEARNLGIPVVSIVDTNSNPDGVDYIIPGNDDAIRAV
RS2_ECOLI       G-GLP---DALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAV
RS2_NITOC       T-HLP---DALFVIDVEHERIAVDEAAKLGIPVVAVVDTNSDPRKADYIIPGNDDAIRAI
RS2_ALKEH       N-GLP---DAMFVIDVGFEHIAVQEARKLGIPVVAVVDTNNSPREVDYVIPGNDDAIRAI
RS2_HALHL       E-RLP---DAMFVVDVGYEHIAISEAKKLGIPVIGVVDTNCSPREVDYVIPGNDDAIRAI
RS2_ACIAD       G-GLP---DALFVIDVDHEAIAIKEAKNLGIPVIGIVDTNSNPDNVDYVIPGNDDAIRAV
RS2_HYDCU       R-AMP---DAIFIIDTGNEKIAIQEAKNLGIPVVGVVDTNNDPNGVDYVIPGNDDAVRAV
RS2_CHRSD       G-GLP---DALFVVDVDHERIAINEANKLGIPVIGVVDTNSNPDGVDYVIPGNDDSIRAI
RS2_ALCBS       G-GLP---DALFVIDVDHEDIALQEARKLGIPVVAVVDTNSNPDGVDYVIPGNDDAIRAI
RS2_SACD2       G-GLP---DALFIIDVEHERIAIQEANKLGIPVIGVVDTNSDPAGVDYVIPGNDDAIRAI
RS2_PSEU5       G-GLP---DAMFVIDVDHERIAISEANKLGIPVIGVVDTNSSPEGVDYIIPGNDDAIRAV
RS2_MARMS       G-GLP---DVLFVVDVDHERIAIKEANKLGIPVIGIVDTNSNPDGVDYIIPANDDAIRAV
RS2_DEIRA       N-RLP---DAIFVVDPTKEVIAVQEANKLGIPVIALADTDSDPDVIDYIVPGNDDAIRSI
RS2_THET8       K-RLP---DAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSI
RS2_RICBR       H-SKP---DLIVIIDTNKEHIAISEAVRLDIPIVAVVDTNSNPDHIDYPIPGNDDAIRSI
RS2_WOLTR       G-AVP---DVLFIIDTNKEHIAVKEAEKLEIPVVAILDTNSDPDGITYPIPGNDDSRKSI
RS2_EHRRW       G-GLP---HVIFVIDTNKERIAIREANKLNIPVIAVLDTNSDPTGIDYPIPGNDDAVRSI
RS2_ANAPZ       G-GLP---HILFVIDTNKEHIAIQEANKLKIPVVAVLDTNSDPRGVDYPIPGNDDSIRSI
RS2_ANAMM       G-GLP---HALFVIDTNKEHIAIREANKLKIPVVAILDTNSDPGGVDYPIPGNDDSVRSI
RS2_RUBXD       E-RLP---GAVYVVDPKREELLVREANRLRIPVVALTDTNCDPDVIDYVIPGNDDAIRSI
RS2_TROWT       T-KLP---ALLWVVDTNREGIAVEEARKLGIPVVAILDSNCDPDLVQFPIPGNDDSIRSI
RS2_BIFLO       N-RTP---SAMFVVDITKEALAVEEAHKLGIPVVAIVDTNADPDTVEYPIPANDDAIRGI
RS2_SALTO       Q-KLP---AAIWVVDTKKEHIAVDEARKLGIPVIAVLDTNCDPDEVDYPIPGNDDAIRSA
RS2_CLAMS       T-KTP---SAMWVVDTKKEHLAIDEARKLGIPVIGILDTNCDPDEVQYPIPGNDDAIRSV
RS2_LEIXX       S-KTP---SALWVVDTKKEHLAIDEAKKLGIPVIAILDTNCDPDEVQYPIPGNDDAIRSV
RS2_FRAAA       S-RVP---SAVWVVDTKKEHIAVGEARKLGIPVVAILDTNCDPDEVDYPIPGNDDAIRSA
RS2_RHOJR       A-KVP---SAVWVVDTNKEHLAVAEARKLNIPVIAILDTNCDPDLVDYPIPGNDDAIRSA
RS2_COREF       S-RIP---SALWIIDTNKEHIAVAEAHKLNIPVVAILDTNCDPDVVDYPVPGNDDAIRAT
RS2_CORJK       T-KTP---SALWIVDTNKEHIAVSEAQKLNIPVVAILDTNCDPDVVDYPIPGNDDAIRSA
RS2_NOCSJ       T-RTP---SAVWIVDTNKEHLAVEEARKLRIPIIGILDSNCDPDLVDFPIPGNDDAIRAV
RS2_KINRD       T-KVP---SAVWIVDTNKEHLAVDEAKKLNIPVVAILDSNCDPDDVDYRIPGNDDAIRSV
RS2_RENSM       N-KVP---STIWIVDTKKEHLAIDEAKKLNIPVVAILDTNCDPDEVDFPIPGNDDAIRSV
RS2_CUTAK       P-KVP---QAVWVVDTKKEHLAIDEARKLKIPVVAILDTNCDPDEVDYAIPGNDDAIRSV
RS2_THEFY       N-RVP---SAVWIVDTKKEHIAISEARKLNIPVVAILDTNCDPDEVDYPIPGNDDAIRSV
RS2_ZYMMO       G-TIP---DIMFVVDANKEELAIKEANTLGIPVVAILDSNVSPDGIAFPIPANDDAARAV
RS2_ERYLH       G-GVP---DVMVVIDANKEDLAIKEANVLGIPVVGILDTNVDPSGIAFPVPGNDDAARAV
RS2_ROSDO       G-GRP---DLIFVIDVKKEALAVAEANKLGIPVVAVVDTNCAPDGIDYIIPGNDDASRAI
RS2_PARDP       G-GLP---DLLFVIDVNKEDLAIAEAKKLGIPVVAVVDTNCSPKGVDYVIPGNDDAARAI
RS2_ACICJ       G-GLP---DILFIIDTNKEKLAVEEANKLGIPVVAVLDSNSNPEGVTYPIPGNDDAIRAI
RS2_MAGSA       G-GLP---DILFIIDTNKEALAVQEANKLGIPVVAIIDSNCDPAGITYPIPGNDDAIRAI
RS2_RHORT       G-GLP---DMLFIIDTVKESLAVNEANKLGLPVVAVIDSNSDPRGITYPIPGNDDAIRAI
RS2_HYPNA       G-GLP---AAIVVIDTNKEAIAVQEARKLGIPVVAVLDTNCNPSDADFGFPGNDDAARAI
RS2_MARMM       G-GTP---DLMFVIDTNKEGIAIQEAKKLGIPVIAVVDTNCDPDLVDFPIPGNDDASRAI
RS2_METRJ       G-GVP---DLLFVIDTNKEQLAIKEANRLGIPVAAIVDTNCNPDGISYIVPANDDAGRAI
RS2_BEII9       G-GVP---DLIFVIDTNKEQLAIQEAERLHIPVAAILDTNCDPDGITYPIPGNDDAGRAI
RS2_RHOP5       G-GLP---DLLFVIDTNKEDIAIQEAQRLGIPVAAIVDTNCDPKGISYLVPGNDDAGRAI
RS2_AZOC5       G-GLP---DLLFVIDTNKEDIAVKEAQRLGIPVAAILDTNSDPDGITYPVPGNDDAGRAI
RS2_CAUSK       G-GIP---DIMFVIDTNKEAIAILEARKLNIPVVAILDTNCDPDGITYPIPGNDDAARAL
RS2_PARL1       G-GLP---DLIFVIDTNKEEIAIQEARKLGIAVVAILDSNSNPDGIAFPVPGNDDAARAI
RS2_BARBK       G-SIP---DLMFVIDTNKENIAIQEAKRLGIPVVAIIDTNCDPDGIDYPIPGNDDASRAI
RS2_CHESB       G-STP---DMMFVIDTNKEAIAVQEARRLGIPVIAVIDSNCDPDVVDYPIPGNDDAARAI
RS2_DEHM1       T-RLP---DVIFVVDPTKEKIAMAEAKRMGVPLVAMVDTNCNPDEVDYPIPSNDDAMRAI
RS2_BDEBA       K-EMP---SAMFVVDLPKEHIAVAEAKRLGIPVVAIADTNSDPESVDFAIPGNDDAIRSI
RS2_SULDN       K-KLP---DMLFVMDAVKEHIAVLEARCLGIPVVAPLDTNCDPDLITYPIPGNDDAIRSI
RS2_CAMHC       K-NLP---DMVFVIDCVKEKIAVKEANRLGMPVIAPLDTNCDPDVVDFPIPGNDDAIRSI
RS2_SULNB       K-KLP---DMMFVIDAVKENIAVKEARRLGMKVIAPLDTNCDPDVIDYPIPGNDDAIRSI
RS2_ARCB4       N-KLP---DMMFVLDAVKEKIAIQEARRLGITVVAPLDTNCDPDVVDLPIPGNDDAIRSI
RS2_NITSB       K-GLP---DMLFIIDAVREHIAVKEGNKLGIPIVAPLDTNCDPDLIDYPIPGNDDAIRSI
RS2_HELPY       K-KIP---DMIFVIDVAKEKIAVAEARKLHIPIVAPLDTNCDPDLVDYPIPGNDDAIRSI
RS2_WOLSU       K-KAP---DMLFVVDAAKEKIAVAEARRLGIPVVAPLDTNCDPDVVDFPIPGNDDAIRSI
RS2_BORAP       E-TLP---GAVFIIDPKREQIAINEARKLKIPIISVVDTNCNPDVIDCPIPGNDDAIRSV
RS2_MAGMM       E-RQP---NLIIVVDTRKESIAVKEANKLGIPVVALVDSNCDPDPIDYPVPGNDDAIRAL
RS2_SORC5       G-GLP---AAIFVIDPHQESIAISEARKLNVPVVAITDTNCDPDLVDFVIPGNDDAIRSI
RS2_TREPA       K-ELP---GVVFIIDTRKETIAIREARRVGIPIVAVVDTNCNPEGIDYPIPGNDDAIRAI
RS2_LEPBJ       A-TIP---EIMFVIDPKKEEIAVKEARKLGLKIFAVVDTNCDPELIDYPIPGNDDAIRAI
RS2_ROSS1       D-RLP---GALFIVDPHKEALAVKEANKTGIPVVAMVDTNCDPDLIDYVIPCNDDAIRSI
RS2_CHLAA       D-RLP---GAVFIIDPRKEELAVREAVKEGIPIVAMVDTNCDPDPIDYVIPCNDDAIRGI
RS2_DESAG       E-NLP---QLAFIIDPNREDIAVKECRRLGIPIVAVTDTNCDPDLIDYVIPGNDDAIRAI
RS2_LAWIP       E-RLP---QLIFIIDPHRENIAVKEGRKLGIPIMAVTDTNCDPDLIDYIIPGNDDAIRAI
RS2_ONYPE       K-DLP---QAIFVVDPEKESIAVAEARKLGIKVFGIVDTNCDPDLVDYIIPANDDAIRGV
RS2_DESPS       R-ALP---AVIVIVDPRKESIAVSEAGKLGIPVVALTDTNCDPDGIDYRNPR--------
RS2_PETMO       K-KIP---DILFIIDPKKEEIAVKEANLLKIPIIATVDTNCDPDVIDYVIPANDDAIRTI
RS2_ANADF       S-RLP---AAIFVIDTKKEHIAVHEANRLGIPVVAVVDTNCDPEGIEYVIPGNDDAIRSI
RS2_MYXXD       S-KLP---RCVFVIDPKKEHIAIHEAGRLGIPVIGLVDTNCDPDGIDFVIPGNDDAIRSI
RS2_PELPD       N-RLP---GLMFVIDPKNEEIAIQEAKKLGIPVVAIVDTNCDPDPIDYVIPGNDDAIRAI
RS2_PELCD       N-KLP---GAIFVIDPKKETIAVKEARKLGIPVVAVVDTNCDPDDIDYIIPGNDDAIRAI
RS2_KORVE       N-RLP---DCLFVIDSNKEQIAVKEARKLGIPVVAVVDTNCDPSEVDYVIPGNDDALRAI
RS2_SOLUE       P-GLP---DVLFVIDSNKEGIAVKEARRLGIPVVAIVDTNCDPDEVDWVIPGNDDALRAI
RS2_FUSNN       E-KVP---DAIYVVDVKMEELPVKEAHLLGIPVFAMIDTNVDPDLITYPIPANDDAIRSV
RS2_AQUAE       K-KLP---DVIWIVDTVREKIAVSEARKLGIPIVAIADSNCDPTVIDYTIPGNDDAIKSI
RS2_SYNFM       A-RLP---GALYVVDTQRENIAVLEANRLGIPVVAIVDTNCDPDLINYPIPGNDDAIRAI
RS2_ACHLI       Q-RIP---QALFVVDPRTEEIAVKEARKLGIPVFGIVDTNCDPDLVDYIIPANDDAIRAV
RS2_SYNAS       K-SLP---AALFIVDPKRETIAVNEAKKLRIPIIAIVDTNCDPENIDYIIPGNDDAIRAI
RS2_PSELT       D-RIP---DIIYVIDPRKERIAVAEANKMGIPVIGVVDTNCDPDPVDFVIPANDDAIRSI
RS2_THEMA       R-RLP---DIIYIVDPRKEKIAVAEANKLGIPIVAIVDTNCDPDPIDYVIPGNDDAIRSI
RS2_THEM4       D-RIP---DVIYIVDPRKERNAVYEANLLKIPTVSIVDTNCDPDEIDYIIPGNDDAIRAI
RS2_FERNB       R-GLP---DVIFVVDPRKEKIAVEEANYLGIPIVAMVDTNCDPDPIDYVIPSNDDAIRAI
RS2_OENOB       E-DIP---DVMFVVDPKTEEIAVKEARSLNIPVVAMIDTNGNPDLVDVKIPANDDAIRAV
RS2_LACP7       K-EVP---EAIFVVDPKKERICIQEAHNLGVKLIGIADTNCDPEELDHVIPGNDDAIRAV
RS2_LEUCK       P-GLP---DVLFVVDPKKEEIAVKEANMLNIPVVAMIDTNANPEVVDVKIPANDDAIRAV
RS2_LACH4       P-RIP---DVLFVVDPKKEKIAVHEANILGIPVVAMVDTNTDPDPIDVVIPSNDDAIRAI
RS2_PEDPA       P-HTP---DVLFVVDPRKEQIAIKEAQKLNIPVVAMVDTNSDPDQVDVIIPSNDDAIRAV
RS2_LACRD       P-RIP---DVMFIVDPHKEQIAVKEAQKLHIPIVAMVDTNTDPDDIDYVIPSNDDAIRAV
RS2_OCEIH       N-KLP---DALFVIDPRKERIAIAEAHKLNIPIIGIVDTNCDPDEIDYVIPANDDAIRAV
