CLUSTAL format seed alignment for MF_00293

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSBN_SYNJA      --MEST-------LSLVVAIAAITICITAFAIYTAFGPPSKNLQDPYEMHED
PSBN_SYNJB      --MEPT-------FSLIVAIAAVTICITAFAIYTAFGPPSKDLQDPYEMHED
PSBN_GLOVI      --MTVA-------QVFVVGILVALVLITAFAVYTAFGPPSKKLADPFEMHED
PSBN_CHAGL      --METG------ILV-VIFISCLLVSFTGYTIYTAFGQPSKQLRDPFEEHED
PSBN_COLOB      --METG------ILI-VIFISCLLVSFTGYAVYTAFGQPSKKLRDPFEEHED
PSBN_STAPU      --META------TLV-VIFISCLLVSFTGYALYTAFGQPSKELRDPFEEHED
PSBN_ANTAG      --META------TLV-AIFISCLLVSFTGYAPYTASGQPSNELRDLFEEHED
PSBN_MARPO      --META------TFV-AIFISCLLISFTGYALYTAFGQPSNELRDPFEEHED
PSBN_SPHCU      --META------TLV-AIPISCLLVSFTGYALYTAFGQPSRELRDPFEEHED
PSBN_PSINU      --META------TLI-AIFISCLIVSFTGYALYTAFGQPSKELRDPFEEHED
PSBN_WELMI      --META------TLV-TISISCLLVSFTGYAIYTSFGRPSEQLRDPFEDHED
PSBN_PINTH      --META------TLV-TISISCLLVSFTGYALYTAFGQPSKQLRDPFEDHED
PSBN_THUPL      --META------TLF-AISISCLLVSFTGYALYTAFGQPSEQLRDPFEEHED
PSBN_EPHSI      --META------NLV-AIFVSCLLVSLTGYALYTSFGRPSEGLIDPFDNHED
PSBN_ADICA      MATETA------TLV-TTFLSRSLVSFTGYALYTAFGKPSKELRDPFEEHED
PSBN_SPIMX      --META------ALV-TIFLSCLLVSFTGYALYTAFGEPSKELRDPFEEHED
PSBN_KLEBI      --MEPA------TLI-TIFLSCFLVGVTGYALYTAFGQPSKELRDPFEEHED
PSBN_MESVI      --META------TIF-SIFFSCLLIGLTGYSLYTSFGNASSELRDPFEEHED
PSBN_CYACA      --MEKA------LIL-SIFIFSLLLGITSYSIYISFGPLSKTLRDPFEEHEE
PSBN_GRATL      --MQTA------TVL-SIFISSLLLGITIYSIYISFGPISRELRDPFEEHEE
PSBN_PORPU      --META------TVL-SIFISSLLLGITGYSIYTAFGPASKDLRDPFEEHEE
PSBN_EMIHU      --META------TIL-SIFILGLLLGVTGYSVYTAFGPVSKGLRDPFEEHEE
PSBN_GUITH      --META------TVL-IIFIASLLLGLTGYSIYTAFGPNSKELRDPFDDHED
PSBN_CYAPA      --MEIS------TFL-SIFISAALLGITGYSIYTAFGPPSKNLRDPFEEHED
PSBN_CYAM1      --MQNA------TLI-SVFVASLVIGITAYAIFVSFGPSARNLRDPFEEHED
PSBN_TRICV      --META------TII-VIFVSSLLLGITAYSIYTAFGPAAKNLRDPFEEHED
PSBN_TUPAK      --MESP------AFFFSLFVWCLLLSITAYSLYVGFGPPSKQLRDPFEEHED
PSBN_CHLVU      --MDSP------AFFFTIFLWCLLLSITGYSIYVGFGPPSQQLRDPFEEHED
PSBN_CHLRE      --MESP------AFFFTFFLWFLLLSVTGYSVYVSFGPPSKKLRDPFEEHED
PSBN_NEPOL      --METP------ALVATVFVSCLVLSITGYSLYIGFGPPSKELRDPFDEHED
PSBN_EUGGR      --FKII------SFLSTIFLGFFIISTTIYSIYMGFGPMSRKLKDPFEEHEN
PSBN_NOSS1      --MEPA------IVL-IISVGAALVAVTGYGIYTAFGPPSRELSDPFEDHED
PSBN_PROMM      -MMENSSSE---TYSLLIAMVTITFGLTGYGLYTAFGPPSKELEDPFEEHED
PSBN_SYNSC      --METSS----PALSVAIGVLAVLFGLTGFGVYQAFGPPSKALDDPFDDHED
PSBN_SYNS9      --METSS----PALSVALGVMAVVLGLTGFGVYQAFGPPSKELDDPFDDHED
PSBN_PROMA      --METSS----PALSIAITILIVLLGLTAFGVYTAFGPPNRALDDPWDDHDD
PSBN_PROMP      --MQTLSSAPDPAVSVAVTILAVLLALTGFGLWTAFGPKAAKLTDPWDDHDD
PSBN_SYNE7      --MMEAS----PGLSIAITFAVILLALTGFSIYTSFGPPSKQLEDPFEDHED
PSBN_THEEB      --MEPAT-------VLSIALAAVCIGVTGYSIYLSFGPPSKELADPFDDHED
PSBN_SYNY3      --MESAT-------VLSITFAVILIAITGLAVYTSFGPPSAELGDPFDDHED
                                   .    .  *    : . *     * * :: *::