CLUSTAL format seed alignment for MF_00296

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

METXA_NOSP7           ------------------------------------------------------------
METXA_PELLD           ------------------------------------------------------------
MET2_YEAST            ------------------------------------------------------------
U9T077_RHIID          ------------------------------------------------------------
R7Z2K7_CONA1          ------------------------------------------------------------
C1G658_PARBD          ------------------------------------------------------------
E9ED85_METAQ          ------------------------------------------------------------
FUB5_GIBF5            ------------------------------------------------------------
U5HBT3_USTV1          ------------------------------------------------------------
B8MN38_TALSN          ------------------------------------------------------------
I2FWN4_USTH4          ------------------------------------------------------------
W7M0B0_GIBM7          ------------------------------------------------------------
METXA_SALRD           ------------------------------------------------------------
METXA_PSYTT           ------------------------------------------------------------
METXA_CYCMS           ------------------------------------------------------------
A0A2B5FQ06_9BACI      ------------------------------------------------------------
R8T2A6_BACCE          ------------------------------------------------------------
A9VL94_BACMK          ------------------------------------------------------------
Q72YZ7_BACC1          ------------------------------------------------------------
G7ZBS2_AZOL4          ------------------------------------------------------------
METXA_NAUPA           ------------------------------------------------------------
METXA_CARHZ           ------------------------------------------------------------
METXA_MOOTA           ------------------------------------------------------------
METXA_SYMTH           ------------------------------------------------------------
METXA_GEOLS           ------------------------------------------------------------
METXA_CAUVC           ------------------------------------------------------------
METXA_NITHX           ------------------------------------------------------------
METXA_ZYMMO           ------------------------------------------------------------
METXA_PELUB           ------------------------------------------------------------
METXA_GLUOX           ------------------------------------------------------------
METXA_DESPS           ------------------------------------------------------------
METXS_MAGMM           ------------------------------------------------------------
METXS_NOCSJ           ------------------------------------------------------------
METXS_ACIBS           ------------------------------------------------------------
METXS_PSEF5           ------------------------------------------------------------
METXS_DECAR           ------------------------------------------------------------
METXS_NITEU           ------------------------------------------------------------
METXS_CUPNH           ------------------------------------------------------------
METXA_HAEIN           ------------------------------------------------------------
E1QJW4_DESB2          ------------------------------------------------------------
METXA_HALSA           ------------------------------------------------------------
Q18E47_HALWD          ------------------------------------------------------------
SST_SCHPO             ----------------------MLRASSKRLQLSWQVFRRFQS-----------------
I1BUI1_RHIO9          ------------------------------------------------------------
M3ISF8_CANMX          --MIFNKGSRKLIQDIRSHTFSSKKIISHPNSAKFFTTSTTFRKP---------------
W1Q867_OGAPD          -------MSQRLFSVGFARHFSRCVVASKPRASAARAAAMSTPNP---------------
C5DPX0_ZYGRC          --------------------MRSLMGLIKPNLVLLRAKRFNSS-----------------
E9DBY2_COCPS          MRAATRRAALRPSAAVWSRNLEFHGQASRFWGPAPVLASASTSSTHLGRRSIQSHR----
SST_EMEND             --------MSPLNGVARSLPRPFQAVARRPFRVAQPAVACPSN-----RRSFNHSR----
Q6CAU6_YARLI          ------------MKLARSTPRILRGIRPQSMVFARQVATSTVR-----------------
I2FQ00_USTH4          MSRASLRLLPSAQTLSSSSPSTSRIISATRTSFHTLSYRSVPSSSSSVNARPEFSCVDAN
K5XXI1_AGABU          ---------MAFNSLLKSFPRTKLRLPRARFS----------------------------
Q5KGQ3_CRYNJ          MPRPPLPRNLNLPRWNPPKPHLAKYHPPPPHPTTAHAHFLPPTSPQLPPRR---------
SST_XANOR             ------------------------------------------------------------
METXA_NOCFA           ------------------------------------------------------------
METXA_MYCLE           ------------------------------------------------------------
METXA_THEFY           ------------------------------------------------------------
METXA_LEIXX           ------------------------------------------------------------
METXA_CORDI           ------------------------------------------------------------
METXA_CORGL           ------------------------------------------------------------
METXA_CORU7           ------------------------------------------------------------
A9WMJ0_RENSM          ------------------------------------------------------------
METXA_THET8           ------------------------------------------------------------
METXS_XANCP           ------------------------------------------------------------
Q8PI58_XANAC          ------------------------------------------------------------
METXS_BREDA           ------------------------------------------------------------