RS2_STAS1       K-SMP---QALFVVDPRKERNAIAEARKLHIPIVGIVDTNCDPDEIDYVIPANDDAIRAV
RS2_LYSSC       H-DLP---DVMFVVDPRKERIAVAEARKLNIPLVGIVDTNCDPDEIDYVIPANDDAIRAV
RS2_STRTD       P-RIP---DVIYIVDPHKEQIAVKEAKKLGIPVVAMVDTNADPDEIDVIIPANDDAIRAV
RS2_ENTFA       P-RIP---DVMYIVDPRKERIAVQEAHKLNIPIVAMVDTNCDPDEIDVVIPSNDDAIRAV
RS2_SYMTH       K-SLP---DMAFVIDPRRERIAVSELRKLGIPIVAIVDTNCDPDEIDYVIPGNDDAIRAV
RS2_CALS4       E-SLP---SALFIVDPKKEAIAVSEARALEIPIVAIVDTNCDPELIDYPIPGNDDAIRAV
RS2_SYNWW       D-KLP---GAVFVVDPRKERIAVAEARKLNIPVVAIVDTNCDPDEIDYVIPGNDDAIRAV
RS2_CLOK5       NAENV---GALFVVDPRKEKNAISEAKILGIPVVAIVDTNCDPDEVDYVIPGNDDAIRAV
RS2_HUNT2       K-ELP---GALFVVDPRKERIAVLEARRLGIPVVAIVDTNCDPDEVDYVIPGNDDAIRAV
RS2_CARHZ       K-KLP---DALFVVDPRKEKIAVAEARKLDIPVVAIVDTNCDPDEVDYVIPGNDDAIRAV
RR2_EUGGR       T-ERP---EIVIIIGQNKEINAVRECKKLGIASITILDTNCDPTLTKYPIPSNDDSILSV
RR2_CYACA       K-KPP---DIIILVDPSREKTTISECQKLNIPTIGILDTNCNPKSVNVPIPANDDSIKAI
RR2_CHLVU       S-RLP---GVVILIGQTEEIHAVKECRQLGIPTVTLLDSNCDPNLADWFLPANDDSVSAL
RR2_OLTVI       T-TIP---DVVVIVGQPDELNAVAECRRLGIRSVTILDTDCDPSLADLFVPANDDSVASI
RR2_TUPAK       A-SIP---DIVIIIGQSEEINAVRECKKLGIRTITILDTDCDPSLADLFIPANDDSISSI
RR2_NEPOL       T-GLP---TTVVIVGQPQEMNAVRECEKLGIPMITMLDSDCNPLLTDIGIPSNDDSIASI
RR2_CYAM1       D-QIP---DIVIVVDPNKENTAVLECHKLGILTIGIVDTNADPESVDLAIPANDDAIASL
RR2_PHATC       K-NLP---DIAIVIDQKRETTAIRECRKLGIPVVSILDTNCDPDLVDIPIPGNDDAVRSI
RS2_GLOVI       R-RKP---DILLVVDQRREQNAVMEARRLNIPIVSLLDTNCDPDLTDVGIPANDDAIRSI
RR2_CHLAT       K-TLP---DVVIIVDQKREMNAVRECIKLGIPIIALLDTNCDPSLSDLPIPANDDAIRSV
RR2_EMIHU       T-QIP---DIVILVDPKRETTALLECRKLGIPIISILDTNCDPNLVDIPIPANDDAVRSV
RS2_SYNJA       R-KLP---DAVIIVDQRREANAVQECIKLKIPIISLLDTNCDPDLSDVFIPSNDDAIRAI
RR2_RHDSA       K-RLP---DLVVVVDQKRESTAVQECRKLGIPIVSILDTNCNPELADIPIPANDDAIRSI
RR2_PYRYE       T-RLP---DIVVVVDQKRETTAIQECLKLGIPTICILDTNCSPEIINIPIPANDDAIRSI
RR2_GRATL       S-RLP---DFIVVVDQKRETTAIQECIKLGIPIICILDTNCNPEIIDIPIPANDDAIRSI
RS2_SYNR3       R-RLP---DVVVLIDQKREYNAVLECQKLDIPVVSMLDTNCDPDLCDVPIPCNDDAVRSV
RS2_SYNY3       R-KLP---DVVVIVDQRREHNAIHECQKLGIPIIAMLDTNCDPDVVDVPIPANDDAIRSI
RS2_MICAN       R-RLP---DLVVVVDQRREYNAIQECQKLGIPIISLLDTNCDPDLVDVPIPANDDAIRSV
RR2_CYAPA       R-HIP---DIVVIVDQKRENNAVQECKKLNIPIIALLDTNSDPDVVDIPIPGNDDAIRSI
RS2_THEEB       R-RLP---DIAIIVDVKREYNAVAECHKLGIPIVALLDTNCDPTQVDIPIPANDDAIRSI
RS2_SYNE7       R-RLP---DAVVIIDQKREYNAVQECQKLGIPIVAMLDTNCDPDVVDVPIPGNDDAIRSV
RS2_ACAM1       H-KIP---DVVVIIDIRREYNAVQECQKLGLPIVSLLDTNCDPDWVDIPIPANDDAIRSI
RS2_TRIEI       R-RLP---DGVIMVDQRREYNAVQECQKLNIPIVSLLDTNCDPTQVDIPIPANDDAIRSI
RR2_CHAVU       K-NLP---DVVIIVDQQKEIIAVQECRVLGIPIIALVDTNCDPEIVDIPIPANDDARSSI
RR2_ZYGCR       K-KVP---DIVIFINQHQDYTAIQECIKLGIPTIGLVDTDCDPNLVDMPIPANDDNRTSI
RR2_CRYJA       T-KLP---DIVIILDQKGEYTAIRECRTLGIPTICLVDTDCDPDLVDIPIPANDDGRGPI
RR2_CHAGL       T-KLP---DIVIIIDQQHELTALKECLILGIPTICFVDTDCDPDLTDIPIPANDDSRASI
RR2_PELHO       K-ELP---DIVIILDQHGEFTALRECISLRIPTIGLIDTNCDPDLVDLPIPANDDSIPSI
RR2_PSINU       K-NLP---DIVIIVDQHKELTAIRECMILDIPTICVVDTDCDPDLTNIPIPANDDAQSSI
RR2_ANEMR       T-ALP---DIVIIIDQRKEFTAIRECITLGIPTICLVDTDCDPNVTDIPIPANDDARASI
RR2_CUSOB       T-GLP---DIVIIIDQHKEYTALQECRTLGIPTISLIDTNCDPNLSDIAIPANDDAMASI
RR2_ADICA       S-DLP---DIAIITDQHEQSIALKECSILGIPTICIVDTDCDPDLVDVPIPGNDDARSSI
RR2_TRACE       T-KLP---DFVIIIDQQKDYTALRECIKLGIPTISLIDTNSDPDLASLSIPANDDSRSSI
RR2_MAIZE       T-RLP---DIVIVLDQQKEYIALQECAILGIPTISLVDTNCDPDLANISIPANDDTMTSI
RR2_STAPU       T-RLP---DIVIIIDQQKEATAVEECIKLGIPTICLVDTDCDPDLTDMPIPANDDARSSI
RR2_ANGEV       I-DPP---DIVIIADQHKESTAIKECINLGIPTICVVDTDCDPDLTDIPIPANDDARSSI
RR2_HUPLU       A-SLP---DVVTIVDQREESIAIKECITLNIPTICLVDTDCDPDLADIPIPANDDARASI
RR2_ANTAG       T-NLP---DIVIIVDQQKELTAIRECINLNIPTICLVDTDCDPDLTDISIPANDDARASI
RR2_CYCTA       T-SLP---DIVIIADQQEESTAIGECITLGIPTICLVDTDCDPDLTDIPIPANDDARASI
RR2_EPIVI       T-RLP---DIVIIVDQHEEYKALHECITIGIPTIGLIDTNCDPDLADISIPANDDAISSI
RR2_PHAVU       K-GLP---DIVIIIDQQEEYTALRECITLEIPTICLIDTNSDPDLADISIPANDDAIASI
RR2_AMBTC       T-GLP---DIVIIVDHQEEYTAIRECLTLGIPTICLIDTNCDPDLADIPIPANDDAIASI
                              .         *     :      :::          .         

RS2_UREP2       TLILGVLADSIAELHGE--------------PTKIVGRPDSEIVLPETKSNWKQNNYDPS
RS2_MYCPE       YLLVGLLCDAVAE--AK------------GLPKAFAEKKDEEILLPEVIK----------
RS2_MYCPN       CLLMNLLADAVAEAKAM--------------PTMFAYKPDEEIQIEIPQK----------
RS2_MYCGA       TLLLNLLGDAVALAQGN--------------PAKFAFKPDEEIDIPQLVKKETRTVVNRD
RR2_STIHE       KFLLFNFAKAIQA--GR--------------ALSVLKKKLKNKLTKK-------------
RR2_EUGLO       FFILDFVKYYMLK--GG-------------------------------------------
RS2_MYCAP       TLIMTILADAIAT--AR--------------GGKAKFAYQGDDKVILPEFKTDKTLNP--
RS2_MYCPU       SLILTVLADAIVN--AK--------------GGKDLFAYQDEANIILPEDKKIDSPQRSH
RS2_MYCH7       TLIFTVLADAIAS--AK------------GGKKLFAYQSDENIILPEDPE----------
RS2_MYCMO       NLIITILADAIVA--AK--------------NGKQLFAYQGDEAIVFPATSENVGKDG--
RS2_MYCS5       NLIVNILADAIAKTQGK--------------KQMYAYQPDDKIVLSNPHELKKSEEASE-
RR2_PLETE       NFLFKFFRLAIKK--GR-------------------------------------------
RS2_OPITP       RIIVEAIVAAVQN--GL--------------SQRDARRAARGAADLKAAAAAAAGITGET
RS2_PARUW       KLILETLAKAIID--KK--------------NDIKVYASKEEQTEEAEEETLSSKY----
RS2_CHLMU       RLIVNALKDAIID--TK----------------KRSGFEILSPVRPIERPA---------
RS2_CHLPN       RLIINVIKENIIE--AK--------------HKLGIEIVSPVKSLEVPDLSA--------
RR2_BIGNA       NLILGELQVAINI--GR--------------QKFC-------------------------
RR2_OSTTA       AFILDQLTKD--------------------------------------------------
RS2_RHOBA       EMIMRELADAVIA--GK--------------GQTQTEAAPNAQAAPEAAA----------
RS2_MESFL       NIMINALVDAFAD--GA--------------NLKLAPSVLKTVVVKRERTEGEN------
RS2_MYCCT       NLIINILVEAYAE--GA--------------QIKMNPSVLRTVAPKREPRQINRPVMSSE
RS2_SALRD       ELVTSTLTDAVQE--GL-------------------------------------------
RS2_CHLTE       DLMVKAVADTILE--AR--------------TLQVEQE----------------------
RS2_SULMW       HLIISYLTNSILT--N--------------------------------------------
RS2_CYTH3       SILTQAIGQGIED--AL--------------SERKREKDDAKL-----------------
RS2_FLAPJ       DKILTLVTEAIID--GL--------------ANRTSDKEADTTTEEVAQEEVTDT-----
RS2_GRAFK       SKVVSYVADSIVE--GL--------------SERKSEKSTKKKEEKASKEEKSDKAPKEK
RS2_PORGI       ELIVGTMCQAINE--GL--------------MERKAEKPEEEETEEAAPRRERRARSG--
RS2_BACV8       EVILDACCGAIAE--GL-------------EERKAEKVDMEAAGENAPKGAGKKKNTKAR
RS2_PARD8       EVILGAICEAMNE--GL--------------QERKAEKIDAEAAEEAPKRERKA------
RS2_NEOSM       EYYCSLVADAVLV--GI--------------ESELQRKQSKELDDKADEKAAKVSHSDGQ
RS2_ORITB       RLYCKIFSDAVLL--AI------------EHMLAASGVDLGAINGDNPSERLKAAKKITK
RS2_DICNV       RLYVNAAADTIEH--AK-------------AAAAVRGGDNAEEELAEAISQEEPSA----
RS2_RUTMC       GYYAREIANAILE--AK--------------AATSTSIEKKVSVKKLETKKPGSK-----
RS2_FRAP2       SFYMKKFADAVID--AQ-------------------------------------------
RS2_COXBR       RLYCKAIADTIID--AR--------------SVLELQKDEEAKEEKTKAKTTAKKVVTKK
RS2_LEGPH       DIYVRCVADAILD--GK--------------NSNTVGRVSSDSE----------------
RS2_METCA       QLYAQSAATAILR--GK-----------------ASGVDFGAVADEFVE-----------
RS2_BORA1       ALYAKGIADAVLE--GR--------------EQNLNGLVEE-------------------
RS2_POLAQ       LLYARGIADAILE--GK--------------ANSVQEILT--------------------
RS2_CHRVO       RLYARGIADAVLE--GR---------------A---------------------------
