CLUSTAL format seed alignment for MF_00295

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A8YVP5_LACH4          ------------------------------------MANRVKIGVLNLMHDKL--DTQQR
SAT_LACAI             ------------------------------------MANKVKIGILNLMHDKL--DTQSH
A0A0R1PAG4_9LACO      ------------------------------------------------MHDKL--DTQRR
A5VMF6_LACRD          -----------------------------------MTADPLRIGILNLMHDKV--DTQLR
G2SPK7_LACRR          ---------------------------------MRKKDDVLEIGVLNLMHDKE--DTKRR
A5GLL9_SYNPW          -MALILPPNYHKITAVERNRISWIEP----KEAERQDIRPLRIGILNIMPLGK--QYEFN
A5GS40_SYNR3          -MALILPKNYHKVAAIERNGISWIEP----ELAERQDIRPLRIGIINIMPLGM--QYEFN
Q7V245_PROMP          -MALIIPSNYHKISDVEKNHISWIEP----DLAERQDIRPLRIGILNIMPLGK--QYEFN
METAA_BRUME           -MPIKIPDDLPATSVLEAEGVMVMRE----ADAVRQDIRPLRIGLLNLMPNKV--TTETQ
METAA_BRUSU           -MPIKIPDDLPATSVLEAEGVMVMRE----ADAVRQDIRPLRIGLLNLMPNKV--TTETQ
METAA_RHIME           -MPIKIPDTLPAFETLVHEGVRLMTE----TEAIRQDIRPLQIGLLNLMPNKI--KTEIQ
Q5H329_XANOR          -MSIIIPKGLPAGRALENEGITVLQD----ETTIHPQCRIIRVGLLNLMPNKI--NTEIQ
METAA_BACC1           -MPIIIDKDLPARKVLQEENIFVMTK----ERAETQDIRALKIAILNLMPTKQ--ETEAQ
METAA_BACHK           -MPIIIDKDLPARKVLQEENIFVMTK----ERAETQDIRALKIAILNLMPTKQ--ETEAQ
METAA_BACCR           -MPIIIDKDLPARKVLQKENIFVMTK----ERAETQDIRALKIAILNLMPTKQ--DTEAQ
METAA_CLOAB           -MPIKIPDNLPAAKTLNEENIFFMDE----DRAYHQDIRPLNIVIVNLMPTKI--VTETQ
METAA_CLOTE           -MPIVIPKDLPATETLENENIFVITE----HRAIHQDIRPLKIAIVNLMPKKI--ETETQ
METAA_BACHD           -MPIKIPDNLPAKEILTKENIFVMAE----SRAYSQDIRPLKIVILNLMPIKQ--TTETQ
METAA_OCEIH           -MPIKIPIHLPAKDILEKENIFVMDD----QRAITQDIRPLNILILNLMPEKQ--KTETQ
METAA_BACSU           -MPINIPTHLPAKQVLESEHIFVMDE----SRAFHQDIRPQKIIILNLMPKKI--QTETQ
METAA_BACFR           -MPLNLPDKLPAIELLKEENIFVIDN----SRATQQDIRPLRIVILNLMPLKI--TTETD
METAA_BACTN           -MPLNLPDKLPAIELLKEENIFVIDT----SRATQQDIRPLRIVILNLMPLKI--TTETD
METAS_ECOL6           -MPIRVPDELPAVNFLREENVFVMTT----SRASGQEIRPLKVLILNLMPKKI--ETENQ
METAS_ECO57           -MPIRVPDELPAVNFLREENVFVMTT----SRASGQEIRPLKVLILNLMPKKI--ETENQ
METAS_ECOLI           -MPIRVPDELPAVNFLREENVFVMTT----SRASGQEIRPLKVLILNLMPKKI--ETENQ
METAS_SALTI           -MPIRVLDELPAVNFLREENVFVMTT----SRASGQEIRPLKVLILNLMPKKI--ETENQ
METAS_SALTY           -MPIRVLDELPAVNFLREENVFVMTT----SRASGQEIRPLKVLILNLMPKKI--ETENQ
METAS_YERPE           -MPIRVPDELPAVSFLRNENVFVMAS----SRAKTQEIRPLKVLILNLMPKKI--ETENQ
METAS_YERPS           -MPIRVPDELPAVSFLRNENVFVMAS----SRAKTQEIRPLKVLILNLMPKKI--ETENQ
METAS_PECAS           -MPIRVPDELPAVNFLRNENVFVMTS----SRAKTQEIRPLKVLVLNLMPKKI--ETENQ
METAS_PHOLL           -MPICIPDELPAVNFLQNENVFVMTS----TRANIQNIRPLKVLLLNLMPKKI--ETENQ
METAS_VIBVU           -MPIRIPDQLPAADVLRTENIFVMSE----TRAASQEIRPLRVLILNLMPKKI--ETETQ
METAS_VIBVY           -MPIRIPDQLPAADVLRTENIFVMSE----TRAAKQEIRPLRVLILNLMPKKI--ETETQ
METAS_VIBPA           -MPIRIPDQLPASDVLRTENIFVMSE----TRAASQEIRPLRVLILNLMPKKI--ETETQ
METAS_VIBCH           -MPIRIPDQLPASDVLRNENIFVMSE----SRASTQEIRPLKVLLLNLMPKKI--ETETQ
METAS_PHOPR           -MPIKIPDRLPATDILRSENIFVMSE----ARAATQGIRPLKVLLLNLMPKKI--ETETQ
METAS_SHEON           -MPVKIPDHLPAAGILESENIFVMSE----TRAANQDIRPMKVLILNLMPNKI--ETETQ
METAA_STRPN           -MPIRIDKKLPAVEILRTENIFVMDD----QRAAHQDIRPLKILILNLMPQKM--VTETQ
METAA_STRR6           -MPIRIDKKLPAVEILRTENIFVMDD----QRAAHQDIRPLKILILNLMPQKM--VTETQ
METAA_STRMU           -MPITLDKKLPAVDILKSENIFVMDD----KRAIHQDIRPMSILILNLMPTKV--ATETQ
METAA_LACLA           -MPVKVIEGLPAIDDLRADNIFVMND----ERAKNQNIRPLNLLVVNLMPRKL--ITERQ
METAA_THEMA           -MPINVPSGLPAVKVLAKEGIFVMTE----KRAIHQDIRPLEILILNLMPDKI--KTEIQ
METAA_CAMJE           -MPLIIPENIPAYELLK-EHAFIMGL----RRAKHQDIRPQEILIVNLMPKKI--ETENQ
Q187D6_CLOD6          -MALILPKGLPVINKLLDEGIDVIYKEDFKKELKYEENIDTKIAILNLMPIKI--DTELD
K8E201_CARML          ----------------------------------MSSKPILSIAILNLMPTKE--ATATQ
META2_ILYPC           MCCIAGAPSLSGRERAEKEGIRFKEN-----------KGELKIGIINLMPFKE--EVEYQ
C2D3C9_LACBR          ----MYMTANATNGFLHAENQWTN----------QKLTHPVSILILNLMPTRR--DAEFQ
F9UR59_LACPL          ------MTVTANNGLLVARGEWANAT-------CQESHQAQQILILNLMPTKV--TTERQ
METAA_LEUMM           -------MSVILNNGLLKRESFVIGR-------FEVLEPTINILLVNLMPNRL--QTEKQ
METAS_THIND           -MPLVAHSNLPTFERLRKEGG---TVLP-NDYALHQDIRALHIGLLNMMPDAALAATERQ