METXA_DEIRA           ------------------------------------------------------------
                                                                                  

METXA_NOSP7           ------------------------------------------------------------
METXA_PELLD           ------------------------------------------------------------
MET2_YEAST            ------------------------------------------------------------
U9T077_RHIID          ------------------------------------------------------------
R7Z2K7_CONA1          ---------------------------------------------------------MTV
C1G658_PARBD          ---------------------------------------------------------MVT
E9ED85_METAQ          ------------------------------------------------------------
FUB5_GIBF5            -------------------------------------------------------MTTTT
U5HBT3_USTV1          ------------------------------------------------------------
B8MN38_TALSN          ------------------------------------------------------------
I2FWN4_USTH4          ------------------------------------------------------------
W7M0B0_GIBM7          ------------------------------------------------------------
METXA_SALRD           ------------------------------------------------------------
METXA_PSYTT           ------------------------------------------------------------
METXA_CYCMS           ------------------------------------------------------------
A0A2B5FQ06_9BACI      ------------------------------------------------------------
R8T2A6_BACCE          ------------------------------------------------------------
A9VL94_BACMK          ------------------------------------------------------------
Q72YZ7_BACC1          ------------------------------------------------------------
G7ZBS2_AZOL4          ------------------------------------------------------MPRVVR
METXA_NAUPA           ------------------------------------------------------------
METXA_CARHZ           ------------------------------------------------------------
METXA_MOOTA           ------------------------------------------------------------
METXA_SYMTH           ------------------------------------------------------------
METXA_GEOLS           ------------------------------------------------------------
METXA_CAUVC           ------------------------------------------------------------
METXA_NITHX           ------------------------------------------------------------
METXA_ZYMMO           ------------------------------------------------------------
METXA_PELUB           ------------------------------------------------------------
METXA_GLUOX           ------------------------------------------------------------
METXA_DESPS           ------------------------------------------------------------
METXS_MAGMM           ------------------------------------------------------------
METXS_NOCSJ           ------------------------------------------------------------
METXS_ACIBS           ------------------------------------------------------------
METXS_PSEF5           ------------------------------------------------------------
METXS_DECAR           ------------------------------------------------------------
METXS_NITEU           ------------------------------------------------------------
METXS_CUPNH           ------------------------------------------------------------
METXA_HAEIN           ------------------------------------------------------------
E1QJW4_DESB2          ------------------------------------------------------------
METXA_HALSA           ------------------------------------------------------------
Q18E47_HALWD          ------------------------------------------------------------
SST_SCHPO             -----------------------------SNPQLSFPCVDQAQERSRQFEQSLQKQQACP
I1BUI1_RHIO9          ---------------------------------MDFPCIDKLNSRT--------------
M3ISF8_CANMX          -----------------------LQKTTGSNPALTFPCLDKLERKNEDLSKGKL------
W1Q867_OGAPD          -----------------------RP----SNPQLSFPCLEKLEQR---------------
C5DPX0_ZYGRC          ---------------------------GSTNPAMMFPCLDKMERVSEELR----------
E9DBY2_COCPS          -------PNRAAQAIAASREPSEQRTYDSSNPALSFPCLDALEAKSA-------------
SST_EMEND             -------SLRSTGSQSPAPSPR-----DSSNPALSFPCLDAQEAKSA-------------
Q6CAU6_YARLI          ---------------------------KSSNPQLAFPCLDHLESKQQ-------------
I2FQ00_USTH4          ERRGEKLQRLAEQARQSTSSSSLCSTPSSTDPSVAFPCVDANEAREDRLRAQLSSPQLSP
K5XXI1_AGABU          ------------------SSSAHLSPRNTTCGQPHFPCVDAHAVRASRIIASVSQRRSAE
Q5KGQ3_CRYNJ          -----------KPAFNPGGFGLQSQPAPAPAPTSAWGKGKEREMQVDEIQKKDDELRREE
SST_XANOR             ------------------------------------------------------------
METXA_NOCFA           ----------------------------------------------------MSTDQSP-
METXA_MYCLE           ----------------------------------------------------MTISKVP-
METXA_THEFY           ----------------------------------------------------MSHDTTP-
METXA_LEIXX           -----------------------------------------------MDWQTTSADTAPS
METXA_CORDI           ------------------------------------------------------------
METXA_CORGL           ------------------------------------------------------------
METXA_CORU7           ------------------------------------------------------------
A9WMJ0_RENSM          ------------------------------------------------------------
METXA_THET8           ------------------------------------------------------------
METXS_XANCP           --------------------------------------------------MVRIVPSARR
Q8PI58_XANAC          ------------------------------------------------------------
METXS_BREDA           -----------------------------------------------------MTLALIS
METXA_DEIRA           ------------------------------------------------------------
                                                                                  