RS2_RHOFT       ILYARGIADAIIE--GR----------------SNAVDDVVKAV----------------
RS2_NITEC       RLYARAMADAILE--GR-------------NQAIQEIVEIG-------------------
RS2_NITMU       RLYARGVADAILE--GR--------------NQAIQEIV---------------------
RS2_THIDA       RLYARGMADAALE--GR--------------AQVISEIVGG-------------------
RS2_JANMA       MLYARGVADAILE--GR----------------ANATNDLV-------------------
RS2_DECAR       QLYARGVADAILE--GR--------------SQVVQDIV---------------------
RS2_XYLFT       QLYARAAADAVLE--GK--------------AAMPNAAAVREEEFASAPDAGKKGR----
RS2_WIGBR       DLYLKTVSETIKN--SK-------------------------------------------
RS2_BUCCC       NLYLNILSDELSK--CY-------------------------------------------
RS2_BLOPB       NLYLNIISNMIHI-----------------------------------------------
RS2_IDILO       QLYLNTAAEAVKE--AR-------------------------------------------
RS2_BUCBP       NLYLNAVSKVIKK-----------------------------------------------
RS2_BAUCH       NLYLTAVAHAISE--GH-------------------------------------------
RS2_PSEA6       QLYLNSAADAVIE--GR-------------------------------------------
RS2_ECOLI       TLYLGAVAATVRE--GR-------------------------------------------
RS2_NITOC       RLYLRGIADGIID--GR--------------TTAAAASASKASKDEFVEM----------
RS2_ALKEH       QLYLSGAADAVLE--AK----------------TATARPG--------------------
RS2_HALHL       ELYVSGIADAVIE--AK--------------QASSHA-----------------------
RS2_ACIAD       TLYASAMADAILA--GK--------------EYAQSQ-----------------------
RS2_HYDCU       SLYLSAAADAINE--GK--------------GSI--------------------------
RS2_CHRSD       QIYAQAVADVCVR--AK-----------------DNSAS---------------------
RS2_ALCBS       QLYVKAAADVILE--GK--------------QYAQNQTGGES------------------
RS2_SACD2       KLYATAVADACIE--GA-----------------ADSAS---------------------
RS2_PSEU5       QLYLGSMADAVLR--GR-----------------QNGAGG--------------------
RS2_MARMS       QLYVGAFADAVLE--GR--------------NAT--------------------------
RS2_DEIRA       QLITHRVGDLLVEARGG--------------HEDVSAGPVEEQSDEAQAAEQ--------
RS2_THET8       QLILSRAVDLIIQ--AR--------------GGVVEPSPSYALVQ---------------
RS2_RICBR       RFYCSLFADAALQ--GL------------EESMKASGVDLGSIQEHGDKNLAPKNVSKL-
RS2_WOLTR       ELYCRLAADSILA--GM------------ESSLARSGVKVGDIKDEEFIQEKGDSIIRTK
RS2_EHRRW       DFFCKIISDTILE--AI------------RSDLAKSGINVDGIKDFSVERREDFLKMNKD
RS2_ANAPZ       DFFCRAVSNTILE--AI--------RSDLMSSGISVAGSVGQAKDGSVVDSGKGKSIAAH
RS2_ANAMM       DFFCRAVSRTILE--AI------------RSDLASSGVNIAAKGSDVAESYAGTAADAGH
RS2_RUBXD       SLITRLIADAVIE--GR--------------GEESAAEERPVPPAVEEAQMVEEGRVPAG
RS2_TROWT       ELLTGIVADAVAQ--GL------------VERHKAPQDDIEPMAEWEKQLLQSGD-----
RS2_BIFLO       ELLTSLMADAVAE--GL------------LERSGANKAEGEAAEQPMAAWEK--------
RS2_SALTO       ELLTKVVAAAVAD--GL------------IARSGRRRGTDEKPEAGVATDEPLAEWEREL
RS2_CLAMS       ALLTRIIADAAAE--GL--------------IQRHQKPDAEGSAPAEPLADWERELLEQG
RS2_LEIXX       SLLTHIVADAAAE--GL----------IQRHQKPEEGVEAAEPLAEWEQELLAQPAAEVQ
RS2_FRAAA       ALLTRVVADAVAD--GL------------MARAGASKAADAKPEQSAGEEPLAEWEQALL
RS2_RHOJR       ALLTKVVASAVAE--GV--------------QARAGLSADKDAKPEAGAGEPLAEWEQEL
RS2_COREF       ALLSRVISTAVEE--GKKAREER--------QLAAAREAAGEPKS---------------
RS2_CORJK       NLLTSIISSAVEA--GR--------------QARAERQEAAAKEAAGDADKAPAEAERTE
RS2_NOCSJ       GLLTRVVADAVAE--GL---------------IARSGVKAGEGAEAVGAEEPLAEWEREL
RS2_KINRD       TLLTRVIADAVAE--GL--------------QVRHGGKSDAAEPLAAWEQDLLAGDEGVQ
RS2_RENSM       NLLTRVIADAVAE--GL-----------IARNAKATGSAEGTAAEPLAEWERELLESSNT
RS2_CUTAK       SLLTRIIADAAAE--GL--------------MARSAGKSGEQPAEAEPMPDWERELL---
RS2_THEFY       SLLTRVVADAVAE--GL--------------MIRSGGAPGSEKGAGEPLAEWERELLEGK
RS2_ZYMMO       RYYCDAIAEAATR--GD----------------QQNRQELG-------------------
RS2_ERYLH       RLYCDAFAQAASK--NG--------------GGA--------------------------
RS2_ROSDO       SLYCDLAARAALD--GM------------SAQLGAAGVDLGAMEEAP-------------
RS2_PARDP       ALYCDLVSRAALD--GM------------TAQMGAAGVDLGALEAS--------------
RS2_ACICJ       TLYCDLVANAVLD--GI------------SAEMAASGADIGAL-----------------
RS2_MAGSA       QTYCDLMSGAVLD--GI------------QAEITRGGGDVGAAAEAPVEQIP--------
RS2_RHORT       QTYCELISGAAID--GI------------QAQLGAAGVDVGAAEIVPA------------
RS2_HYPNA       SLYCNLFADAVLD--GL------------AESTAGLGVDLGASADIASL-----------
RS2_MARMM       SLYCDLIADAVLD--GM------------GDSQLAMGMDLGEAEAPVETLVEAEA-----
RS2_METRJ       ALYCDLIAKAAID--GI------------SRAQGSSGMDLGASEEPMAEELPANDDAAVT
RS2_BEII9       SLYCDLIARAALD--GI------------SRSQGMGGFDAGELEAPVEDLPPVEGEYEAA
RS2_RHOP5       TLYCDLVARAVID--GL------------SRAQGDSGYDAGAMAQPLREELPVVAEARFQ
RS2_AZOC5       QLYCDLVARAAID--GI----GR--------GHVDLGVDLGETEAPLSEGLP--------
RS2_CAUSK       QLYCDLIADAVLD--GL------------AAGQANSGVDLGASIAPIEPTLARELTPEPV
RS2_PARL1       SLYCDLVSRAVID--GI------------SQSQSASGVDV--------------------
RS2_BARBK       SLYCDLFARAALD--GI------------ARQQGAMGVDLGAQAYAPIEPVLEDVAVD--
RS2_CHESB       ALYCDLIAKAAID--GI------------ERQQGSLGVDIGESAAAPSEPALET------
RS2_DEHM1       KLICSKMADSVIE--AQ--------------NALK-------------------------
RS2_BDEBA       KLFSNLVADAYLE--GA-----------KEWEGKLRTMTDKQSDVAKEAKADGKEEAPKR
RS2_SULDN       QLFCREMTEAINE--GK--------------ALRSGGRDEIVAEDSEEVST---------
RS2_CAMHC       QLFCQEMSEAINE--GK--------------ALRDQDSEEEIQNKEQDEVSQEEKDDIL-
RS2_SULNB       NLFCKEMADAIIE--GK----------AA--YAEANGGEAEEVPAGEMEAVMAEAATE--
RS2_ARCB4       HLFCNEMAAAMNE--GK------------AALADETGVEVEPISAEEKEELIAEA-----
RS2_NITSB       QLFCKEMAEAIIE--GK--------------ELREQELEGEEQEEAAPATEEEKKELIE-
RS2_HELPY       RLFCKEMSEAILE--GR--------------ELMQEEIVHANENSEEIEYVSHEEK----
RS2_WOLSU       QLFCKEMAEAIQE--GR------------ALAGSEEGEATEEVTPASEAEKQEVLAEAMS
RS2_BORAP       ALFTKIISDAILE--SD--------------KEVGIQIIENLNEEDLMKEIE--------
RS2_MAGMM       TLFISKMGDSVIE--GM--------------QLAGREIPNSGISAGEGSMEA--------
RS2_SORC5       RLITARVADACVE--GA--------------QRRKDHGEGGQQAAGGGRGQRDEINVYQ-
RS2_TREPA       SLFTQLIANAVME--AG--------------NEHGLKIIENLQDEESGDELDESVSLHEE
RS2_LEPBJ       SLFLETMSNAVIE--GT--------------GGVVEQPRFSEDLDSEALALEYQGEYDES
RS2_ROSS1       RLIAAKIADAAIE--GQ---------------NRRESLQADVHGAGYE------------
RS2_CHLAA       RLMAGKIADAAIE--GT-------------------------------------------
RS2_DESAG       KLFVGHIADACLE--GE--------------AMRKETKAENAEEAMKQAA----------
RS2_LAWIP       KLFVTAMADACIE--GE---------------ALQKDTKNKNLEEELKQIATAECNKEST
RS2_ONYPE       KLIIWLMANACVE--GT--------------GGVAEKAETFDAKNPLKPQNYNAPNKRPY
RS2_DESPS       ---------------QR-------------------------------------------
RS2_PETMO       MLIVSKMADAIIE--GK--------------EGRIETLEESSEVEEEEEEKDEVIDEVDE
RS2_ANADF       RLFTGKIAEACIE--GR------ARYSTWAAQHGEERRPGEEDRDAASERGQKDRRDRRD
RS2_MYXXD       KLFTSKIAEACLE--GA------------ARYRASGAAERDEQEEREGRDDRGDRRDDRR
RS2_PELPD       RLLSSKMADAVIE--GA--------------QARNAALQAEKEGAAD-------------
RS2_PELCD       RLFAAKMADACID--GA--------------QAREAAIRAESDKAETDKVEVEGKGE---
RS2_KORVE       RLFASKIADSVAE--GS--------------QLADKSMIESTNVSNAAEVIPQSYIGDD-
RS2_SOLUE       RLFASKIADAVVE--GR------------ALATEQDFTADKIISDETPAEEGMMEYTEYV
RS2_FUSNN       KLITSVIANAIVE--GN--------------QGIEN------------------------
RS2_AQUAE       KLLTSKIADAVLE--GK--------------QRRESAEEVVPTKERRPV-----------