METAS_ALLVD           -MPIVAHNDLPTFARLREEGQ---QILD-PDFALHQDIRELHIGLLNMMPDAALAATERQ
METAS_NITOC           -MPLVANSDLPAFERLREEGE---TVIP-RDVALHQDIREMHIGLLNMMPDAALAATERQ
METAS_METCA           -MPLVAHTDLPTFQRLREEGQ---DVLS-VERAARQDIREMHIGLLNMMPDAALEATERQ
METAS_METTV           -MPLVAHTDLPTFQRLREEGE---EILD-PDRASNQDIREMHIGLLNMMPDAALEATERQ
METAS_THIDA           -MPLVAHNALPTFERLRRDGI---TVLS-TERAANQEIRELHVGLLNMMPDAALEATERQ
METAS_THINJ           -MPLVAHTRLPTFERLKQEGQ---TVLS-EDYAFQQDIRELHIGFLNMMPDAALAATERQ
METAS_CARH6           -MPLVAHRELESLDRLRAEGQ---EILD-VRRASQQDIRELHIGLLNLMPDGALKATERQ
METAS_METED           ----MLDHGTPIQPVSLPAAELDLGAVG-GIAWPEPVQRRLRVGLLNNMPDSALVQTERQ
B0UG52_METS4          ----MLKPATPPL------------ARA-GRPRPAAPRDRLTVGLLNNMPDAALAATDRQ
Q6N119_RHOPA          -MSLLFDSADPIDSPVLAPDG--AGDER-CRWGQPDHRKPIEIGLVNNIGDAALRATERQ
METAS_RHOPL           -MTLLFDKTGPIDSPTLAPAS--VDNHC-RSPDRSAAARVIEIGLVNNMSDAALRATERQ
METAS_BRAJP           -MTLLFDGDRRIKSPALAPAG--GDR-------RARDPIELTIGLVNNMPDSALKATDVQ
                                                                      :           

A8YVP5_LACH4          FARVLP-------DADLTFFYPRMHYQNRPVPPEVAKTSQPLDLNQIKE-FDGFIITGAP
SAT_LACAI             FIKVLP-------NADLTFFYPRMHYQNRPIPPEVNMTSEPLDINRVSE-FDGFIITGAP
A0A0R1PAG4_9LACO      FASVLP-------NTELIFFYPRMHYLNRLVPNEVAQTSKPLNLEQINT-LDGFIITGSP
A5VMF6_LACRD          FTKVLS-E--GPYNVDVQYFYPQTHYTSRPVPDLVQKISQPLDLKQVAT-MDAFIITGAP
G2SPK7_LACRR          FERVLT-R--EDCRVNLTWFYPVMHYQDREVPENVRQMSQPLDLNKVKE-LDAFIVTGAP
A5GLL9_SYNPW          LLHPLG-L--SVLQIEPIWIRLQTHAYKSWDQSHLNDLYVSWEEALSQGPLDGLIITGAP
A5GS40_SYNR3          LLHPLG-L--SPLQIEPVWIRLQSHDYKTWDHDHLDQQYRSWEQANASASLDGLIITGAP
Q7V245_PROMP          LLHPLG-L--SPLQIEPVWIKLKTHSYKTWDLNHLNNLYTTWEEANDPEPLDGVIITGAP
METAA_BRUME           IARLLG-A--TPLQVELTLVRMTNHVARHTPADHMLSFYCPWEEVNDQR-FDGFVITGAP
METAA_BRUSU           IARLLG-A--TPLQVELTLVRMTNHVARHTPADHMLSFYCPWEEVNDQR-FDGFVITGAP
METAA_RHIME           MARLIG-A--TPLQVELTLVRVNGHRPKNTPEEHLLAFYETFEEVEARK-FDGFIITGAP
Q5H329_XANOR          IARLLG-S--TPFQIELTLVRISSHSSKNTPIEHLKAFYQDWRDINNLK-FDGFIITGAP
METAA_BACC1           LLRLIG-N--TPLQLDVHLLHMESHLSRNVAQEHLTSFYKTFRDIENEK-FDGLIITGAP
METAA_BACHK           LLRLIG-N--TPLQLDVHLLHMESHLSRNVAQEHLTSFYKTFRDIENEK-FDGLIITGAP
METAA_BACCR           LLRLIG-N--TPLQLDVHLLHMESHLSRNVTQEHLTSFYKTFRDIENEK-FDGLIITGAP
METAA_CLOAB           ILRLIG-N--SPLQVNPTFIHTQTHKSQNTSKEHLIKFYETFEEIKNNK-FDGMIVTGAP
METAA_CLOTE           LLRLLG-N--IPIQVSIDLIHPKTHHSKNISEKHLLSFYKTIDDIKNEK-FDGMIITGAP
METAA_BACHD           LLRLLG-N--TPLQVEVSFMYTDTHISKNTSYDHLQTFYQTIDEVKQKK-FDGMIITGAP
METAA_OCEIH           LLRFLG-N--TPLQVHISFLRMSSHESKHTSKYHLDTFYKKFEEVKSKK-FDGMIITGSP
METAA_BACSU           LLRLLG-N--SPLQVHFTFLIPSTHTPKNTAREHLDEFYTTFSNIRHKR-FDGMIITGAP
METAA_BACFR           LVRLLS-N--TPLQVEISFMKIKSHTSKNTPIEHMKTFYTDFDKMREDR-YDGMIITGAP
METAA_BACTN           LVRLLS-N--TPLQVEISFMKIKSHTSKNTPIEHMQTFYTDFEQMRNEK-YDGMIITGAP
METAS_ECOL6           FLRLLS-N--SPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQEQN-FDGLIVTGAP
METAS_ECO57           FLRLLS-N--SPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQEQN-FDGLIVTGAP
METAS_ECOLI           FLRLLS-N--SPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQDQN-FDGLIVTGAP
METAS_SALTI           FLRLLS-N--SPLQVDIQLLRIDARESRNTPAEHLNNFYCNFDDICDQN-FDGLIVTGAP
METAS_SALTY           FLRLLS-N--SPLQVDIQLLRIDARESRNTPAEHLNNFYCNFDDICDQN-FDGLIVTGAP
METAS_YERPE           FLRLLS-N--SPLQVDIQLLRVDSRESKNTPTEHLNNFYCDFEDIQDQN-FDGLIVTGAP
METAS_YERPS           FLRLLS-N--SPLQVDIQLLRVDSRESKNTPTEHLNNFYCDFEDIQDQN-FDGLIVTGAP
METAS_PECAS           FLRLLS-N--SPLQIDIQLLRIDSRESKNTPTEHLNNFYCNFDDIQDEN-FDGLIVTGAP
METAS_PHOLL           FLRLLS-N--TPLQVDIQLLRIDNRKCRNTPAEHLNNFYCDFEQIKHQN-FDGLIVTGAP
METAS_VIBVU           FLRLLS-N--SPLQVNVELLRIDDRPSKNTPTEHLDNFYRQFEMVKNRN-FDGLIITGAP
METAS_VIBVY           FLRLLS-N--SPLQVNVELLRIDDRPSKNTPTEHLDNFYRQFEMVKNRN-FDGLIITGAP
METAS_VIBPA           FLRLLS-N--SPLQVNVELLRIDNRPSKNTPTEHLDTFYRQFEMVKGKN-FDGLIITGAP
METAS_VIBCH           FLRLLS-N--SPLQVDIELLRIDDRPSKNTPEEHLNTFYRQFELVKNRN-FDGLIITGAP
METAS_PHOPR           FLRLLS-N--SPLQVDVELLRIDNRPTKNTPTEHLDTFYRQFEMVKDRN-FDGLIVTGAP
METAS_SHEON           LLRLLG-N--TPLQVDVDLLRIHDKESKHTSIDHMNTFYRDFEDVRHKN-YDGLIITGAP
METAA_STRPN           LLRHLA-N--TPLQLDIDFLYMESHRSKTTRSEHMETFYKTFPEVKDEY-FDGMIITGAP