METXA_NOSP7           -------------------------MIYSDFISPQTQF-------YQLTVPFQLESGKVL
METXA_PELLD           --------------------MNRGMKPINELISPDTKH-------YSFTEPFQTELGATL
MET2_YEAST            ------MSHTLKSKTLQELDIEEIKETNPLLKLVQGQR-------IVQVPELVLESGVVI
U9T077_RHIID          -----------------MYEKIEIQTENKFSQLVHGQN-------IVIIPEFTLCSGHTL
R7Z2K7_CONA1          ETNGADHLAEQPSNGAQRYRRLASQPENPFARLIPDQT-------TAVIPSFTLESGVTL
C1G658_PARBD          SDTGADN----GSSHTPRYQRVASQPENPFSGLITDQT-------IAIIPSFTLESGVTL
E9ED85_METAQ          ----------------------MSQPENPFASLIPDQQ-------IAIIPEFTLESGITL
FUB5_GIBF5            TAPALPTPIHDGLGNGTTYERSIPRPVNPFSNRVPGRE-------IITVPNFTLESGVEM
U5HBT3_USTV1          --------MSDPTIRIFPPGAPPAAASNRFAALIPLQS-------IAVVSSFTLESGVTL
B8MN38_TALSN          ---------------MTIALDYKPAQPNLFADHISGQR-------IALIPSLILESGHEL
I2FWN4_USTH4          --------MAENDHLLPPPFEMPGPTSPQSSLLAGRQR-------YLLFPTFTLESGVTL
W7M0B0_GIBM7          ----------------MQSLIRWQGGQHAMQDQLPTQL-------YTTIDRFMLESGEVL
METXA_SALRD           -----------------------------------MSQ-------TLTVPTLTLENGTTL
METXA_PSYTT           ----------------------------------MPEI-------FKYQDPFQLENGEVL
METXA_CYCMS           ----------------------MNLQSPHLTIEMTQEI-------FYCQEALSLESGESF
A0A2B5FQ06_9BACI      --------------------------MMYVKKESFHL------------KEFTFENGIKI
R8T2A6_BACCE          --------------------------MLQVKKESFHL------------KEFTFENGIKI
A9VL94_BACMK          --------------------------MQIVKKEKFVL------------KEFVFENGREI
Q72YZ7_BACC1          --------------------------MQIVKKEKFIL------------KEFTFENGRTI
G7ZBS2_AZOL4          GSTWSARLGGLAMAACLFGALPALALDGIVEKKVFEM------------PSYTTVGGGTI
METXA_NAUPA           --------------------------MKIETKIAKFT------------KPLYLESGRIL
METXA_CARHZ           ---------------MNGS---VGIVETKKVTFPE----------------ITLECGEKI
METXA_MOOTA           ---------------MDG----VGIVTTRFYEWSQC---------------LHLESGAQL
METXA_SYMTH           ---------------MNAAPVPILLTQRRYARVATPE------------NPLVLESGQRL
METXA_GEOLS           --------------------MSIGVVHEQTITFEAG---------------IRLESGRIL
METXA_CAUVC           ----------------MAALDPITPAGGGTWR-------------FPANEPLRLDSGGVI
METXA_NITHX           ----------------MVNAQSVPTPAHAEYRAQEADHPTSQVAMFAGDQPLPLDCGIDL
METXA_ZYMMO           ----------------MNNDRRFGLKRHITLP-----------------GELALDGGSLL
METXA_PELUB           ----------------MNINVNIKNIIIDK--------------------PLKLDCGQTI
METXA_GLUOX           ----------------MDISASPSIADGPVYTHQ----------TVRLDSGLDLECGVHL
METXA_DESPS           ------------MEKEIKDHKSVGIVEKQFFTCA------------QVPSPLILENGAKL
METXS_MAGMM           -------------MTHEPLTASVGIVTPQHVRLFG------------ASTPLQLDGGTLL
METXS_NOCSJ           ------------------MTGSLGYVETQRVVLAG------------PDDPLHLRGGGRL
METXS_ACIBS           ---------------MSFPADSVGLVTPQKFQFE---------------EPLHLECGRVL
METXS_PSEF5           -------------MPTAFPPDSVGLVTPQIAHFS---------------EPLALACGRAL
METXS_DECAR           --------------MPGQ---SVGAVQPQRAHFD---------------QPLHLRSGGVL
METXS_NITEU           --------------MSTQDSDSIGIVSARRAHFD---------------TPLSLKSGAVL
METXS_CUPNH           --MTDVALPTAAPAAFDLPPDSVGVVAPQRMHFA---------------EPLKLRNGSSI
METXA_HAEIN           --------------------MSVQNVVLFDTQ------------------PLTLMLGGKL
E1QJW4_DESB2          -------------MIPRQADRPWPLVPPRRADFD---------------EPLELLCGARL
METXA_HALSA           ---------------------------MPTTELD----------------GFTFACGDTV
Q18E47_HALWD          -----------------------MKSESGTASLG----------------RFDFACGDEI
SST_SCHPO             NSVDPSASITSPSLSSGPEPVYGKIVSG-FKKFYHNK------------PFLCDHGGI-L
I1BUI1_RHIO9          -----------AELDNGPEPSYDKIVTG-YEKFEYDH------------PFLLDHGGI-L
M3ISF8_CANMX          ------AASSSSSLESGPEPSYGNVKTG-FDLYKSKK------------PIFLDYGGH-L
W1Q867_OGAPD          ---------SQSLVENGPEPAYAKITEDKVDIFRSTD------------PIFLDYGGY-L
C5DPX0_ZYGRC          --------TTTVGTQGQNEPVYGKVKSG-FEIFKSNR------------PFYTDYGGV-L
E9DBY2_COCPS          -------LLSARSLSSGPEPSYT--TGH-HEQFRSRE------------PLLLDWGGV-L
SST_EMEND             -------LLSARSLGSGPEPSYT--AGH-HERFHSDE------------PLLLDWGGL-L
Q6CAU6_YARLI          -------RIT-QSFESGPEPSYG--VNEGYKTYHSDK------------PLYLDYGGV-L
I2FQ00_USTH4          DS---STSVPSEVDESGPEPSYSKVV-SGYQTYHHPH------------PFSLDYGGS-L
K5XXI1_AGABU          YN---PGNGQSD---TGPEPPYARPTPASYHTYHHPQ------------PLSLSYTTTPL
Q5KGQ3_CRYNJ          ER---IEGKSPK--EGREEAEACYVPPPATLHYVASH------------SLPLLYSPSPL
SST_XANOR             ---------------------MTEFIPLGTLYHALPS------------PFQMKRGGV-L
METXA_NOCFA           -------------CPSATGAELLPPPDGTLAIVPVGD--------------IRLESGAVI
METXA_MYCLE           -------------TQKL-------PAEGEVGLVDIGS--------------LTTESGAVI
METXA_THEFY           -------------PLPATGAWREGDPPGDRRWVELSEP-------------LPLETGGEL
METXA_LEIXX           SFITEEQDRSLFGKPPASGAWKESDPVGGRRFAGIGA--------------FGFESGESL
METXA_CORDI           ----------------------MLTTTGTLTHQKIGD--------------FYTEAGATL
METXA_CORGL           --------------------MPTLAPSGQLEIQAIGD--------------VSTEAGAII
METXA_CORU7           ------------------MRSDLLPASGTYADIPIGE--------------VLTEAGASI
A9WMJ0_RENSM          ------------------------------------------------------------
METXA_THET8           ---------MSEIALEAWGEHEALLLKPPRSPLSIPPPKPRTAVLFPRREGFYTELGGYL
METXS_XANCP           TRAPAKLDGRSTPDIAMSLVTTASPLTTADTYTPAADSDAPPAVRGELVINLPMRHAG-Q
Q8PI58_XANAC          ----------------MSLVNTASPSTNDFVDTPASSDDGITAVRGELVIALPMRHAG-M
METXS_BREDA           TETTEEPSCKASVAAPAPKGGAQIGVKAARRPSELLQRDGAHDVAVAIPDDFELDFGGTL
METXA_DEIRA           ------MTAVLAGHASALLLTEEPDCSGPQTVVLFRR------------EPLLLDCGRAL
                                                                                  