RS2_SYNFM       RLITSKVADACAE--GR-------------RRLEETEQADHDKEFTALEEVPAGQILKDE
RS2_ACHLI       KLLTWVMANAVVEANGG--------VVEKYEDEENAPFEQDEPRKPSQKPKQNRPENKPR
RS2_SYNAS       KLFSSKFADAVTE--GK--------------RRYEERLQAETDKDAESSTVQ--------
RS2_PSELT       KLITSKIAEAYLE--GR--------------EGVSFTEETPSEPIQSDSSEEEEGS----
RS2_THEMA       KLITSVIADAYLE--GR--------------EGAPLTAEKEETESAEETSEE--------
RS2_THEM4       QLITSKIADAYLE--GK--------------EGVSYQEEPQEQKEEN-------------
RS2_FERNB       ALIASKIADAYLE--GR--------------EGVPYSSEEAAAQPEEKI-----------
RS2_OENOB       KLITSKMADAIIE--GR--------------QGQDAGEDSAEKTFADTAD----------
RS2_LACP7       KLIVAKMADAVIE--AN--------------QGVQL------------------------
RS2_LEUCK       RLITAKMADAIIE--GR--------------QGQDSAPEDAFVAGDEN------------
RS2_LACH4       RLIAGAMADAIVE--GK--------------QGQDDESVEVDFKKN--------------
RS2_PEDPA       RLITAKMADAVIE--GR--------------QGEDEEEASQEVAEGVSKD----------
RS2_LACRD       RLITSKMADAFVE--GK--------------QGQDDAQQETADDNAANETVS--------
RS2_OCEIH       KLLTSKMADAILE--VK--------------QGEETEVVEEEAN----------------
RS2_STAS1       KLLTGKMADAILE--GQ--------------QGVSNEEVAAEQNIDLDESKE--------
RS2_LYSSC       KLLTAKMADALIE-----------------------------------------------
RS2_STRTD       KLITSKMADAIIE--GK--------------QGEDASVDFQEAAA---------------
RS2_ENTFA       KLITAKMADAFIE--GN--------------QGEDQATEELFVEETPEATS---------
RS2_SYMTH       KLLTSKIADAVIE--GR--------------QGVDTSATVDEEEAEVAEETESM------
RS2_CALS4       KLITSKIADAVLE--GK-------------------------------------------
RS2_SYNWW       KLISSRIADAVLE--GK-------------------------------------------
RS2_CLOK5       KLITSKVADAVIE--GR-------------------------------------------
RS2_HUNT2       KLIASKMADAIIE--GR--------------QGEQLSVESTA------------------
RS2_CARHZ       KLITSKIADAVIE--GR-------------------------------------------
RR2_EUGGR       SLILSVLCNSINR--GV----N--------------------------------------
RR2_CYACA       DLIVSKLSTSIFK--AK-------------------------------------------
RR2_CHLVU       RLILAWFQQAIQT--GQ--------------LRSLEREAAKKQKIKKTGVKISGNR----
RR2_OLTVI       QLILTEFLRSILN--GQ-------------------------------------------
RR2_TUPAK       KLLLGEFVTAIKK--GQ--------------QNFAEKLL---------------------
RR2_NEPOL       ELVMREITKGIEE--GQ--------------WIQKEGREEATIEIEWFVVEPTPVEKP--
RR2_CYAM1       QLILSCLADAILK--GK-------------------------------------------
RR2_PHATC       KLILKSLTDSILI--GK-------------------------------------------
RS2_GLOVI       RLIVGKLADAIYE--GR--------------HGQLEDFSEEEPVPAAAPVAA--------
RR2_CHLAT       NLIISKLADAIYE--GQ-------------------------------------------
RR2_EMIHU       KLIISTLADGILE--GK-------------------------------------------
RS2_SYNJA       KLIVGKLADAIYE--GR--------------HGQLDTVEEDEYDYEGAMDMDLEDDI---
RR2_RHDSA       KLILGKIADSISE--GN-------------------------------------------
RR2_PYRYE       KLIVGKIADAIYD--GK-------------------------------------------
RR2_GRATL       KLIISRIADSIIE--GS-------------------------------------------
RS2_SYNR3       QLIIGRLADAINE--GR-------------------------------------------
RS2_SYNY3       KLIVGKLADAIYE--GR--------------HGQPDVSDDYEEFDEGLDGDNLEVEAAE-
RS2_MICAN       KLILGKISDAIIE--GR--------------RGGQAAVEEYEEDYDNETEYEEEG-----
RR2_CYAPA       KLIIGKLADAILE--GS-------------------------------------------
RS2_THEEB       KLIVGKLADAIYE--GR--------------HGQLEEPEADLADEDDNGMTTS-------
RS2_SYNE7       KLIVSKLADAIYE--AR--------------HGAAPVAEEY-------------------
RS2_ACAM1       KLIIGKLADAIYE--GR--------------HGQVSAETFEGDDIPSAIDFEDETPEPVA
RS2_TRIEI       KLIVGKLADAIYE--GR--------------HGQLEADYEDYYEDYEEYEDDYEGAEGDL
RR2_CHAVU       RWILSKLTAAIRD--NR-----F-------------------------------------
RR2_ZYGCR       RWILSQLTTAIKE--GR-------------------------------------------
RR2_CRYJA       RLILNKLILAIRA--GR-------------------------------------------
RR2_CHAGL       QWILNKLTNSIRE--GR-------------------------------------------
RR2_PELHO       RFILNKLILAICK--GR---------------SRR-------------------------
RR2_PSINU       RWILNQLTLAIRE--GR-------------------------------------------
RR2_ANEMR       KWISNKLTLAICE--GR-------------------------------------------
RR2_CUSOB       RFILNKLVFAICQ--GY-------------------------------------------
RR2_ADICA       RWILDKLALAISE--GR-------------------------------------------
RR2_TRACE       KFILNKLVFAIRE--GR-------------------------------------------
RR2_MAIZE       RLILNKLVFAISE--GR-------------------------------------------
RR2_STAPU       RWILDKLTTAIRE--GR-------------------------------------------
RR2_ANGEV       RWILNKLTFAIHE--GQ-------------------------------------------
RR2_HUPLU       RWISDKLASAICE--GR-------------------------------------------
RR2_ANTAG       RWVLDKLTSAIQE--GR-------------------------------------------
RR2_CYCTA       RLILNKLTSSICE--GH-------------------------------------------
RR2_EPIVI       RLILNKLVFAICE--GR-------------------------------------------
RR2_PHAVU       RFILNKLVFAICE--GR-------------------------------------------
RR2_AMBTC       QLILNKLVLAIRE--GH-------------------------------------------
                                                                            

RS2_UREP2       KRGYNP-----------------------------KYVNHKSTFNKFNNKK---------
RS2_MYCPE       -----------------------------------RKPENRRQNNHSFNKN---------
RS2_MYCPN       -----------------------------------QEAPRQVVNRANSKQI---------
RS2_MYCGA       RAGFNKKQ---------------------------PKAEEAAKPAEKKAEK---------
RR2_STIHE       -----------------------------------KQTKSRAKVFLKEKKL---------
RR2_EUGLO       -----------------------------------KKISKRLVFN---------------
RS2_MYCAP       -----------------------------------RFMNQRRSFEQNSAEG---------
RS2_MYCPU       FNNTRFDQSSSREHRDSW-----------------RRNSQNTSQNQEQSQR---------
RS2_MYCH7       -----------------------------------KELKQTRYRNNSFEKF---------
RS2_MYCMO       -----------------------------------EERKPRKPYVKRRPDG---------
RS2_MYCS5       -----------------------------------VKAASTKEKLTEEASQ---------
RR2_PLETE       -----------------------------------NKRQQLTIN----------------
RS2_OPITP       AATPEVDLSKV------------------------ELPADVAAVVEGEGES---------
RS2_PARUW       -----------------------------------REQDFQEAKSGARGEK---------
RS2_CHLMU       -----------------------------------EEIVEGLPLPNEAQND---------
RS2_CHLPN       -----------------------------------FESSQDDESDEENREE---------
RR2_BIGNA       -----------------------------------ENLKTWKNSSSILKQI---------
RR2_OSTTA       ------------------------------------------------------------
RS2_RHOBA       -----------------------------------PAEQPAEEAAAASSEG---------
RS2_MESFL       -----------------------------------NYSNNRSWNKPERTNN---------
RS2_MYCCT       -----------------------------------NQAEQQTSVANENVQM---------
RS2_SALRD       -----------------------------------QERRMKKEEKKKAAA----------
RS2_CHLTE       -----------------------------------VLAEMDEAAEEETAND---------
RS2_SULMW       ------------------------------------------------------------
RS2_CYTH3       -----------------------------------KEDEESKKASDKAEIQ---------
RS2_FLAPJ       -----------------------------------KADEKAIVAEAAKTKE---------
RS2_GRAFK       KEKKA------------------------------EVPSKDAEDKKAMKEA---------