METAA_STRR6           LLRHLA-N--TPLQLDIDFLYMESHRSKTTRSEHMETFYKTFPEVKDEY-FDGMIITGAP
METAA_STRMU           LLRLLA-N--TPLQLSVDFLYMTSHHSKTTQAEHMKTFYKTFKDIKDNY-YDGLIITGAP
METAA_LACLA           ILRLLS-N--TPLQINVEFLYMTSHDFKNTKQGHLDSFYKSFSEIKSQY-YDGLIVTGAP
METAA_THEMA           LLRLLG-N--TPLQVNVTLLYTETHKPKHTPIEHILKFYTTFSAVKDRK-FDGFIITGAP
METAA_CAMJE           ILSLLA-N--SPLQVNITLLATTSYVGKNTPFTHLEKFYKGLEEVKKHK-FDGAIVTGAP
Q187D6_CLOD6          LLRRID-K--TGFNVSVEFIKISTRESKRSCNEYVKEFYKTFDEAKGEY-FDGFIITGAP
K8E201_CARML          LASLLSQN--NLFKVEITLLYPKTHYQAKAIPDDLQENYLTFDDVRDQL-FDGFIITGAP
META2_ILYPC           FYAVLG-R--FDISVEVEFLYPENHVFKNTDGSYIKDNYYPLGELNNRN-YDAIIMTGAP
C2D3C9_LACBR          FLSGFN-H--LDSDVDITFMYPYTHHFKGTSREKIEADYVCWNQIADRY-YDGLIITGSP
F9UR59_LACPL          FLKRFA-A--GNTDVAVTFMYPASHHFKSLPQAVVAAHYVTLADIQDQY-FDGLIVTGAP
METAA_LEUMM           FTRLLS-H--LPINVRVTFAVPSEHKIRHD-TDAIMTNYVTLNDIWHKK-FDGMIVTGAP
METAS_THIND           FFRLVGES-NQIAQFYMHPFTLAELPRGPGGQAHVERYYETFDTIQREG-LDALIITGAN
METAS_ALLVD           FFRLIGES-NQIAQFYVHPFTLKELERGPEARAHVERYYQSFDQIRADG-LDALIITGAN
METAS_NITOC           FFRLIGES-NQIAQFYIHPFTLKEIQRSLEANHYVERYYQTFEQIQAEG-LDALIITGAN
METAS_METCA           FFRLVGGA-NPIVQFHMHPFTIEGLPRGDQAAEHIARYYESFDRIREEG-LDGLIVSGAN
METAS_METTV           FFRLVGAC-NQIVQFHVHPFTIEGLKRSPEAQAHIAKYYESFEQIKRDG-LDALIISGAN
METAS_THIDA           FYRLVGES-NPIAQFYMHPFTLETLPRGDKARAHIGRHYEKFEDIRAAG-LDALIITGAN
METAS_THINJ           FLRLVNES-NLIAQFHIHPFTLGTLPRGDKAQAHIAQYYDKFEDLQEQG-LDALIITGAN
METAS_CARH6           FLRLIGNS-NRIAQFYVHIFTVPGVPRSADMQAYIDSHYENFDDLAHDG-LDAIIFTGTN
METAS_METED           FRRLIGPG------VELRLFSLDTVPRGPLARAHLDRFYETQGALAGAG-LDALVVTGAE
B0UG52_METS4          FSALLGRE------VRLLRFHLPEIARGPEARDMLAPLSAPADALEGAG-LDALIVTGCE
Q6N119_RHOPA          FARLLRDGAGER-RVRLHCFALRSVPRSAAARHRIDSLYSDIADLGHVR-LDGLIVTGAE
METAS_RHOPL           FMRLLRAGSGEH-LVRLHCFALPSVQRSPATRQRIDSLYADIADLRHTR-LDALIVTGAE
METAS_BRAJP           IARLLQQAAPWHVRIRLHCFSLPSIARSPMASSHVAQTYTDIDRLDGLD-IDGLIVTGAE
                      :   .                             :                *. :.:*  

A8YVP5_LACH4          LDHLDFDQVTYIEEVRCLLQLLDKYKLQQLYFCWGAMAALDYFYNIQKRILSKKIFGVFP
SAT_LACAI             IDQIDFSKITYIEEIRYLLQALDNHKIQQLYFCWGAMAALNYFYGIKKKILAEKIFGVFP
A0A0R1PAG4_9LACO      IDQIKFQDVTYIEEIRCLLNKLNQLKIPQLYFCWGAMVALNHFYGIQKQILSEKIFGIYP
A5VMF6_LACRD          IEQLTFEEITYLDEIHQLIDVLVANNIPQLYVCWGAMAAANYLYDIPKFQLPEKIFGVFH
G2SPK7_LACRR          LEKLDFDDVTYISELQELFDCLSTEGIEQLYVCWGAMVAANYFYGVDKYLLNQKLFGVYP
A5GLL9_SYNPW          VEHLAFEDVTYWKELVAVVEEARQTCASTLGLCWAGFA-LAYLAGVNKTAFKRKLFGVYP
A5GS40_SYNR3          VEHLAYEQVTYWQEMVELVGIARTQCASTLGLCWAGFA-LAYLAGVDKTAFAQKLFGVFP
Q7V245_PROMP          VEHLAFEEVKYWDEFVNITNEARNSCASTLGLCWAGFA-LAYLAGVNKTVFDKKLFGVFP
METAA_BRUME           VERLPFEEVTYWDEMRRVFDWTQSHVHRTLNICWAAQAAVYHFHGMKKYDLPAKASGVFR
METAA_BRUSU           VERLPFEEVTYWDEMRRVFDWTQSHVHRTLNICWAAQAAVYHFHGMKKYDLPAKASGVFR
METAA_RHIME           IETLEYEEVTYWKELQRIFDWTTTNVHSTLNVCWGGMAAVYHFHGVPKYPLKEKAFGVYR
Q5H329_XANOR          IEKIPFRSVDYWDELTEVFRWTQTHVHSCFNICWGAHAAMHLFYGVKKHVLKEKLFGVFK
METAA_BACC1           VETLSFEEVDYWEELKRIMEYSKTNVTSTLHICWGAQAGLYHHYGVQKYPLKEKMFGVFE
METAA_BACHK           VETLSFEEVDYWEELKRIMEYSKTNVTSTLHICWGAQAGLYHHYGVQKYPLKEKMFGVFE
METAA_BACCR           VETLAFEEVDYWEELKHIMEYSKTNVTSTLHICWGAQAGLYYHYGVPKYPLKEKMFGVFE
METAA_CLOAB           VETLSFENVDYWEELCRIFDWSVTNVTSTIHICWGAQAGLYHHYGIPKYELHEKLFGVFK
METAA_CLOTE           VEQIAFEDVDYFQELKTIMDFSVTNVFSTLHICWGAQAALYYHYNINKNILPKKVFGVFS
METAA_BACHD           IETLPYDEVDYWNELKQIMEWSKTNVTSTLHICWGAQAGLFYHYGVEKVPLPEKQFGVYP
METAA_OCEIH           VEHLPFEEVDYWKELQDIMNWSKENVTSTLHICWGAQAALYHHYGIDKHHLPQKCFGVYE
METAA_BACSU           IEHLAFEEVSYWEELKEIMEWSKTNVTSTLHICWGAQAGLYYHYGVEKIQMPKKIFGVFE
METAA_BACFR           VEQMDFEEVNYWDEITEIFDWARTHVTSTLYICWAAQAGLYHHYGIPKYALDKKMFGIFK
METAA_BACTN           VEQMDFEEVTYWEEITEIFDWARTHVTSTLYICWAAQAGLYHHYGVPKYPLDQKMFGIFE
METAS_ECOL6           LGLVEFNDVAYWPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTRTDKLSGVYE
METAS_ECO57           LGLVEFNDVAYWPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTRTDKLSGVYE
METAS_ECOLI           LGLVEFNDVAYWPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTRTEKLSGVYE
METAS_SALTI           LGLVEFNDVAYWPQIRQVLEWAKDHVTSTLFVCWAVQAALNILYGIPKQTRTDKLSGVYE
METAS_SALTY           LGLVEFNDVAYWPQIRQVLEWAKDHVTSTLFVCWAVQAALNILYGIPKQTRTDKLSGVYE
METAS_YERPE           LGLVDFCDVAYWPQIERIIAWAKEHVTSTLFVCWAVQAALNILYGIPKMTREVKLSGIYQ
METAS_YERPS           LGLVDFCDVAYWPQIERIIAWAKEHVTSTLFVCWAVQAALNILYGIPKMTREVKLSGIYQ
METAS_PECAS           LGLVDFCDVVYWPQIARVIEWAKEHVTSTLFVCWAVQAALNILYGIPKMTRKEKLSGVYL
METAS_PHOLL           LGLVEFEDVAYWKQIERIISWAKEHVTSTLFICWAVQAALNILYGLPKFTREVKLSGVYY
METAS_VIBVU           LGLVQFEDVIYWDHLKTIMEWAKSHVTSTLYVCWAAQAGLKLLYDLPKKTRKEKLSGVYH
METAS_VIBVY           LGLVQFEDVIYWDHLKTIMEWAKSHVTSTLYVCWAAQAGLKLLYDLPKKTRKEKLSGVYH
METAS_VIBPA           LGLVQFEDVIYWDHLKTIMEWAKDHVTSTLYVCWAAQAGLKLLYDLPKKTRKEKLSGVYH
METAS_VIBCH           LGLVQFEDVAYWQHLQNIMAWAKAHVTSTLYICWAAQAGLKLLYNLPKRTREEKLSGVYY
METAS_PHOPR           LGLVQFEDVLYWEEIQVIMNWAKEHVTSTMFVCWAAQAGLKLLYDLPKRTRKEKISGVYE
METAS_SHEON           LGQIDFEDVTYWDHIREIIDWSQQHVTSVLFLCWAAHAGLYHLYGLNRKILEQKRSGVFV
METAA_STRPN           VEHLPFEEVDYWEEFRQMLEWSKTHVYSTLHICWGAQAGLYLRYGVEKYQMDSKLSGIYP
METAA_STRR6           VEHLPFEEVDYWEEFRQMLEWSKTHVYSTLHICWGAQAGLYLRYGVEKYQMDSKLSGIYP
METAA_STRMU           VETMPFEKVDYWEELCQVFQWSKTHVYSTLHLCWGAQAGLYYRYSVDKVQMTDKLSGIYL
METAA_LACLA           VEQLNFEEVDYWSELLKIIDWSKSHVYSSLHICWGAQAALYARYGVTKENLPQKLCGIYK
METAA_THEMA           VELLPFEEVDYWEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGIPKYELPQKLSGVYK
METAA_CAMJE           VEQMDFEKVAYWEELLEIFDFLKQNVTSSMYICWGAMAALKYFYGVDKISLDKKIFGVYK
Q187D6_CLOD6          VEQMEFEEVDYWNELEEIMDYSKRKTKSTLYICWAAQASLYKYYNVKKLPLSQKCFGVFK
K8E201_CARML          VEQLPFEHVDYWLELKTIFTYLKATHTHSLFICWGAQAALYEYYQIPKIHLPTKLVGIFQ
META2_ILYPC           VELLDFQKVNYWDEIKNLIKSNK---LPALYICWGAQAALYVKYGIEKFTLNEKLLGIFR
C2D3C9_LACBR          VEKLPFKQVDYWDELQKIIKWGKTHVKQQLHECWAAQAGLYLDYGIQKRLLPNKLFGIFT
F9UR59_LACPL          VETLPFEAVDYWNELLTIIDWSRQHVSQTLFECWAAQAGLYAQFGIAKRAVAHKIFGIYS
METAA_LEUMM           VDRMKFEQIDYWDEFRHLLEWRKTHVTESLFACWAAYGAGYAERNFPVKALSEKISGVFQ
METAS_THIND           VSQPDLALEPFWEPLAEVVEWAWKNVTSTLCSCLTTHAVMQSRYGERRRHRGAKLWGVFD
METAS_ALLVD           VTGPDLALEPFWEPLIEVVDWAYDNVCSTLCSCLATHAVMQFRYGERRRRLPAKRWGVFP
METAS_NITOC           VTQPQLSLEPFWKPLIKVISWAYENVTSTLCSCLATHAVLDFRYGQKRRRLSSKRWGVYS
METAS_METCA           VTQPHLQQEAFWQPLTEVFDWARSNVTSILCSCLATHALFQYSYGVERTHLGFKRWGVYS
METAS_METTV           VSHPRLPEEDFWQPLSEVFFWAKENVTSILCSCLATHALIQYCYGIERTRLPAKRWGVFS
METAS_THIDA           VSHANLADEAFWQPLIEVIDWAWDNVTSTLCSCLATHAVMQFRYAQTRVLQPRKIWGVFE
METAS_THINJ           PAAPHLEDEPFWDGLCEVVAWAQENVTSTLCSCLASHALVQHLWGIRRRPLGFKRWGVYS
METAS_CARH6           PLHADLAQEAYWPHVQRVFDWADKNVTSVLCSCLASHLALQHFHGIARKRRDEKLFGVFS
METAS_METED           PKAERLADEPFFPALAAVVDWADASGVPTLFSCLAAHAAVLHLDGIERRPLPTKHSGIYA
B0UG52_METS4          PRAADLRDEPYWPALAGVIDWARDHTVSTLFSCLAAHAAVLHLDGIARRRMARKRSGIFA
Q6N119_RHOPA          PRKAALRDEPYWDEFRRLVDWAEANTRSTIWSCLAAHAAVLHLDGIERRRLPRKCSGVYT
METAS_RHOPL           PRAATLQSEPYWDEMRALVDWAEANTRSTIWSCLAAHAAVLHLDGIERERLPQKCSGVFA
METAS_BRAJP           PVAARLRDESYWPDLAAIVDWARTNTKTTIWSCLAAHAAVLHLDDIERQRLASKCSGVFD
                                :   .  :           :  *                    *  *:: 

A8YVP5_LACH4          H---LIIEPHPLLNGLSKG--FIAPHARYAEMDKTQIMQDPR--LTINSVDDNGHLFMVS
SAT_LACAI             H---LITEPHPLLSGLSQG--FMAPHARYAEMDKKQIMQDER--LAINAVDDNSHLFMVS
A0A0R1PAG4_9LACO      H---LIIAPHPLLDRLSQG--FIAPHARYAEMDKKQILQNPH--LVINAVDDNGHLFMVS
A5VMF6_LACRD          N---YLRAQDPLLKGLPDG--FLAPHARYAELDIDKIMEDSR--LVINAVTKNNFLFSFR
G2SPK7_LACRR          Q---VILENSPLLEGLSDG--FLAPHARYAELSCSQVREVPE--LSVVSVSETNHLFLAE
A5GLL9_SYNPW          L--RSLVPGHSLMGTQDDQ--FLCPQSRHAGLPDAAMESAQRQGRLRLLAHGESVGYTIF
A5GS40_SYNR3          M--RSLKPGHALMGTQDDS--FFCPQSRHAGLDDAAMEQAQRQGRLRLLAHGEQVGYSIF
Q7V245_PROMP          L--KSLAPGHPLMGTQDDE--FICPQSRFAGLPDLEMEEAQKEGKLNLLAYGKDVGYTIF
METAA_BRUME           Q--RSLVLASPYLRGFSDD--FAIPVSRWTEVRKSDIPADSG---LKVLVDSTETGLCLL
METAA_BRUSU           Q--RSLVPASPYLRGFSDD--FAIPVSRWTEVRKSDIPADSG---LKVLVDSTETGLCLL
METAA_RHIME           H--QNLQPSSVYLNGFSDD--FAVPVSRWTEVRRADIDRVPD---LEILMESKEVGVCLV
Q5H329_XANOR          H--HIYDVNSPYLKGFTGE--VHIPVSRWTEIRRNDLPVDSG---VSVLIDSLDAGICLL
METAA_BACC1           H--EVREQHVKLLQGFDEL--FFAPHSRHTEVRESDIREVKE---LTLLANSEEAGVHLV