METXA_NOSP7           IGVQVAYRSWGELNAQ--------GDNGVLICHALTGSADADD-----------------
METXA_PELLD           PSVEVAYRTWGTLNEA--------RDNVILICHALTGSADADQ-----------------
MET2_YEAST            NNFPIAYKTWGTLNEA--------GDNVLVICHALTGSADVAD-----------------
U9T077_RHIID          YKVPVAYKTWGALNDN--------KDNVMVICHALSGSSDVQD-----------------
R7Z2K7_CONA1          YNVPVAYKTYGSLSPQ--------GDNAMVICHALTGSADVGD-----------------
C1G658_PARBD          RNVPVAYTTRGKLSAS--------RDNVLVICHALSGSADVSD-----------------
E9ED85_METAQ          RNVPVAYTTRGKLNDA--------GDNAMVICHALTGSADVSD-----------------
FUB5_GIBF5            RNVPVAYMSWGKLSPK--------ANNVMIICHALSGSADVSD-----------------
U5HBT3_USTV1          EQVPVGFRTWGELNAE--------KENVMVLCHALTGSSDVED-----------------
B8MN38_TALSN          KSCQVAYKTWGQLNAT--------RDNVLIVCHALSGSSDVAD-----------------
I2FWN4_USTH4          INVPVAFKTWGRLTPGT-------RDNALVVCHALTGSADVED-----------------
W7M0B0_GIBM7          TNATVAFTVKGRLNTQ--------KTNAVIICHALSGSADAAD-----------------
METXA_SALRD           RDVPVAYRTWGTLNAT--------GTNAVLVCHALTGDTNVAD-----------------
METXA_PSYTT           PELEVSYSTLGKLNKE--------KSNVIWVCHALTANAQPED-----------------
METXA_CYCMS           PEFQLSFTTQGQLNAN--------KDNVIWVLHALTGDANPHE-----------------
A0A2B5FQ06_9BACI      P-VQIGYETYGKLNREKS--------NAILVCHYFSATSHAAGKYTE---------QD--
R8T2A6_BACCE          P-VQIGYETYGKLNRDKS--------NAILVCHYFSATSHAAGKYTE---------QD--
A9VL94_BACMK          P-VQMGYETYGTLNRERS--------NAILVCHYFSATSHAAGKYTE---------HD--
Q72YZ7_BACC1          P-VQMGYEAYGTLNRERS--------NAILVCHYFSATSHAAGKYTA---------HD--
G7ZBS2_AZOL4          KNVRIGWESYGKLNEAKD--------NVILITHFFSGNSHAAGRYKA---------ED--
METXA_NAUPA           EPWQIIYETYGELNEKKD--------NVILITHALSGSHHAAGMYEG---------D---
METXA_CARHZ           APVTVAYETYGELNERGD--------NAILILHALTGDAHVAGKHRP---------ED--
METXA_MOOTA           GSLTIAYETYGELNAAGN--------NAILVLHALTGNAHIAGRNFP---------DE--
METXA_SYMTH           TDVTLCYEVFGRLNPAGD--------NAILVCHALTGDSHVAGRYRP---------DD--
METXA_GEOLS           APITLVYELYGTMNADCS--------NVIMVEHAWTGDAHLAGKRRE---------DD--
METXA_CAUVC           EGLEIAYQTYGQLNADKS--------NAVLICHALTGDQHVASPHPT---------TG--
METXA_NITHX           APFQIAYQTYGELNAGKS--------NAILVCHALTGDQHVANVHPV---------TG--
METXA_ZYMMO           TGIEIAYETYGHLNADAS--------NAILICHPLTADQFAASDHPI---------TG--
METXA_PELUB           NNYSLAYETYGSLNENKD--------NAILIFHALTGDQFVSGINPI---------TK--
METXA_GLUOX           APLEVAYCTYGTLSPARD--------NAILVCHALTGDQYLAERNPL---------TG--
METXA_DESPS           GPITIAYETYGNLSARKD--------NAILINHAFSGDSHVAGHYAT---------DGPK
METXS_MAGMM           HSVDVSYETYGTLNQERS--------NAVLICHALSGNAHAAGYHSK---------DD--
METXS_NOCSJ           DHVEVAYETYGSLSPARD--------NAVFICHALTGDAHAAGLHVG---------SK--
METXS_ACIBS           PRFELMVETYGTLNADKS--------NAILICHALSGHHHAAGYHHE---------DD--
METXS_PSEF5           PAYDLIYETYGQLNASAS--------NAVLICHALSGHHHAAGYHSV---------DD--
METXS_DECAR           PAYDLVYETYGTLNAAKS--------NAILVCHALSGHHHVAGHYAD---------QP--
METXS_NITEU           DSYELVYETYGELNADRS--------NAVLICHALSGNHHVAGVYAD---------NP--
METXS_CUPNH           AGYDLMVETYGTLNAARS--------NAVLVCHALNASHHVAGVYAE---------DP--
METXA_HAEIN           SHINVAYQTYGTLNAEKN--------NAVLICHALTGD---AEPYFD---------DG--
E1QJW4_DESB2          GPYTLAYEEYGPAWAKAE--------RAILICHGLTATAHAAGRHHP---------AD--
METXA_HALSA           DSLTVAYRTYGDYT--GS--------NAVLVCHALTGSQHVRGRAD-------------G
Q18E47_HALWD          ESLEVAYEAYGEFN--GD--------NAVLLCHALTGSQNVAGYTDE---------ETDG
SST_SCHPO             PKFEIAYETWGTLNKDHS--------NAILLHTGLSASSHAHS-------------HPEN
I1BUI1_RHIO9          PKFDIAYETWGQLNEAKD--------NAILIHTGLSASSHAKS-------------HPKN
M3ISF8_CANMX          QEYEIAYETWGELNRDKS--------NLILIHTGLSASSHAKS-------------QPHN
W1Q867_OGAPD          PQFQVAYETWGTLNSNRS--------NAILLQTGLSASSHAHS-------------TAKN
C5DPX0_ZYGRC          PNFQIAYETWGTLNEDKS--------NAILIHTGLSASSHAHS-------------TNLN
E9DBY2_COCPS          PEFEIAYETWGTLNSQRS--------NAILLHTGLSASSHAHS-------------TKAN
SST_EMEND             PEFDIAYETWGQLNEKKD--------NVILLHTGLSASSHAHS-------------TEAN
Q6CAU6_YARLI          PEFDIGYETWGELNEDKS--------NGILIHTGLSASSHAKS-------------HPDN
I2FQ00_USTH4          PQFDLAYETWGKLNADKS--------NAILLHTGLSASSHAAS-------------THSN
K5XXI1_AGABU          PSFDLAYETWGTLSPAKD--------NVILLHTGLSASSHAAS-------------TSLN
Q5KGQ3_CRYNJ          PPFTIAYETWGTLNADAS--------NAILIHTGLSASSHVASRGNDVS-------PSTS
SST_XANOR             HQAHVAYETWGALAADRS--------NAVLIVTGLSPNAHAAA-------------NQAN
METXA_NOCFA           PDVHLGVQRWGELSPGLD--------NVVLVEHALTGDSHVVGPADD-----------VH
METXA_MYCLE           DDVCIAVQRWGELSPTRD--------NVVMVLHALTGDSHITGPAGP-----------GH
METXA_THEFY           PGVRLAYETWGSLNEDRS--------NAVLVLHALTGDSHVVGPEGP-----------GH
METXA_LEIXX           PFVRIAYETWGELSPARD--------NAVLVLHALTGDSHAVGAAGP-----------GH
METXA_CORDI           HDVTIAYQAWGHYTG----------TNLIVLEHALTGDSNAIS-----------------
METXA_CORGL           TNAEIAYHRWGEYRVDKE-----GRSNVVLIEHALTGDSNAAD-----------------
METXA_CORU7           PETSLRLYAFYDAAEQAAVPTPPEERPIVLIEHALTGDGNAAD-----------------
A9WMJ0_RENSM          ---------------------------MTGSTHVARGDSDEDG-----------------
METXA_THET8           PEVRLRFETYGTLSRRRD--------NAVLVFHALTGSAHLAGTYDEETFRSLSPLEQAF
METXS_XANCP           RELRLRYELVGAEQAP-----------VVFVAGGISAHRHLAASAVFP------------
Q8PI58_XANAC          RELRLRYELIGAANAP-----------VVFVAGGISAHRHLAASNLFP------------
METXS_BREDA           TQKRVIGRLHGKANAP-----------LIVVAGGISADRYVHRTETK-------------
METXA_DEIRA           SDVRVAFHTYGTPRADAT-----------LVLHALTGDSAVHE-----------------
                                                                                  