RS2_PORGI       -----------------------------------ARRSRQNENEATAEAA---------
RS2_BACV8       MDKAEEEA---------------------------INAAKAAAFLKEDEEA---------
RS2_PARD8       -----------------------------------KAAVKKERTKKEDDDA---------
RS2_NEOSM       KKGASI-----------------------------RAGTDKAALQKRKVSP---------
RS2_ORITB       MKLSKKVTKI-------------------------NVEQDQNKLEKDNKDL---------
RS2_DICNV       -----------------------------------AEELPDDMADNENEFE---------
RS2_RUTMC       -----------------------------------KTPIEQVPAKEEIIKT---------
RS2_FRAP2       -----------------------------------GLDRAVEAKAEETTEA---------
RS2_COXBR       AKVAEKAQAAAEKKS--------------------EKPTTEKRPTKEAAET---------
RS2_LEGPH       -----------------------------------FVEVTSNSNEEEKSGE---------
RS2_METCA       -----------------------------------MEPETEQGATGETLGG---------
RS2_BORA1       -----------------------------------IVEGEEEFVEVQDGQA---------
RS2_POLAQ       -----------------------------------AVKEGEEEFVEEGKAE---------
RS2_CHRVO       -----------------------------------HSLQEIVAAAETAQAE---------
RS2_RHOFT       -----------------------------------VAESSDEFVEVNETAA---------
RS2_NITEC       -----------------------------------KTDSEVLSGQDLSADA---------
RS2_NITMU       -----------------------------------QGDFEEADEAVAGEQG---------
RS2_THIDA       -----------------------------------EEFVEVEEEEGGVAAE---------
RS2_JANMA       -----------------------------------ESIKGGDDFVEVSEQA---------
RS2_DECAR       -----------------------------------AAGGDDEFVEVQDAAQ---------
RS2_XYLFT       -----------------------------------QAQPKKGKRASDAAAE---------
RS2_WIGBR       ------------------------------------ISNKEINKKIIIKNN---------
RS2_BUCCC       -----------------------------------KEKKESIILKNRLKEQ---------
RS2_BLOPB       ----------------------------------------------NACNT---------
RS2_IDILO       ----------------------------------TAQVEAKDSDDFVEATE---------
RS2_BUCBP       -----------------------------------NVKNEK-------------------
RS2_BAUCH       --------------------------------------------QKNALEI---------
RS2_PSEA6       ---------------------------------EKNIEVQAEEGEFVEAAE---------
RS2_ECOLI       -----------------------------------SQDLASQAEESFVEAE---------
RS2_NITOC       -----------------------------------EEASEEETLTESLSEK---------
RS2_ALKEH       -----------------------------------GDDDFVEVDEATEQQG---------
RS2_HALHL       -----------------------------------AAAGKDDFVEINDTAS---------
RS2_ACIAD       -----------------------------------ANAQAKGEEAPAASEA---------
RS2_HYDCU       -----------------------------------TTAVEGDEFVEEKAEA---------
RS2_CHRSD       -----------------------------------EFVEVTETNENEAAAE---------
RS2_ALCBS       -----------------------------------EFVEVADEAAGEKAEG---------
RS2_SACD2       -----------------------------------VPNKDEFVEEKAADAE---------
RS2_PSEU5       ------------------------------------ADEFVEEVASEAAQG---------
RS2_MARMS       -----------------------------------AGTADEFVEVSEATEA---------
RS2_DEIRA       -----------------------------------GTEGDTAQLTSSQGRS---------
RS2_THET8       -----------------------------------EAEATETPEGESEVEA---------
RS2_RICBR       -----------------------------------KQAKKFSKTKNINEEA---------
RS2_WOLTR       KGRSKV-----------------------------YKEDEKEVVTNEDESR---------
RS2_EHRRW       NKSNKSNTINAD-----------------------ENIKESDLIGGSNNEG---------
RS2_ANAPZ       KGGGKASKGAAEVVAG-------------------GSVVSASGGEDAVVQE---------
RS2_ANAMM       TPVSETLSAGGPTAGASPYIPEVGPSVVEVDTHKSAALPDSRPNDADVPAE---------
RS2_RUBXD       GEEQPGEPEAEAFEEA-------------------AGEPEDSTEEEAAEEQ---------
RS2_TROWT       -----------------------------------SSGETRPISGTDRPLD---------
RS2_BIFLO       -----------------------------------ELLTNEAPAEASAEAA---------
RS2_SALTO       L----------------------------------EEPKKSDEQPAKSDEL---------
RS2_CLAMS       DAAKAALPVEENDVDAEVSAKNEAKSDDEVPAPVHAPESDDATEAKIEAEA---------
RS2_LEIXX       ASAET------------------------------EKAADADLAEAKADSA---------
RS2_FRAAA       RGEGTA-----------------------------PAASEEQPAEEPAPAA---------
RS2_RHOJR       LSQA-------------------------------APAAEAAPAAEAAPAA---------
RS2_COREF       -----------------------------------EDAPAEAAATEEAPAT---------
RS2_CORJK       APAEEA-----------------------------PAEAQSEAKAEGNTEA---------
RS2_NOCSJ       LGGEAEQAAVDATG---------------------GAATEETPAAESTGAA---------
RS2_KINRD       SGGSESVATVEGSTAPEAA----------------QAEAAEGQPAEAAAEA---------
RS2_RENSM       EAPVA------------------------------ETAAAEAPVADAAIEA---------
RS2_CUTAK       -----------------------------------EGDGAKTEAKAEEPKA---------
RS2_THEFY       T----------------------------------EAAGEEATPAAEAPAK---------
RS2_ZYMMO       -----------------------------------EDLGAAVEPAAEEALA---------
RS2_ERYLH       -----------------------------------NVGEMENPPVEATADA---------
RS2_ROSDO       -----------------------------------VEEAVAAEAPAEEAQA---------
RS2_PARDP       -----------------------------------VEEELTGETAEEAAEA---------
RS2_ACICJ       -----------------------------------EELPAEAVDEDAEAHA---------
RS2_MAGSA       -----------------------------------EVVAEAAAEEAAAPQA---------
RS2_RHORT       -----------------------------------ETLAAEAPAAEQQPTA---------
RS2_HYPNA       -----------------------------------ADADVKLADEEAAGEA---------
RS2_MARMM       -----------------------------------EVVAEAAPAAEEAPAA---------
RS2_METRJ       VESDALDPADVAMLAESTEHFELLAAPRGAPDDLTKLNGAGPQIVQKLNDA---------
RS2_BEII9       PTEIFELLDAPRGAPDDLA----------------KLPGSGPQIVKKLNDA---------
RS2_RHOP5       GLAGPRGVADDLKKLTGVSGAIEKKFNDLGIFHFWQLAELDHDTAHKISEE---------
RS2_AZOC5       ------------AEPSLWSTFEPLSGPRGVADDLKKLTGVSPEIEQKLNDL---------
RS2_CAUSK       AEAAAPEVAAAEVAEQEAAFE--------------AAAAPAAPAVEPAPEA---------
RS2_PARL1       -----------------------------------GAEAEPAVEIPAAAEA---------
RS2_BARBK       -----------------------------------TSAADLISEDTTPVSN---------
RS2_CHESB       -----------------------------------ASAEATAEGEQPGSQA---------
RS2_DEHM1       -----------------------------------VTEVETTGEAQAETAG---------
RS2_BDEBA       RGAGA------------------------------KAGAKEAPKKSAGPAV---------
RS2_SULDN       -----------------------------------VDADAITAEDFETEEV---------
RS2_CAMHC       -----------------------------------DEAMNEEDFEIPEDKE---------
RS2_SULNB       -ETAAPAT---------------------------EAEVEKLVEEKAAPKAAAAEKKGDD
RS2_ARCB4       -----------------------------------VAEGEEFNFAEEGENA---------
RS2_NITSB       -----------------------------------EAVAEGEAEETEEEEK---------
RS2_HELPY       -----------------------------------EEMLAEIQKEITQGAE---------
RS2_WOLSU       E----------------------------------EGDALQESEVVEEEEK---------
RS2_BORAP       -----------------------------------IKNDKSDSIEEGGNNL---------
RS2_MAGMM       -----------------------------------QMLSQAGEGEMQSAEA---------
RS2_SORC5       -----------------------------------GGRGGRGGGPRQQQAS---------
RS2_TREPA       GR---------------------------------EITDYENYTPPEEREY---------
RS2_LEPBJ       GK---------------------------------FIMDEDADSKKSKAEE---------
RS2_ROSS1       -----------------------------------QEMTAQLIAREAEAVE---------