METAA_BACHK           H--EVREQHVKLLQGFDEL--FFAPHSRHTEVRESDIRGVKE---LTLLANSEEAGVHLV
METAA_BACCR           H--EVCEQHVKLLQGFDEL--FFAPHSRHTEVRENDIREVKE---LTLLANSEEAGVHLV
METAA_CLOAB           H--NLTERNIKLTRGFDDE--FYAPHSRHTYVKREDIKKNPS---LKILAESDEAGAYIV
METAA_CLOTE           HHININKGTVKLLRGFDDK--FYVPHSRHTEVKKEDIEKVPE---LEIFAESNEVGPYII
METAA_BACHD           H--KINVPNVKLLRGFDDE--FYVPHSRHTDINKAQIEAHPD---LEILSESEQAGVYIV
METAA_OCEIH           H--KLLHPHERLVRGFDDY--FFAPHSRYTDVSISEIEAHPD---LQLLAKSDDAGVFLL
METAA_BACSU           H--TVLSKHERLVRGFDEL--YYVPHSRHTDINMEQLQAVPE---LNILTASKEAGVCLI
METAA_BACFR           H--RTLLPLHPIFRGFDDE--FYVPHSRHTEVRKEDILKVPE---LTLLSESDDSGVYMV
METAA_BACTN           H--RVLEPFHSIFRGFDDC--FYVPHSRHTEVRREDILKVPE---LTLLSESKDAGVYMA
METAS_ECOL6           H--HILHPHALLTRGFDDS--FLAPHSRYADFPAALIRDYTD---LEILAETEEGDAYLF
METAS_ECO57           H--HILHPHALLTRGFDDS--FLAPHSRYADFPAALIRDYTD---LEILAETEEGDAYLF
METAS_ECOLI           H--HILHPHALLTRGFDDS--FLAPHSRYADFPAALIRDYTD---LEILAETEEGDAYLF
METAS_SALTI           H--HILHPHALLTRGFDDS--FLAPHSRYADFPAALIRDYTD---LEILAETEEGDAYLF
METAS_SALTY           H--HILHPHALLTRGFDDS--FLAPHSRYADFPAALIRDYTD---LEILAETEEGDAYLF
METAS_YERPE           H--QTLEPLALLTRGFDET--FLAPHSRYADFPVEVLQQYTD---LDILVSSEEAGAYLF
METAS_YERPS           H--QTLEPLALLTRGFDET--FLAPHSRYADFPVEVLQQYTD---LDILVSSEEAGAYLF
METAS_PECAS           H--QTLQPHALLTRGFDET--FLAPHSRYADFPADVIRQHTD---LDILVASEQAGAYLF
METAS_PHOLL           H--STLNPLALLTRGFDES--FFAPHSRYADFPEQVVREHTD---LDILSSSEDAGVYLL
METAS_VIBVU           H--RIHKPYHPVLRGFDDS--FLAPHSRYADFSPEYLAEHTD---LDILATSDDAGVYLA
METAS_VIBVY           H--RIHKPYHPVLRGFDDS--FLAPHSRYADFSPEYLAEHTD---LDILATSDDAGVYLA
METAS_VIBPA           H--QIHNPFHPILRGFDDT--FLAPHSRYADFSPHFLEEHTD---LDILATSDVAGVYLA
METAS_VIBCH           H--DIHKPFHPLLRGFDDR--FLAPHSRYADFDAEFLAEHTD---LDILATSDVAGVYLA
METAS_PHOPR           H--KIHDRHHPLLRGFDDL--FKAPHSRYADFSPSYLAEHTD---LDILATSEVAGVYLA
METAS_SHEON           H--RRTCQHFPLLRGFDDE--FFAPHSRFAEMDVEEIRQHPQ---LQLLAESDEAGAYLV
METAA_STRPN           Q--DTLKEGHLLFRGFDDS--YVSPHSRHTEISKEEVLNKTN---LEILSEGPQVGVSIL
METAA_STRR6           Q--DTLKEGHLLFRGFDDS--YVSPHSRHTEISKEEVLNKTN---LEILSEGPQVGVSIL
METAA_STRMU           Q--KVNEQLSPLMRGFDDC--FLSPHSRYTEVLLKDINNKTN---LEILASGEKVGLSIL
METAA_LACLA           S--SVEQPKNPLFRGFDDF--FNYPQSRYTQSNPSEIKKVPD---LEVLSSSKETGFSIL
METAA_THEMA           H--RVAKD-SVLFRGHDDF--FWAPHSRYTEVKKEDIDKVPE---LEILAESDEAGVYVV
METAA_CAMJE           H---DKVSPDLLLTNLDEK--VLMPHSRHSSMDEEQILALQKQGKLKILLRNKKIGSALL
Q187D6_CLOD6          H---KVDKDSKIVDGFENE--FFAPHSRHTTVNIEALKENKE---LSIVSHSKEAGPYII
K8E201_CARML          H--RFCVTEHWLANTTKTD--FHAPHSRNTTVDSCLVSQHPE---LIPVAQSDAAGLYLA
META2_ILYPC           H-------RTNKNPFVSGE--FWAPHSRNTQNSSKDIKNAGL----RILAESDEAGVYMA
C2D3C9_LACBR          AV--SVDHDSPLARGFGAGGLLRMPQSRHTEIILDETNLPGD---LKVIATAPQSGPMIL
F9UR59_LACPL          AT--STDVKSPLISGLNAGGLLKMPQSRHTALVMPE-RLPAG---LQVVADNPKVGPLVL
METAA_LEUMM           AS--QIFKRHSLLKDLEN---ISMPQSRYFTV---PNFGVAR---RLKVAGDDILGAFIL
METAS_THIND           H--RVVDRTHPLVAGVNTR--FDVPHSRFNDVSREQFDRHRL----KVLVESERAGVHLA
METAS_ALLVD           H--RVLARTHPLVADVNTC--FDVPHSRFNDISHAQFVGAGL----HVLVESEEAGVHLA
METAS_NITOC           H--RVVNRSHPLVRGVNTR--FDVPHSRFNEISRDQFEAAGL----HVLAESEKGGAHLA
METAS_METCA           H--RVVEPLHPLVADINTR--FDVPHSRYNEIFREDMEAAGL----RVLVESEEAGVHLA
METAS_METTV           H--KLTDRTHPLVAEINTR--FDVPHSRFNEIFQSDMERHGL----KVLAVSKEAGVHLA
METAS_THIDA           H--RVTDVRHPLVADVNTR--FDVPHSRWNDVSRAQFEAAGV----KVLVESEEAGVHLA
METAS_THINJ           H--AVTMPEHPLVNDLNTR--FDVPHSRFNQIDREPLEAVGV----QVLVESTEAGVHMA
METAS_CARH6           H--RVLDRSHPMLANINTR--FDMPHSRWNGISAAQLEARGL----PVLVAGEESGVAMA
METAS_METED           C--TAVA-HHPLLAGMPAS--VPVPHSRWNDLPEQALTARGY----RVLRRSEQVGVDLF
B0UG52_METS4          C--RPVA-AHPLLAGMPAV--LPVPHSRWNDLAEADLAASGY----HVLTRSDEAGVDLF
Q6N119_RHOPA          A--VKLQ-RDPMLDDLPAT--MRVSHSRLNDLDADKLSSAGY----EVLTRAVGAGVDVF
METAS_RHOPL           G--EQVN-DDALLSDLPSP--LKVPHSRLNDLAADRLAARGY----EVLTHAPNAGVDIF
METAS_BRAJP           C--VKVR-DDWLTHGIDAP--LQVPHSRLNAVNEPLLAERGY----DILTRSAEVGVDIF
                                              . :*                                

A8YVP5_LACH4          SLEKP-EQNFIFSHIEYGRKGLKKEYEREIAAHP----ERHYKKPENYS-----LSNL--