METXA_NOSP7           ----WWEPLFG--SGKAFNPDRDFIVCSNILGSC------YGTTGP--------------
METXA_PELLD           ----WWGGLFG--EGCGFDATRDFIICSNVLGSC------YGTTGP--------------
MET2_YEAST            ----WWGPLLG--NDLAFDPSRFFIICLNSMGSP------YGSFSP--------------
U9T077_RHIID          ----WWGPLIG--KGRAFDPTKFFIFCGNVLGSP------YGTASP--------------
R7Z2K7_CONA1          ----WWGPLLGG-PGKAFDVSRFFVVCVNSLGSP------YGSASP--------------
C1G658_PARBD          ----WWGPLLGG-PGQAFDVTRFFVVCLNSLGSP------YGSASA--------------
E9ED85_METAQ          ----WWGPLLGG-PGRVFDTSRFFIVCMNSLGSP------YGTASP--------------
FUB5_GIBF5            ----WWGPLLG--PGKAFDTDKFFVICMNSLGSP------YGTASP--------------
U5HBT3_USTV1          ----WWGPLLG--PNLAFDPTRYFIFCANVLGSP------YGTASP--------------
B8MN38_TALSN          ----WWAPLMG--PGKALDYTRFFIFCGNALGSP------YGSSSP--------------
I2FWN4_USTH4          ----WWGPLLG--VGKVFDFSRFFIVCCNVLGSP------YGSASSCTQAGGETVWAEAL
W7M0B0_GIBM7          ----WWSPLLSCPENPILDPNRFCIICCNSLGSP------YGSSSP--------------
METXA_SALRD           ----WWGGLLG--PGRALDPTEDFVVCLNVPGSP------YGSVAP--------------
METXA_PSYTT           ----WWRGLIG--NEKGIDTEKYFIVCANIIGSC------YGSTNP--------------
METXA_CYCMS           ----WWSGLIG--EDKFFDPSKYFIVCANFLGSC------YGSTQP--------------
A0A2B5FQ06_9BACI      LIPGWWDGLIG-PG-KAIDTDRYFVICTDNLCNVQVKNPYVITTGP--------------
R8T2A6_BACCE          LIPGWWDGLIG-PG-KAIDTDRYFVICTDNLCNVQVKNPYVITTGP--------------
A9VL94_BACMK          EEAGWWDGLIG-PG-KAIDTNKYFVICTDNLCNVQVKNPYVITTGP--------------
Q72YZ7_BACC1          EESGWWDGLIG-PG-KAIDTNKYFVICTDNLCNVQVKNPNVITTGP--------------
G7ZBS2_AZOL4          AAPGYWDSIIG-PG-KPLDTDKYFIISSDTLVNLSPKDPTVVTTGP--------------
METXA_NAUPA           RKPGWWDGLIG-DG-KAIDTTKYFVISTNVIGSC-----FGSTSPM--------------
METXA_CARHZ           KVAGWWDPMVG-PG-RPFDTNKYFIVCSNVLGGC------YGTTGP--------------
METXA_MOOTA           RYPGWWDPLVG-PG-RALDTRRYFIVCANVLGSC------YGTTGP--------------
METXA_SYMTH           PKPGWWDDAVG-PG-KALDTDRYCVICSNVLGGC------QGSTGP--------------
METXA_GEOLS           PKPGWWDAIVG-PG-RLLDTDRYCVLCSNVIGSC------YGSTGP--------------
METXA_CAUVC           -KPGWWQRLVG-PG-KPLDPARHFIICSNVIGGC------MGSTGP--------------
METXA_NITHX           -KPGWWVTLVG-PG-KPLDTDKYFVICSNVIGGC------MGSTGP--------------
METXA_ZYMMO           -KPGWWSRMIG-KG-KPIDPERYCIICSNVLGSC------LGSTGP--------------
METXA_PELUB           -KEGWWSYAVG-SG-KAIDTDKYFVICANVIGGC------MGSYGP--------------
METXA_GLUOX           -KPGWWSRMVG-PG-LPIDTDRYFVVCSNVLGGC------MGTTGP--------------
METXA_DESPS           EKPGWWDFLVG-PG-KGIDTDKYFIICSNILGSC------NGTTGP--------------
METXS_MAGMM           KRPGWWDHYIG-PG-KPFDTNRYFVIASNNLGGC------DGTTGP--------------
METXS_NOCSJ           KR-GWWDNLIG-PG-KPVDTDRFFVISANLLGGC------SGSTGP--------------
METXS_ACIBS           KKAGWWDSCIG-PG-KAIDTNKFFVVALNNIGGC------SGSTGP--------------
METXS_PSEF5           RKPGWWDSCIG-PG-KPIDTNRFFVVSLNNLGGC------NGSTGP--------------
METXS_DECAR           DNIGWWDNIVG-PG-RPLDTDKFFIVGLNNLGGC------HGSTGP--------------
METXS_NITEU           KNTGWWNNMIG-PG-KPVDTRKFFVIGINNLGGC------HGSTGP--------------
METXS_CUPNH           RDVGWWDNMVG-PG-KPLDTNRFFVIGVNNLGSC------FGSTGP--------------
METXA_HAEIN           -RDGWWQNFMG-AG-LALDTDRYFFISSNVLGGC------KGTTGP--------------
E1QJW4_DESB2          PKPGWWDLAIG-PG-KAIDTDKYYVLCSNVLGGF------GGSTGP--------------
METXA_HALSA           DDRGWWPDIVG-PG-RPIDTTEYFVVCANVPGSC------HGTDGP--------------
Q18E47_HALWD          QARAWWNDIVG-PG-KAIDTTEYYVVCANVPGSC------YGTTGP--------------
SST_SCHPO             TAPGWWEQFIG-PG-KDVDTNKFFVICTNVLGSC------YGSTGP--------------
I1BUI1_RHIO9          SKPGWWEDFIG-PG-SHIDTNKFFVICTNVIGGC------YGSTGP--------------
M3ISF8_CANMX          PKNGWWENFIG-PG-KYIDTNKYFVVCTNVLGGC------YGSTGP--------------
W1Q867_OGAPD          PAKGWWENFIG-PG-KYLDTDKYFVICTNVIGGC------FGSTGP--------------
C5DPX0_ZYGRC          QQPGWWEKFIG-PGNVCLDTNKWFLICTNVLGGC------YGSTGP--------------
E9DBY2_COCPS          PKPGWWEKFIG-PG-APLDTNKYFVICTNVVGGC------FGSTGP--------------
SST_EMEND             PKPGWWEKFIG-PG-KTLDTDKYFVICTNVLGGC------YGSTGP--------------
Q6CAU6_YARLI          PKPGWWEKFIG-PG-LSIDTDKYFVVCTNVLGGC------YGSTGP--------------
I2FQ00_USTH4          PAKGWWQDFIG-PN-KPLDTNRFFIICTNVLGGC------YGSTGP--------------
K5XXI1_AGABU          PAPGWWEKFIG-PG-KALDTNKFFIICTNVLGGC------YGSTGP--------------
Q5KGQ3_CRYNJ          SKPGWWEDFVG-PG-KSIDTDKFFVICTNVLGGC------FGSTGP--------------
SST_XANOR             PEPGWWEAMVG-PG-KPIDTARWFVVCVNSLGSC------KGSTGP--------------
METXA_NOCFA           QLPGWWNGMVG-PG-APMDTDEWCVIATNVLGGC------KGSTGP--------------
METXA_MYCLE           PTPGWWDWIAG-PG-APIDTNRWCAIATNVLGGC------RGSTGP--------------
METXA_THEFY           PSPGWWEGIIG-PG-LALDTDRYFVVAPNVLGGC------QGSTGP--------------
METXA_LEIXX           RTSGWWQGIIG-PG-KAIDTDRWFVAVPNMLGGC------QGTTGP--------------
METXA_CORDI           ----WWDGLIG-PG-KALDTNRYCILCTNVLGGC------KGSTGP--------------
METXA_CORGL           ----WWADLLG-PG-KAINTDIYCVICTNVIGGC------NGSTGP--------------
METXA_CORU7           ----WWADMVG-VG-KPIDTAKYLVLCANALGGC------AGSTGP--------------
A9WMJ0_RENSM          ----WWDGLVG-PG-KAIDTNRFFVVAANILGGC------YGSTGP--------------
METXA_THET8           GREGWWDSLVG-PG-RILDPALYYVVSANHLGSC------YGSTGP--------------
METXS_XANCP           -EKGWVEGLVG--AGRALDPASRRLLAFDFLGA---------------------------
Q8PI58_XANAC          -EKGWVDGLVG--SGRALDPASRRLLAFDFLGA---------------------------
METXS_BREDA           -GLGWWSGAVG--VRAPIDLTRFRVLAFDFAPEF--------------------------
METXA_DEIRA           ----WWPDFLG--AGRPLDPADDYVVCANVLGGC------AGTTSA--------------
                          :     .      .:         :                               