RS2_CHLAA       -------------------------------------------RRREMSQE---------
RS2_DESAG       -----------------------------------EAEAEAAAPAAEESAE---------
RS2_LAWIP       SIEQEL-----------------------------IIASEQTETKENNIEE---------
RS2_ONYPE       Q----------------------------------DSPRKPSYQNQNQNQI---------
RS2_DESPS       ------------------------------------------------------------
RS2_PETMO       KL---------------------------------EAEEKYASYAEEVEEV---------
RS2_ANADF       RRGGG------------------------------RDRERREPREDRAAAS---------
RS2_MYXXD       GPRRGDRRDDRRDRGGD------------------RGGDRRGPLVEMKGAA---------
RS2_PELPD       -----------------------------------AETAGEQVVEEEVAQA---------
RS2_PELCD       -----------------------------------APAAEAAEVVESADKA---------
RS2_KORVE       -----------------------------------EEHGLAQPTEEAAPVE---------
RS2_SOLUE       DPKYAEKIMAES-----------------------LSMAEEPAPPSQRKGP---------
RS2_FUSNN       -----------------------------------VEPQSEEVNVEEGSAE---------
RS2_AQUAE       -----------------------------------EITERERQLFEQAVEM---------
RS2_SYNFM       ASG--------------------------------PIVEIVNPVAEAEEEQ---------
RS2_ACHLI       FDKQAPRAAAKPEVKA-------------------EVKPEVKPEVKVEAKV---------
RS2_SYNAS       -----------------------------------QEENPEADIPESIETK---------
RS2_PSELT       -----------------------------------LDISDLFEDTDLKEEE---------
RS2_THEMA       -----------------------------------VTEDINLEELEEEEEV---------
RS2_THEM4       -----------------------------------SEEIFDIEDEEESEEI---------
RS2_FERNB       -----------------------------------EEIEINIPEGIGEEEI---------
RS2_OENOB       -----------------------------------GEGDFEESSNNENQEA---------
RS2_LACP7       -----------------------------------TDSTDVAEEATETVEA---------
RS2_LEUCK       -----------------------------------TESIEEIANIVEEGNN---------
RS2_LACH4       -----------------------------------ADGSEEIVSAEENPED---------
RS2_PEDPA       -----------------------------------SLEDLKKSVEEGSNEE---------
RS2_LACRD       -----------------------------------EDSLKNLKNSVEGKED---------
RS2_OCEIH       -----------------------------------EAVAEEEAAEEVSTQE---------
RS2_STAS1       -----------------------------------ATEAETTEENTSVESN---------
RS2_LYSSC       -----------------------------------SKQGEEEAPAVEAAAE---------
RS2_STRTD       -----------------------------------ADSIEEIVEVVEGDNN---------
RS2_ENTFA       -----------------------------------IEEIVDVVEGNNESAE---------
RS2_SYMTH       -----------------------------------ESAEDLDADLIEEEAE---------
RS2_CALS4       -----------------------------------QGEQFEAAEE---------------
RS2_SYNWW       -----------------------------------QGEQITT------------------
RS2_CLOK5       -------------------------------------------QGEQLAEE---------
RS2_HUNT2       -----------------------------------QEQVEETAQEETAVEA---------
RS2_CARHZ       -----------------------------------QGEQYAE------------------
RR2_EUGGR       -----------------------------------NKVRQKFDKYKKFKKL---------
RR2_CYACA       -----------------------------------LENNQFIENSTENLNE---------
RR2_CHLVU       -----------------------------------RTSSITKKRNPASSKI---------
RR2_OLTVI       -------------------------------------QMFSEKQQRGKKTA---------
RR2_TUPAK       -----------------------------------LSSDLKKQIKKQRSRR---------
RR2_NEPOL       -----------------------------------LVIIEPPPVEKPVLSK---------
RR2_CYAM1       -----------------------------------SI-----------------------
RR2_PHATC       --------------------------------------------------S---------
RS2_GLOVI       -----------------------------------VAVAVAAPAEAESEDK---------
RR2_CHLAT       -----------------------------------GIK----------------------
RR2_EMIHU       -----------------------------------QSYQ---------------------
RS2_SYNJA       -----------------------------------LEDVEDEEEGDPEQGE---------
RR2_RHDSA       ---------------------------------NGKVSSDQEDTQELQTVQ---------
RR2_PYRYE       ----------------------------------YGQTDLEEITHPTQSEL---------
RR2_GRATL       -----------------------------------TYALNK-------------------
RS2_SYNR3       -----------------------------------------HGSNDQGDEG---------
RS2_SYNY3       -----------------------------------EVEEAAEAEVAATPEA---------
RS2_MICAN       -----------------------------------DYSQYAAEFASGDDDN---------
RR2_CYAPA       -------------------------------------------HTKTSSAE---------
RS2_THEEB       -----------------------------------DDGDAEALDIPDDSDA---------
RS2_SYNE7       -----------------------------------DYDGAEDEYEDDADEA---------
RS2_ACAM1       EVADAEVAAA-------------------------EPVAEAAPTAEAAPEE---------
RS2_TRIEI       DL---------------------------------DSANEEESLEDNNEEE---------
RR2_CHAVU       ------------------------------------------------------------
RR2_ZYGCR       -----------------------------------STSLKQ-------------------
RR2_CRYJA       -----------------------------------ELYYKK-------------------
RR2_CHAGL       -----------------------------------AFSKNDSIN----------------
RR2_PELHO       -----------------------------------TITSRPSHIKKKEKNR---------
RR2_PSINU       -----------------------------------------CHSMSPKNSK---------
RR2_ANEMR       -----------------------------------LNSNANCMNS---------------
RR2_CUSOB       -----------------------------------FSQLRKP------------------
RR2_ADICA       -----------------------------------SNIKVT-------------------
RR2_TRACE       -----------------------------------YESIGNSGLKKRKRTY---------
RR2_MAIZE       -----------------------------------SLYIRNR------------------
RR2_STAPU       ---------------------------------------NRVT-----------------
RR2_ANGEV       ------------------------------------------SNYMLSKDS---------
RR2_HUPLU       -----------------------------------KSYMKD-------------------
RR2_ANTAG       ---------------------------------------------CNSTKI---------
RR2_CYCTA       ----------------------------------------YSSMKGESMKS---------
RR2_EPIVI       -------------------------------------------SGYIIKNI---------
RR2_PHAVU       --------------------------------------------SRSIRNS---------
RR2_AMBTC       --------------------------------------------YSYLGSH---------
                                                                            

RS2_UREP2       ------------PVDSTTNEIKTNVIKAETK-----------------------------
RS2_MYCPE       ------------------------------------------------------------
RS2_MYCPN       ------------TSQRLNITRNPEVLTRE-------------------------------
RS2_MYCGA       ------------------------------------------------------------
RR2_STIHE       ------------------------------------------------------------
RR2_EUGLO       ------------------------------------------------------------
RS2_MYCAP       ------------VKTVEKTTTSTEVAE---------------------------------
RS2_MYCPU       ------------PYKRTYNKDSRETLDKKTKEEVK-------------------------
RS2_MYCH7       ------------ARQKNTLKDSQVLKPNTEIQA---------------------------
RS2_MYCMO       ------------DFQPRHNNNESETK----------------------------------
RS2_MYCS5       ------------------------------------------------------------
RR2_PLETE       ------------------------------------------------------------
RS2_OPITP       ------------EAEPVVAKKKPVRAKRPAVKAE--------------------------