SAT_LACAI             AKDNP-ERNFIFSHIEYGKDSLRDEYNREINAHP----ERHYKKPINYS-----MSNP--
A0A0R1PAG4_9LACO      NPDKP-EQSFIFSHIEYDQNGLKDEYQREVAAHP----ERNYKKPANYN-----MAAP--
A5VMF6_LACRD          AREK--NQYFLFSHLEYGKDALLKEYLRERNANP----GVEYIKPQNYFRDPLHMKDP--
G2SPK7_LACRR          ARKE--RQTFLFSHLEYGRDALDKEYYRELQAHPED--APVLAKAANYYDDPAKMTGM--
A5GLL9_SYNPW          ETPDQ-RQLMHLGHPEYNVGRIIAEMERDKARGD-----VP-------PPENFNADHP--
A5GS40_SYNR3          ETPDQ-RQLMHLGHPEYSSGRLLAEMERDRARGD-----VP-------PPQNFDAELP--
Q7V245_PROMP          ETKDQ-KQLMHLGHPEYTVHRIISEINRDKEKGD-----VP-------PPENFDINSS--
METAA_BRUME           DDPRH-RSLHMFNHVEYDTTSLADEYFRDIQVQP-----EA-KVPVNYFPGDDAKRPP--
METAA_BRUSU           DDPRH-RSLHMFNHVEYDTTSLADEYFRDIQVQP-----EA-KVPVNYFPGDDAKRPP--
METAA_RHIME           HEKKG-NRLYMFNHVEYDSTSLSEEYFRDVDAGV-----PI-KLPHDYFPHNDSALPP--
Q5H329_XANOR          SDPEH-HALHFFNHIEYDSNTLADEYFRDLNAGI-----NI-QLPKGYFPNDCPHLPP--
METAA_BACC1           IGQEG-RQVFALGHSEYSCDTLKQEYERDRDKGL-----NI-DVPKNYFKHDNPNEKP--
METAA_BACHK           IGPEG-RQVFALGHSEYSCDTLKQEYERDRQKGL-----NI-DVPKNYFKHNNPNEKP--
METAA_BACCR           IGPEG-RQVFALGHSEYSCETLKQEYERDRDKGL-----NI-DVPKNYFKHNNPDEKP--
METAA_CLOAB           ASENG-KNIFVMGHAEYDGDTLNLEYIRDKNQGM-----NI-KIPKNYFKDNDPEKGP--
METAA_CLOTE           ASKNG-RQIFITGHPEYDANTLKSEYYRDINLGK-----HI-EIPKNYFKNNNPREEL--
METAA_BACHD           ASKDG-KQIFVTGHSEYDACTLQQEYERDRARGL-----NI-QVPENYFPNDDATRKP--
METAA_OCEIH           ASKDG-KHIMATGHLEYSAETLAEEYLRDHQRGV-----DT-AIPENYFPDNDPKKQP--
METAA_BACSU           VSKDE-KQVFLTGHPEYDTNTLLQEYERDLERNL-----STVEAPKHYFAKG--SNEP--
METAA_BACFR           VARGG-REFFVTGHSEYSPLTLDTEYRRDVSKGL-----PI-EIPRNYYVNDDPDKGP--
METAA_BACTN           MARGG-REFFVTGHSEYSPYTLDTEYRRDLGKGL-----PI-EIPRNYYVDDDPDKGP--
METAS_ECOL6           ASKDK-RIAFVTGHPEYDAQTLAQEYFRDVEAGL-----DP-DVPYNYFPHNDPQNTP--
METAS_ECO57           ASKDK-RIAFVTGHPEYDAQTLAQEYFRDVEAGL-----DP-EVPYNYFPHNDPQNKP--
METAS_ECOLI           ASKDK-RIAFVTGHPEYDAQTLAQEFFRDVEAGL-----DP-DVPYNYFPHNDPQNTP--
METAS_SALTI           ASKDK-RIAFVTGHPEYDAHTLAGEYFRDVEAGL-----NP-EIPYNYFPKNDPQSIP--
METAS_SALTY           ASKDK-RIAFVTGHPEYDAHTLAGEYFRDVEAGL-----NP-EVPYNYFPKNDPQNIP--
METAS_YERPE           ASKDK-RVAFVTGHPEYDVDTLAGEYQRDLAAGL-----NP-QVPLNYFPSDDASLRP--
METAS_YERPS           ASKDK-RVAFVTGHPEYDVDTLAGEYQRDLAAGL-----NP-QVPLNYFPSDDASLRP--
METAS_PECAS           ASKDK-RLAFVTGHPEYDVLTLAGEFFRDCDAGL-----DP-TVPVNYFPEDNPELEP--
METAS_PHOLL           ASKDK-RMVFVTGHPEYDAGTLASEYLRDLAAGL-----AP-KIPINYFPDNNPERKP--
METAS_VIBVU           TTKDK-RNVFVTGHPEYDPHTLHNEYIRDLGEGM-----EP-AIPVNYYPNDNPDNPP--
METAS_VIBVY           TTKDK-RNVFVTGHPEYDPHTLHNEYIRDLGEGM-----EP-AIPVNYYPNDNPDNPP--
METAS_VIBPA           TTKDK-RNVFVTGHPEYDSHTLHNEYIRDLGEGM-----EP-AIPVNYYPNNNPDNPP--
METAS_VIBCH           ATKDK-RNVFVTGHPEYDAYTLHGEYVRDLGEGL-----NP-AIPVNYYPNDNPDNKP--
METAS_PHOPR           STKDK-RNVFVTGHPEYEVDTLHHEYIRDCEQGI-----EP-NMPVNYYPDNNASNTP--
METAS_SHEON           LSRNN-RNLFVMGHPEYQKSTLNDEYHRDLAQSL-----NP-NVPQNYYRNDDPKADA--
METAA_STRPN           ASRDL-REIYSFGHLEYDRDTLAKEYFRDRDAGF-----DP-HIPENYFKDDDVNQVP--
METAA_STRR6           ASRDL-REIYSFGHLEYDRDTLAKEYFRDRDAGF-----DP-HIPENYFKDDDVNQVP--
METAA_STRMU           ASRDM-REVYSFGHLEYDRETLDNEYKRDLKAGK-----SP-KIPENYYQDDDVTTHP--
METAA_LACLA           AKKNL-REIYLFGHLEYDRETLAWEYERDKEEGL-----KP-NLPQNYFPENDDKNKP--
METAA_THEMA           ANKSE-RQIFVTGHPEYDRYTLRDEYYRDIGRNL-----KV-PIPANYFPNDDPTKTP--
METAA_CAMJE           R--DE-KNIFILGHLEYFKETLHQEYVRD----------NFIQKAKNYYDKKG---NI--
Q187D6_CLOD6          TN--S-RDVFVMGHSEYDKYTLDKEYKRDINKGD-----KI-SIPQNYYINDDPSEEP--
K8E201_CARML          TNYNG-LETYVFGHPEYATETLEKEYLRDVQILT-----KP-ILPLYYFPGNNPLNTP--
META2_ILYPC           SDRDY-REFYISGHGEYQRERLKYEYSRDQN-----------LFPKNYFPEDDPKKEP--
C2D3C9_LACBR          SSNTY-HTTYVTGHPEYQEKTLANEYYRDRYKNL-----PI-NPPVNYFSDPVSG-TV--
F9UR59_LACPL          SAPKL-HAVYVTGHPEYERRTLADEYLRDRRKHL-----PI-QLPEHYFATEQLT-TV--
METAA_LEUMM           RDEHV-NSTYITGHFEYDTETLENEYLRDIAIDP-----NT-IKPKNYFYNNKP------
METAS_THIND           VSEDGFRLVFFQGHPEYDSISLLKEYKREVLRFVNGEREEFPPLPERYLSPQAAAILEEH
METAS_ALLVD           VSPDGFRQVFFQGHPEYDTISLLKEYKREVGRFAAGARSDYPPFPDNYFGLQTRAILNEH
METAS_NITOC           VSEDLFRIVFCQGHPEYDSISLLKEYKREILRFASGQRDNYPPFPENYFSPKIQAILEEY
METAS_METCA           VSPDLFRVIYFQAHPEYDTVSLLKEYKREILRYFSGEREDYPPFPEHYFSLEVGAALNDY