METXA_NOSP7           ------------TTINPTTRKPYGVSFPKITIRDMVRL----------------------
METXA_PELLD           ------------LSPNPATGRHYGPDFPLITIRDMVHV----------------------
MET2_YEAST            ----------LTIN--EETGVRYGPEFPLCTVRDDVRA----------------------
U9T077_RHIID          ----------VTIN--PETGKYYGPEFPLTTPQDDVRL----------------------
R7Z2K7_CONA1          ----------VTAKDGDPAKGLYGPEFPLTTVRDDVNI----------------------
C1G658_PARBD          ----------VTSRDGDKNKGIYGPEFPLTTIRDDVRI----------------------
E9ED85_METAQ          ----------VTAKHGDVSKGNYGPEFPLTTIRDDVKLEWCSLCSLTTDPGTGDADLFFS
FUB5_GIBF5            ----------VTAKNGDYSEGWYGADFPATTIRDDVRL----------------------
U5HBT3_USTV1          ----------TTKNPHRDDGGRWGPEFPATVVRDDVCL----------------------
B8MN38_TALSN          ----------LTANAE--TGRPYGPEFPPTSIRDDVIA----------------------
I2FWN4_USTH4          AKDAQAIQEAQKRKLQWKGDGWWGPEFPATTVRDDVRV----------------------
W7M0B0_GIBM7          ------------LSVRPGSASYYGHTFPKTTIRDDVRI----------------------
METXA_SALRD           ------------VTVNPDTGERYGAGFPPFTTRDTVRL----------------------
METXA_PSYTT           ------------KSINPETGEVYGLNFPLFSIRDVTKS----------------------
METXA_CYCMS           ------------LSNNPNNGKPYYYDFPNITTRDIASA----------------------
A0A2B5FQ06_9BACI      ----------KSVNP-IT-GSEYGMGFPVFTFLDIARVQ---------------------
R8T2A6_BACCE          ----------KSVNP-IT-GSEYGMGFPVFTFLDVARVQ---------------------
A9VL94_BACMK          ----------KSINP-MT-GFEYAMDFPVFTFLDVARMQ---------------------
Q72YZ7_BACC1          ----------KSINP-KT-GDEYAMDFPVFTFLDVARMQ---------------------
G7ZBS2_AZOL4          ----------ASINP-DT-GKPYGMSFPIVTIKDFVNVQ---------------------
METXA_NAUPA           ----------SPIHP-GS-SERYRLKFPVVTIKDMVKAQ---------------------
METXA_CARHZ           ----------SSINP-AT-GRPWGMSFPIITIRDMVNLQ---------------------
METXA_MOOTA           ----------ASINP-AT-GKPYGMDFPAITIRDMVRAQ---------------------
METXA_SYMTH           ----------SSVNP-AT-GRPYGLDFPLVTVRDMVRAQ---------------------
METXA_GEOLS           ----------ASINP-RT-GKRYNLSFPVITVRDMVRAQ---------------------
METXA_CAUVC           ----------ASINP-AT-GKTYGLSFPVITIADMVRAQ---------------------
METXA_NITHX           ----------ASTNP-AT-GTVWGLDFPVITIPDMVRAQ---------------------
METXA_ZYMMO           ----------SSFTP-GT-ETPYAMNFPVITIRDMVRAQ---------------------
METXA_PELUB           ----------SEINP-DT-NKKYGTTFPVITINDMVNAQ---------------------
METXA_GLUOX           ----------RSICA-ET-GKAWDSEFPPITMHDIVAAQ---------------------
METXA_DESPS           ----------ASKNS-ET-GEAYALDFPMVTIGDMVATQ---------------------
METXS_MAGMM           ----------SSIDP-AT-GMPYGLNFPMITIGDIVRVQ---------------------
METXS_NOCSJ           ----------LSTDP-AT-GAPYCLDFPMLHMSDLVAAH---------------------
METXS_ACIBS           ----------TSPNP-ENDNRPYGPDFPLVTVRDWVKTQ---------------------
METXS_PSEF5           ----------SSLNP-DT-GKPFGADFPVLTVEDWVHSQ---------------------
METXS_DECAR           ----------SSLNP-AT-GKPWGADFPIVAVNDWVHAQ---------------------
METXS_NITEU           ----------ISIND-KT-GKRFGPDFPLVTTADWAKTY---------------------
METXS_CUPNH           ----------MSLNP-AT-GAPYGAAFPVVTVEDWVNAQ---------------------
METXA_HAEIN           ----------SSINP-QT-GKPYGSQFPNIVVQDIVKVQ---------------------
E1QJW4_DESB2          ----------GSIDP-AT-GRPFGLRLPPLTVADMVAAQ---------------------
METXA_HALSA           ----------PADGP-GG--DPWGTAFPPVTVPDWTRCQ---------------------
Q18E47_HALWD          ----------ASTDP-EG--EVYATDFPPVTVQDWTRAQ---------------------
SST_SCHPO             ----------SSVDP--GDGKHYATRFPIITVNDMIRAQ---------------------
I1BUI1_RHIO9          ----------SSIDP--ADGERYATRFPIVTIFDMVRAQ---------------------
M3ISF8_CANMX          ----------SSIDP--ANDEQYATRFPILSVNDMVRAQ---------------------
W1Q867_OGAPD          ----------SSTDP--SDGQVYATRFPIISVNDMVRAQ---------------------
C5DPX0_ZYGRC          ----------SSPDP--ADGLPYATRFPMLSVHDMVRAQ---------------------
E9DBY2_COCPS          ----------SSIDP--SDGKRYATRFPILTLDDMVRAQ---------------------
SST_EMEND             ----------STVDP--SDGKKYATRFPILTIEDMVRAQ---------------------
Q6CAU6_YARLI          ----------SSIDP--ASGKRYATSFPIVSINDMVRGQ---------------------
I2FQ00_USTH4          ----------SSPHPGDPSGAAYATRFPILSIFDMVRAQ---------------------
K5XXI1_AGABU          ----------SSIEP--ETEKPWGTRFPVISIFDMVQAQ---------------------
Q5KGQ3_CRYNJ          ----------SSPYPPGDGQTRWATRFPLLSVHDMTRAQ---------------------
SST_XANOR             ----------ASVNP--ATGALYRLTFPDLSIEDVADAA---------------------
METXA_NOCFA           ----------GSTAP---DGKPWGSRFPAISIRDQVTAE---------------------
METXA_MYCLE           ----------SSLAR---DGKPWGSRFPLISIRDQVEAD---------------------
METXA_THEFY           ----------SSTAP---DGRPWGSRFPRITIRDTVRAE---------------------
METXA_LEIXX           ----------TSIAP---DGAEWGARFPFTTIRDQVKAQ---------------------
METXA_CORDI           ----------SSPHP---DGKPWGSRFPALSIRDLVNAE---------------------
METXA_CORGL           ----------GSMHP---DGNFWGNRFPATSIRDQVNAE---------------------
METXA_CORU7           ----------SSLHP---EGGFWGSRFPGLSIRDLVQAE---------------------
A9WMJ0_RENSM          ----------SSLAP---DGVPWGSRFPYLTLRDSVRSE---------------------
METXA_THET8           ------------LSLDPRTGRPYGRDFPPLTIRDLARAQ---------------------
METXS_XANCP           ----------------------DGSLDAPIDTADQADAI---------------------
Q8PI58_XANAC          ----------------------DGILDAPIDTADQADAI---------------------
METXS_BREDA           -----------------GEDVKDAKTPLTITTQDQARLL---------------------
METXA_DEIRA           -----------------AELAATCSGPVPLSLRDMARVG---------------------
                                                       *                          