RS2_PARUW       ------------------------------------------------------------
RS2_CHLMU       ------------ANSKEGFLVWTDTDNSEALR----------------------------
RS2_CHLPN       ------------DLLAKKFDGEAN------------------------------------
RR2_BIGNA       ------------------------------------------------------------
RR2_OSTTA       ------------------------------------------------------------
RS2_RHOBA       ------------------------------------------------------------
RS2_MESFL       ------------------------------------------------------------
RS2_MYCCT       ------------TNEPVVQVAEVEKPSEPKAE----------------------------
RS2_SALRD       ------------------------------------------------------------
RS2_CHLTE       ------------------------------------------------------------
RS2_SULMW       ------------------------------------------------------------
RS2_CYTH3       ------------------------------------------------------------
RS2_FLAPJ       ------------------------------------------------------------
RS2_GRAFK       ------------KNDVKLESKSETLDKAKASNEEE-------------------------
RS2_PORGI       ------------TEVAEAPEAEEAE-----------------------------------
RS2_BACV8       ------------------------------------------------------------
RS2_PARD8       ------------LNANVAGKFAKDEE----------------------------------
RS2_NEOSM       ------------KSEKQDNVDAAKLPENKG------------------------------
RS2_ORITB       ------------------------------------------------------------
RS2_DICNV       ------------------------------------------------------------
RS2_RUTMC       ------------SIKEDKPETLNKIALNTMKKADLIAYAETQGVTINSTDTKAQTIEKLA
RS2_FRAP2       ------------------------------------------------------------
RS2_COXBR       ------------KETSEEPKTKEVQQPIEASKAEAEEGK---------------------
RS2_LEGPH       ------------------------------------------------------------
RS2_METCA       ------------------------------------------------------------
RS2_BORA1       ------------------------------------------------------------
RS2_POLAQ       ------------------------------------------------------------
RS2_CHRVO       ------------------------------------------------------------
RS2_RHOFT       ------------------------------------------------------------
RS2_NITEC       ------------------------------------------------------------
RS2_NITMU       ------------------------------------------------------------
RS2_THIDA       ------------------------------------------------------------
RS2_JANMA       ------------------------------------------------------------
RS2_DECAR       ------------------------------------------------------------
RS2_XYLFT       ------------------------------------------------------------
RS2_WIGBR       ------------------------------------------------------------
RS2_BUCCC       ------------------------------------------------------------
RS2_BLOPB       ------------------------------------------------------------
RS2_IDILO       ------------------------------------------------------------
RS2_BUCBP       ------------------------------------------------------------
RS2_BAUCH       ------------------------------------------------------------
RS2_PSEA6       ------------------------------------------------------------
RS2_ECOLI       ------------------------------------------------------------
RS2_NITOC       ------------SASTDASVT---------------------------------------
RS2_ALKEH       ------------------------------------------------------------
RS2_HALHL       ------------------------------------------------------------
RS2_ACIAD       ------------------------------------------------------------
RS2_HYDCU       ------------------------------------------------------------
RS2_CHRSD       ------------------------------------------------------------
RS2_ALCBS       ------------------------------------------------------------
RS2_SACD2       ------------------------------------------------------------
RS2_PSEU5       ------------------------------------------------------------
RS2_MARMS       ------------------------------------------------------------
RS2_DEIRA       ------------------------------------------------------------
RS2_THET8       ------------------------------------------------------------
RS2_RICBR       ------------NTEFEQALSDADEDKN--------------------------------
RS2_WOLTR       ------------------------------------------------------------
RS2_EHRRW       ------------------------------------------------------------
RS2_ANAPZ       ------------------------------------------------------------
RS2_ANAMM       -----------DGVLPDPGVADGAALE---------------------------------
RS2_RUBXD       ------------AASQAAPVGEGDESEER-------------------------------
RS2_TROWT       ------------GDLSKGPAPQDEELSD--------------------------------
RS2_BIFLO       ------------APAAAEGETAEAPKAE--------------------------------
RS2_SALTO       ------------PVKTDEQPTKSDEQPAAAAAE---------------------------
RS2_CLAMS       ------------TEAEAAPATTGPVSE---------------------------------
RS2_LEIXX       ------------AVVAEGEAAADAVAETPAE-----------------------------
RS2_FRAAA       ------------AEAQTDAAVGTAV-----------------------------------
RS2_RHOJR       ------------EAAPAAEAQAAPAAEAPAAEAPSTEA----------------------
RS2_COREF       ------------EAPAAEAQQENAAE----------------------------------
RS2_CORJK       ------------------------------------------------------------
RS2_NOCSJ       ------------SEAAAVSEAAEPATEQPAADAEA-------------------------
RS2_KINRD       ------------GDTAEAPVAGDEAPAEAAAQV---------------------------
RS2_RENSM       ------------PVAEEAKTTEADDTK---------------------------------
RS2_CUTAK       ------------EAKKADEAPEAEKSN---------------------------------
RS2_THEFY       ------------EEKAQAPEEKKEAGSGEEA-----------------------------
RS2_ZYMMO       ------------------------------------------------------------
RS2_ERYLH       ------------------------------------------------------------
RS2_ROSDO       ------------------------------------------------------------
RS2_PARDP       ------------------------------------------------------------
RS2_ACICJ       ------------------------------------------------------------
RS2_MAGSA       ------------------------------------------------------------
RS2_RHORT       ------------------------------------------------------------
RS2_HYPNA       ------------------------------------------------------------
RS2_MARMM       ------------EAEAAATDTSSESDKTEA------------------------------
RS2_METRJ       ------------GIYHYWQLAAMTPEDVAKVDADLKLNGRIDRDSWVSQARGFVEAAAAA
RS2_BEII9       ------------GIFHYWQVAAMTPEDVAKLDHDLKLSGRIERDGWVNQARSLIAS----
RS2_RHOP5       ------------VGLPSRADAWVAQAKTLTEAE---------------------------
RS2_AZOC5       ------------GVFHFSQIAGLDSVDAQRVGEEVGLPGRV--DGWIAQAKEFSAEAE--
RS2_CAUSK       ------------AQEATAEAIEAVAEEPAAS-----------------------------
RS2_PARL1       ------------------------------------------------------------
RS2_BARBK       ------------------------------------------------------------
RS2_CHESB       ------------------------------------------------------------
RS2_DEHM1       ------------------------------------------------------------