METAS_METTV           VSPDGFRIVFFQGHPEYDDISLLKEYKREILRFYRAERDDYPPFPENYFNDVVQQILVDY
METAS_THIDA           VSGDGLRTVFFQGHPEYDTVSLLKEYKRDLLLATTGALAE-PPFPRRYFDRKAQAFLAEF
METAS_THINJ           VSPDLFRMVFMQGHPEYDTVSLLKEYRREVTRWFDGTRADYPPFPQNYLRPKAKAILNEY
METAS_CARH6           SSPDGFRQIYFQGHPEYDRSSLLKEFRRDLALYQDGKLPQPPKLPTHYFTPAGQRLIRDY
METAS_METED           VRERGASMVFLQGHPEYDGDTLAREYRRDIGRFLDGERDTPPALPENYYVDEAVLRLDAF
B0UG52_METS4          VKPERSLLVFLQGHPEYDPDSLAREYRRDLKRFGRGERAEPPDRPVHYFDPEIEAALDDH
Q6N119_RHOPA          RRDGRSRMVFFQGHPEYDPATLQREFLRDVGRYLAGERDDCPEPPCNYFSAETEARLAAF
METAS_RHOPL           ARQGRSRFVFFQGHPEYDATSLQREYLRDIGRFLTGERHDYPEFPVDYFDADIEDALDAF
METAS_BRAJP           ARTMPSRFVFFQGHPEYDALSLQREYMRDIARYLAGQREDYPRPPRSYFSAESEAVLNTF
                                   * **    :  *  *:                               

A8YVP5_LACH4          --------------------------LFQWKDTQKTFFNNWLTQVKKSKLVLLDK-----
SAT_LACAI             --------------------------SFQWQDTQKIFFNNWLKKVKDNKLVLN-------
A0A0R1PAG4_9LACO      --------------------------LFQCRNTQQIFFTNWLKQVKQNKLVLE-------
A5VMF6_LACRD          --------------------------EFSWETTQRVFFDNWLHSVADHIATQQFVKE---
G2SPK7_LACRR          --------------------------RFGWGKAQRHFFENWLKQAEENRFKKVCTQ----
A5GLL9_SYNPW          --------------------------RTLWRSHRNLLFQQWLWFCYQRVSLQG-------
A5GS40_SYNR3          --------------------------QTLWRSHRNLFFQQWLWFCYQRISLASPAGA---
Q7V245_PROMP          --------------------------NTSWRSHRNLLFQQWLWFCYQQVSLS--------
METAA_BRUME           --------------------------ENRWRSHAHLLFGNWINE-MYQSTPYDIERIGKV
METAA_BRUSU           --------------------------ENRWRSHAHLLFGNWINE-MYQSTPYDIERIGKV
METAA_RHIME           --------------------------QNRWRSHAHLFFGNWINE-IYQTTPYELAKIGTG
Q5H329_XANOR          --------------------------TNRWRGHALLLFENWISH-MHKFLNGSGQGRPLS
METAA_BACC1           --------------------------LVRWRSHGNLLFSNWLNYYVYQETPYVL------
METAA_BACHK           --------------------------LVRWRSHGNLLFSNWLNYYVYQETPYVL------
METAA_BACCR           --------------------------LVRWRSHGNLLFSNWLNYYVYQETPYIL------
METAA_CLOAB           --------------------------MVTWRGHANLLFSNWLNYYVYQETPFEL------
METAA_CLOTE           --------------------------IANWRGHANLLFSNWLNYYVYQETPYSYISI---
METAA_BACHD           --------------------------LLRWRAHSYLLFSNWLNYYVYQETPYDLSR----
METAA_OCEIH           --------------------------KYRWKSHCSLLFSNWLNYYVYQETPYQWGE----
METAA_BACSU           --------------------------VNRWKAHATLLFMNWLNYYVYQETPYEWD-----
METAA_BACFR           --------------------------LVRWRGHANLLFSNWLNYFVYQETPYNIEDIR--
METAA_BACTN           --------------------------LVRWRAHANLLFSNWLNYFVYQETPYNINDIE--
METAS_ECOL6           --------------------------RASWRSHGNLLFTNWLNYYVYQITPYDLRHMNPT
METAS_ECO57           --------------------------RASWRSHGNLLFTNWLNYYVYQITPYDLRHMNPT
METAS_ECOLI           --------------------------RASWRSHGNLLFTNWLNYYVYQITPYDLRHMNPT
METAS_SALTI           --------------------------RTTWRSHGNLLFTNWLNYYVYQITPYDLRHMNPT
METAS_SALTY           --------------------------RATWRSHGNLLFTNWLNYYVYQITPYDLRHMNPT
METAS_YERPE           --------------------------KASWRSHGHLLFANWLNYYVYQITPFDLRHMNPT
METAS_YERPS           --------------------------KASWRSHGHLLFANWLNYYVYQITPFDLRHMNPT
METAS_PECAS           --------------------------KASWRSHGHLLFVNWLNYYVYQITPYDLRKMNPT
METAS_PHOLL           --------------------------LASWRSHGHLLFSNWLNYYVYQITPYDLTYMNPT
METAS_VIBVU           --------------------------IASWRSHGHLLFSNWLNYCVYQQTPYDLDHFSEE
METAS_VIBVY           --------------------------IASWRSHGHLLFSNWLNYCVYQQTPYDLDHFSEE
METAS_VIBPA           --------------------------IASWRSHGHLLFLNWLNYCVYQQTPYDLDHFSED
METAS_VIBCH           --------------------------CASWRSHGHLLFANWLNYCVYQQTPYDLEKFSEA
METAS_PHOPR           --------------------------VASWRSHGHLLFSNWLNYCVYQQTPYDLDDFSEA
METAS_SHEON           --------------------------IARWHSHGSLLVSNWLNYYVYQLTPYDLSDMTAM
METAA_STRPN           --------------------------CLCWSSSAALFFSNWVDHAVYQETPFDWRKIEDD
METAA_STRR6           --------------------------CLCWSSSAALFFSNWVNHAVYQETPFDWRKIEDD
METAA_STRMU           --------------------------IMRWNLAAATFFSNWINYAVYQETPYRLEELEKD
METAA_LACLA           --------------------------KSTWASAASLFFSNWLNYAVYQGTPYLGERLSQH