METXA_NOSP7           -QAVLLEYLGVQSLRFVIGGSLGGMQSLEWALLYPDK--------------VKSIAPIAV
METXA_PELLD           -ERHLLRHLGIERVKLVVGASLGGMQVLEWGALYPEV--------------ALALMPMGI
MET2_YEAST            -HRIVLDSLGVKSIACVIGGSMGGMLSLEWAAMYGKE-------------YVKNMVALAT
U9T077_RHIID          -HKLILDSLGINQVAICIGGSMGGMQILEWS-FFGPE-------------YVKTLVPIAT
R7Z2K7_CONA1          -FKLILDELGVRQIAAVIGGSMGGMLVLEFA-YFGTD-------------YVRSIIPIAT
C1G658_PARBD          -HKLVLDDLGVRQIASVVGGSMGGMLVLEYA-FFGKD-------------YVRSIVPIAT
E9ED85_METAQ          LHKLLLDDLGVKQVAAVIGGSLGGMFVLEWA-YFGKD-------------YIRCIVPIAT
FUB5_GIBF5            -HKLVLDRLGVRKVAAVIGGSMGGMHVLEWA-FFGKD-------------YVRCIVPAAT
U5HBT3_USTV1          -QKLLLDHLGVARVSVVIGGSMGGMQCLEWPLCTPPG-------------YVSNICPVAT
B8MN38_TALSN          -HKLVLDALGVLSVAAVIGGSMGGMTTIEWPLCTPPG-------------FVKAVIPIAT
I2FWN4_USTH4          -QKLVLEYLGVEVISAVVGGSMGGMAVLEWPLLFPTRFPGLPDHASAKRRYIQAIVPLAT
W7M0B0_GIBM7          -QKIAVELLGVRSIYCVIGGSMGGMMALEWALLGQH--------------FVRSMVLVAT
METXA_SALRD           -HRRALETLGVQRVACAVGGSMGGMHVLEWAFEATDD----------GAPFVRSLVPIAV
METXA_PSYTT           -LELLSEALEIEHIQFLIGGSMGGMQAMEWAIEKPDK--------------IKNLILLAT
METXA_CYCMS           -LDKLRIHLGLEKINTVIGGSLGGQVGLEWAVSLGEK--------------LENAIIVAS
A0A2B5FQ06_9BACI      -YELV-NAMGITRLHAVIGPSAGGMIAQQWAVRYPHM--------------VERMIGVIT
R8T2A6_BACCE          -YELV-NAMGITRLHAVIGPSAGGMIAQQWAVRYPHM--------------VERMIGVIT
A9VL94_BACMK          -YELI-KDMGIARLHAVMGPSAGGMIAQQWAVHYPHM--------------VERVIGVIT
Q72YZ7_BACC1          -YELI-KDMGIARLHAVMGPSAGGMIAQQWAVHYPHM--------------VERMIGVIT
G7ZBS2_AZOL4          -KALI-DSLGIKSLQAVMGGSMGSLQAFEWAADHPDM--------------VKRLIAVIG
METXA_NAUPA           -KILL-DSLGIRHLKAIVGGSMGGMQALRFAVDFPGF--------------CENIIPIAT
METXA_CARHZ           -YKLV-RHLGITKILAAVGGSMGGMQALEWAYMYPEM--------------LKSVVAIAT
METXA_MOOTA           -KILL-DYLGVKRLVAAIGGSMGGMQVLEWGFLYPQM--------------LDAIIPIAT
METXA_SYMTH           -ARLL-DLLGVRRLLAVIGGSLGAMQALEWAATYPDR--------------MRGIIPIGG
METXA_GEOLS           -ELLL-DHLGIRRLLCVMGGSMGGMQALEWATQYPER--------------VASVVALAT
METXA_CAUVC           -AMLV-SALGVETLFAVVGGSMGGMQVQQWAVDYPER--------------MFSAVVLAS
METXA_NITHX           -AMLI-DRLGIDTLFSVVGGSMGGMQVLQWCVAYPQR--------------VFSALPIAC
METXA_ZYMMO           -AKLL-DYLGIRQLKAVIGGSMGGMQALEWASTYPDR--------------VKSVVIIAS
METXA_PELUB           -FNLL-NFFNIEKLFAVMGGSMGGMQTLQFVNNFPDK--------------AKVAIPIAC
METXA_GLUOX           -AKLI-DHLGIDRLFAVIGGSMGGMQALTWAADFPDR--------------VFAAMPIAT
METXA_DESPS           -KLLI-DHLGIPKLLAVIGGSVGGMQTLEWAIRYPEM--------------MHSVIPIAT
METXS_MAGMM           -HALV-RQLGIERLMAVVGGSMGGMQALQWALDYPHM--------------VPASVIIAA
METXS_NOCSJ           -RRLV-AHLGIERLHAAVGGSLGGMQVLQWVIDEPDA--------------LERAVLVAA
METXS_ACIBS           -AMLS-DRLGISVWYAVVGGSLGGMQALQWSVDYPDR--------------LQKCVVIAS
METXS_PSEF5           -ARLA-DRLGISQWAAVIGGSLGGMQALQWTITYPDR--------------VRHCLAIAS
METXS_DECAR           -ARLA-DLLGIDSWAAVMGGSLGGMQALRWSITFPER--------------VRNAIVIAA
METXS_NITEU           -VRFA-DQFSIDCFAAVIGGSLGGMSAMQLALDAPER--------------VRHAIVVAA
METXS_CUPNH           -ALVA-DAFGITQFAAVMGGSLGGMQAVAWSLLYPER--------------LRHCIVVAS
METXA_HAEIN           -KALL-DHLGISHLKAIIGGSFGGMQANQWAIDYPDF--------------MDNIVNLCS
E1QJW4_DESB2          -VRLA-DRLGVERFHCVIGGCMGGFQALEWLAAHPQR--------------LESAIVIGS
METXA_HALSA           -RRLL-DTLGVDRLHAVVGGSVGGMNALDWARRYPDD--------------VHRIAAVAT
Q18E47_HALWD          -RQVL-DTLGVGRLHAVAGGSVGGMNALDWARQYPDD--------------AECIIAVAA
SST_SCHPO             -LLLL-DHLKIEKLYASVGSSLGGMQSLTLGALAPHR--------------VGRIASISG
I1BUI1_RHIO9          -FKLL-DHLGIQRLHASVGSSMGGMQSIAAAKLFPDR--------------VNRLISISA
M3ISF8_CANMX          -RELVRDEFGVTKIHASVGASMGGMQSLAYGWEFPDE--------------VEKIISISG
W1Q867_OGAPD          -HRLVKQHFKIDRLHAVMGSSMGGMQCLAYAHEFTDE--------------VAKVVSISG
C5DPX0_ZYGRC          -KRLINEHFGIEKLYASLGSSMGGMQSLSYAQQFPSE--------------VNKVISVSA
E9DBY2_COCPS          -FRLL-DSLGVSKLYASVGSSMGGMQSLAAGVLFPER--------------VGRIVSISG
SST_EMEND             -FRLL-DHLGVRKLYASVGSSMGGMQSLAAGVLFPER--------------VGKIVSISG
Q6CAU6_YARLI          -NRLI-RSLGIKKLHASVGSSMGGMQSLAYANDFSAE--------------VDRVVSVSG
I2FQ00_USTH4          -FLLL-DHLGIDKLYASVGSSMGGMQSIAAAHLQGDR--------------VSKLVSISG
K5XXI1_AGABU          -FVLL-DSLGINKLYASVGCSMGGMQSLAAGWLYPSR--------------VGKIVSISG
Q5KGQ3_CRYNJ          -ISLM-DYLGINKLYASVGSSMGGMQSLSLAYLAPER--------------VGRIVSISA
SST_XANOR             -ADVV-RALGIAQLACLIGNSMGGMTALALLLRHPGI--------------ARSHINISG
METXA_NOCFA           -AALF-DRIGIHRLAAVVGGSMGGMRVLEWMVGAPER--------------VAAALVLAV
METXA_MYCLE           -IAAL-AAMGITKVAAVVGGSMGGARALEWIIGHPDQ--------------VRAGLLLAV
METXA_THEFY           -FALL-REFGIHSWAAVLGGSMGGMRALEWAATYPER--------------VRRLLLLAS
METXA_LEIXX           -AAFA-DALGIGRWAAVVGGSMGGMQALEWAVGFPER--------------VERLAVIAA
METXA_CORDI           -KQLF-DHLGINKIHAIIGGSMGGARTLEWAALHPHM--------------MTTGFVIAV
METXA_CORGL           -KQFL-DALGITTVAAVLGGSMGGARTLEWAAMYPET--------------VGAAAVLAV
METXA_CORU7           -KQLL-DVLEIPRVHVIIGASMGGARTLEWSLLYPEM--------------MDAILPIAV
A9WMJ0_RENSM          -AVLS-DALGIQQWHAVIGGSMGGARALEWAAEFPDR--------------LRQAVILAS
METXA_THET8           --ARLLDHLGVEK-AIVIGGSLGGMVALEFALMYPER--------------VKKLVVLAA
METXS_XANCP           --AALLDALGIARLHGFVGYSYGALVGLQFASRHAAR--------------LHTLVAVSG
Q8PI58_XANAC          --AALLDALGIGRLHGFVGYSYGALVGLQFAIRHEAR--------------VGTLVAVSG
METXS_BREDA           --ALLLDHLGVEKVAAFIGCSYGGMIALAFGELFPDW--------------AEQLVVVSA
METXA_DEIRA           --RALLDSLGVRR-VRVIGASMGGMLAYAWLLECPDL--------------VEKAVIIGA
                              : :       * . *.                                    