RS2_BDEBA       -----------VKATKSRKLVAAGTAEEVEIQAELEQGQSTDESAE--------------
RS2_SULDN       ------------------------------------------------------------
RS2_CAMHC       ------------------------------------------------------------
RS2_SULNB       LTKIAGVGKVYAGKLNDEGFYTFNDVANMTDEQINVMEEKYSFKGNFRDAVASAKELAEA
RS2_ARCB4       ------------------------------------------------------------
RS2_NITSB       ------------------------------------------------------------
RS2_HELPY       ------------------------------------------------------------
RS2_WOLSU       ------------------------------------------------------------
RS2_BORAP       ------------------------------------------------------------
RS2_MAGMM       ------------------------------------------------------------
RS2_SORC5       ------------------------------------------------------------
RS2_TREPA       ------------SVNDEGDVFDEDESLYEGR-----------------------------
RS2_LEPBJ       ------------PVIPTAEEPAITTIEVDQNE----------------------------
RS2_ROSS1       ------------------------------------------------------------
RS2_CHLAA       ------------------------------------------------------------
RS2_DESAG       ------------------------------------------------------------
RS2_LAWIP       ------------SVSEVVITNESELITE--------------------------------
RS2_ONYPE       ------------------------------------------------------------
RS2_DESPS       ------------------------------------------------------------
RS2_PETMO       ------------EEEFIPSEIEDEDEKF--------------------------------
RS2_ANADF       ------------ANVEVVRKGEVTPAQPAPGSDANR------------------------
RS2_MYXXD       ------------PVASAEPAAEAAPEGEAAAE----------------------------
RS2_PELPD       ------------------------------------------------------------
RS2_PELCD       ------------------------------------------------------------
RS2_KORVE       ------------EEINMEEVLGKGVRKQPVSENENVEAAAAEQK----------------
RS2_SOLUE       ------------ASETAEPVAEPAVTESGS------------------------------
RS2_FUSNN       ------------------------------------------------------------
RS2_AQUAE       ------------SEKYAELDKDSTEYE---------------------------------
RS2_SYNFM       ------------------------------------------------------------
RS2_ACHLI       ------------APKVVAEVKPTEDLSTLKVAELKELAKAKGIENYSKLRKAELVEALSK
RS2_SYNAS       ------------ESVSAAADSDLDENE---------------------------------
RS2_PSELT       ------------------------------------------------------------
RS2_THEMA       ------------------------------------------------------------
RS2_THEM4       ------------------------------------------------------------
RS2_FERNB       ------------------------------------------------------------
RS2_OENOB       ------------------------------------------------------------
RS2_LACP7       ------------------------------------------------------------
RS2_LEUCK       ------------------------------------------------------------
RS2_LACH4       ------------------------------------------------------------
RS2_PEDPA       ------------------------------------------------------------
RS2_LACRD       ------------------------------------------------------------
RS2_OCEIH       ------------------------------------------------------------
RS2_STAS1       ------------------------------------------------------------
RS2_LYSSC       ------------------------------------------------------------
RS2_STRTD       ------------------------------------------------------------
RS2_ENTFA       ------------------------------------------------------------
RS2_SYMTH       ------------------------------------------------------------
RS2_CALS4       ------------------------------------------------------------
RS2_SYNWW       ------------------------------------------------------------
RS2_CLOK5       ------------------------------------------------------------
RS2_HUNT2       ------------------------------------------------------------
RS2_CARHZ       ------------------------------------------------------------
RR2_EUGGR       ----------S-------------------------------------------------
RR2_CYACA       -------HVK--------------------------------------------------
RR2_CHLVU       ------------------------------------------------------------
RR2_OLTVI       ------------------------------------------------------------
RR2_TUPAK       ------------------------------------------------------------
RR2_NEPOL       ------------------------------------------------------------
RR2_CYAM1       ------------------------------------------------------------
RR2_PHATC       ------------------------------------------------------------
RS2_GLOVI       ------------GEVLYSFDDEEE------------------------------------
RR2_CHLAT       ------------------------------------------------------------
RR2_EMIHU       ------------------------------------------------------------
RS2_SYNJA       ------------------------------------------------------------
RR2_RHDSA       ------------------------------------------------------------
RR2_PYRYE       ------------------------------------------------------------
RR2_GRATL       ------------------------------------------------------------
RS2_SYNR3       ------------------------------------------------------------
RS2_SYNY3       ------------------------------------------------------------
RS2_MICAN       ------------------------------------------------------------
RR2_CYAPA       ------------------------------------------------------------
RS2_THEEB       ------------------------------------------------------------
RS2_SYNE7       ------------------------------------------------------------
RS2_ACAM1       ------------APAEDAAPTAEAEEPAAE------------------------------
RS2_TRIEI       ------------------------------------------------------------
RR2_CHAVU       ------------------------------------------------------------
RR2_ZYGCR       ------------------------------------------------------------
RR2_CRYJA       ------------------------------------------------------------
RR2_CHAGL       ------------------------------------------------------------
RR2_PELHO       ------------------------------------------------------------
RR2_PSINU       ------------------------------------------------------------
RR2_ANEMR       ------------------------------------------------------------
RR2_CUSOB       ------------------------------------------------------------
RR2_ADICA       ------------------------------------------------------------
RR2_TRACE       ------------------------------------------------------------
RR2_MAIZE       ------------------------------------------------------------
RR2_STAPU       ------------------------------------------------------------
RR2_ANGEV       ------------------------------------------------------------
RR2_HUPLU       ------------------------------------------------------------
RR2_ANTAG       ------------------------------------------------------------
RR2_CYCTA       ------------------------------------------------------------
RR2_EPIVI       ------------------------------------------------------------
RR2_PHAVU       ------------------------------------------------------------
RR2_AMBTC       ------------------------------------------------------------