METAA_THEMA           --------------------------ILTWWSHAHLFFSNWLNYCIYQKTPYRLEDIH--
METAA_CAMJE           --------------------------KYNWRSNANTIFANWLNYDVYQSTPFVL------
Q187D6_CLOD6          --------------------------TVKWKKHSELLFRNWIKNYLIQ------------
K8E201_CARML          --------------------------INTWNEHGKNLFKNWMEFIRTKKLN---------
META2_ILYPC           --------------------------PMKWDSHRKEFYYKWLSHIREKKFSNISDKR---
C2D3C9_LACBR          --------------------------NYSWKDASKKLYKNWTHLLVDKKVGISL------
F9UR59_LACPL          --------------------------DYSWQTSSNQLYQNWLATLNLTKVGY--------
METAA_LEUMM           --------------------------TNTWQTYAEKFFVNWGELLMEKMTSSRSTIPTLN
METAS_THIND           RERVEQARQRRVPAPELPEPLLVGRLDNTWHDSALAVVNNWIGNVYQFTNHDRRIPFRPG
METAS_ALLVD           RECVIRALDQGRKPPELPERLIAAALHNTWHDTAEGVIGNWMGLIYQITHHDRRQTFMAG
METAS_NITOC           QEQIIIARDKDLPLPQLPEPLIVDYLDNTWHDTAEAIINNWMGNVYQITHSDRKRPFMED
METAS_METCA           GQALRSARRAGRAPPPFPEEFVLRHLDNTWRDTAKAVFNNWLGKIYQITDQDRRKPFMAH
METAS_METTV           EQRVRSAKQSGQRLEEFPESLILEHIDNTWSDTAKAVFNNWLGKIYQLTHQERGLPFMDG
METAS_THIDA           ARRTRVGETL-----VFPEAEVVPLLDNTWHDTAEAVIGNWIGCVYQVTHRERGLPFMPG
METAS_THINJ           RLEQEKAKRLGKPLPDFPEKLLLPMLHNTWCDTAKVFYSNWIGKVYQLTNNDRRKPFMEG
METAS_CARH6           IE-------SGRPISDFPEAQLADEVDVTWRDTAKALFANWLGLVYQLTHKERHLQYMDG
METAS_METED           AAVARAYRSPAL-HADFPTMAETLPRPAAWQEAAAGLFRNWLALVSDRVALAA-------
B0UG52_METS4          ARGGWAGEP-----------SCAPPAAPAWPPVAAQLFRNWLSLVATRRGARAGAAAAP-
Q6N119_RHOPA          CDRATADRRPDV-IAELPPLALRPGLTAALEASAVALFGNWLSLLAAES-----------
METAS_RHOPL           RAEAEAARDPAI-IARLPHLALRQGTAEGIETTANALFRNWLISLASEP-----------
METAS_BRAJP           EIRARARRDPTL-AAELPGLTLRPDLAAG--HAAKLLFRNWIGYLADG------------
                                                             :*                   

A8YVP5_LACH4          ----------------
SAT_LACAI             ----------------
A0A0R1PAG4_9LACO      ----------------
A5VMF6_LACRD          ----------------
G2SPK7_LACRR          ----------------
A5GLL9_SYNPW          ----------------
A5GS40_SYNR3          ----------------
Q7V245_PROMP          ----------------
METAA_BRUME           ----------------
METAA_BRUSU           ----------------
METAA_RHIME           ER--------------
Q5H329_XANOR          IRHQQ-----------
METAA_BACC1           ----------------
METAA_BACHK           ----------------
METAA_BACCR           ----------------
METAA_CLOAB           ----------------
METAA_CLOTE           ----------------
METAA_BACHD           ----------------
METAA_OCEIH           ----------------
METAA_BACSU           ----------------
METAA_BACFR           ----------------
METAA_BACTN           ----------------
METAS_ECOL6           LD--------------
METAS_ECO57           LD--------------
METAS_ECOLI           LD--------------
METAS_SALTI           LD--------------
METAS_SALTY           LD--------------
METAS_YERPE           LD--------------
METAS_YERPS           LD--------------
METAS_PECAS           LD--------------
METAS_PHOLL           LD--------------
METAS_VIBVU           AFTKDE----------
METAS_VIBVY           AFTKDE----------
METAS_VIBPA           AFTKDD----------
METAS_VIBCH           NFTKDE----------
METAS_PHOPR           NFTKNDE---------
METAS_SHEON           TPWESQ----------
METAA_STRPN           ASAYGYL---------
METAA_STRR6           ASAYGYL---------
METAA_STRMU           ISFYGYL---------
METAA_LACLA           LNEENYDFNQKEQK--
METAA_THEMA           ----------------
METAA_CAMJE           ----------------
Q187D6_CLOD6          ----------------
K8E201_CARML          ----------------
META2_ILYPC           ----------------
C2D3C9_LACBR          ----------------
F9UR59_LACPL          ----------------
METAA_LEUMM           QERNKLGLGTSQCKYL
METAS_THIND           VDPNAPLNWSR-----
METAS_ALLVD           IDPNDPLGLCCG----
METAS_NITOC           IAPDDPLGLRRPT---
METAS_METCA           IDPDNPLGLA------
METAS_METTV           VDPNNPLGL-------
METAS_THIDA           VDPDNPLGLA------
METAS_THINJ           VNPDDPLGLRQQLGI-
METAS_CARH6           IDPADPLGRLRR----
METAS_METED           ----------------
B0UG52_METS4          ----------------
Q6N119_RHOPA          ----------------
METAS_RHOPL           ----------------
METAS_BRAJP           ----------------