METXA_NOSP7           SGR-HSAWCIGLSEAQRQAIYADPNWQGGNYTLDAP-------PNQGLAVARMMAMSTYR
METXA_PELLD           SGR-HSAWCIAQSEAQRQAIMADALWKDGWYEEDAP-------PARGLGAARMMAMCTYR
MET2_YEAST            SAR-HSAWCISWSEAQRQSIYSDPNYLDGYYPVEEQ-------PVAGLSAARMSALLTYR
U9T077_RHIID          SAR-NSAWCISWNEAQRQSIYSDIKYRDGYYDQNDP-------PASGLSAARMSALLTYR
R7Z2K7_CONA1          SAR-YSAWGISWGEAQRQSIYSDPKYDDGYYSFGDP-------PSTGLGAARMSALLTYR
C1G658_PARBD          SSR-HSAWGISWGEAQRQSIYSDPKYEDGYYSFDDP-------PATGLGAARMSALLTYR
E9ED85_METAQ          SSR-HSAWGISWGEAQRQSIYADPKYDDGYYPFDDP-------PATGLGAARMAALLTYR
FUB5_GIBF5            SSH-QSAWAIGWGEAQRHAIRSDVKYKNGRYGFDDP-------PILGLEAARMTALLTYR
U5HBT3_USTV1          SAR-HSAWGISWGEAQRQSIYSDPDYQAGWYAEDGQG------PERGLAAARMAALLTYR
B8MN38_TALSN          SIA-QSAWGISWSEVQRRCILSDPLFRDGYYELNQQ-------PTSGLATARMVAMLTYR
I2FWN4_USTH4          SAR-HSAWCISWAEAQRQSIYSDPLFKHGYYEPEQP-------PRNGLSAARMAALLTYR
W7M0B0_GIBM7          AAR-QSPWAIAWSENQRATIKSDPKFRSGRYG-DDP-------PRDGLAAARMAAMISYR
METXA_SALRD           GGR-HTAWQIGWGAAQRQAIFADPKWRDGTYPPDDP-------PTNGLATARMMAMVSYR
METXA_PSYTT           NAK-HSSWGIALNETQRMAIEADSTFYKKETNSGKK----------GLEAARAIALLSYR
METXA_CYCMS           NAK-ASPWIIGFNETQRMAIESDSTWGKTQPEAGKK----------GLETARAIGMLSYR
A0A2B5FQ06_9BACI      NPQNLVVTSVNVLQNAIEAIQLDPKWNDG-NYGDEQP-------TKGLHLAGKMMFINGF
R8T2A6_BACCE          NPQNPVVTSVNVLQNAIEAIQLDSKWNDG-NYGDEQP-------TKGLHLAGKMMFINGF
A9VL94_BACMK          NPQNPIITSGNVAQNAIEAIQLDPNWKGG-KYGEEQP-------TKGLHLANRMMFMNAF
Q72YZ7_BACC1          NPQNPIITSVNVAQNAIEAIELDPSWKGG-KYGEEQP-------MKGLHLANRMMFMNAF
G7ZBS2_AZOL4          GPE-ADPFLIGWLNLWAAPIKLDPNWNNGDYYGKAEP-------KAGLTEALKLVTLHAR
METXA_NAUPA           TYQ-TKPYVIAINKSMIEAIRADSEFKNGNYDPDIIKQ----NGLKGLAAARMIGYLNYI
METXA_CARHZ           SAR-LSPFGIAFNAVGREAIMTDPEWRGGNYYGFEGP-------KRGLALARMIGIITYK
METXA_MOOTA           CGR-TTPMQIAFHHVQREAIYADPDWQGGNYYGTAGP-------RRGLALARQIGIITYK
METXA_SYMTH           AGR-FHPQGIAFNEVQRQAILNDPGFLGGQYYGTPGP-------VRGLATARMLGMITYR
METXA_GEOLS           TPR-PSPQAISLNAVARWAIYNDPTWKKGEYKHN--P-------KDGLALARGIGHITFL
METXA_CAUVC           ASR-HSAQNIAFHEVGRQAIMADPDWRGGAYAEHG------VRPEKGLAVARMAAHITYL
METXA_NITHX           STR-HSAQNIAFHELGRQAVMADPDWRDGRYVEQG------TYPHRGLGVARMAAHITYL
METXA_ZYMMO           TAR-HSAQNIAFHEVGRQAIMADPKWRQGNYYEEK------DPPVAGLAVARMAAHITYL
METXA_PELUB           TAS-HSAQNIAFNELGRQSIMADANWENGDYSNQN------KNPNKGLSVARMAAHITYL
METXA_GLUOX           SPF-HSAQNIAFNEVSRQAIFADPDWHDGHYRDFG------AIPARGLGVARMMAHITYL
METXA_DESPS           TMR-HSALAIAFNEIARQAIMTDPHWNRGKYYGQ-------AHPDTGLAVARMVGHVTYL
METXS_MAGMM           APR-LTAQNIAFNAVARQAIMADPHFNGGDYYTLPGDPTTKARPESGLALARMMAHITYL
METXS_NOCSJ           SSR-LSPENIAFSAIGREAIMSDPDFCNGRYVEQ------GVFPWRGQKVARMMAHITYV
METXS_ACIBS           APK-LSAQNIAFNEVARQSILSDPDFHHGRYLEN------DSYPKRGLILARMVGHITYL
METXS_PSEF5           APK-LSAQNIAFNEVARQAILTDPEFHGGSFQEQ------GVIPKRGLMLARMVGHITYL
METXS_DECAR           APK-LSAQNIAFNDVARQAILTDPDFHGGHYYEH------NTRPVRGLRLARMLGHITYL
METXS_NITEU           SAR-LTAQNIAFNDVARQAILTDPDFHDGDYYSH------GTHPRRGLRLARMLGHITYL
METXS_CUPNH           TPK-LSAQNIAFNEVARSAILSDPDFHGGNYYAH------GVKPKRGLRVARMIGHITYL
METXA_HAEIN           SIY-FSAEAIGFNHVMRQAVINDPNFNGGDYYEG-------TPPDQGLSIARMLGMLTYR
E1QJW4_DESB2          AAR-VSAHTLALWEVIREAIRRDPGFNGGDYYDGPAP-------ASGMSLGSMFGMMIWM
METXA_HALSA           APR-LDAQCLGLNAIARRAIRGDPNWNDGDYYGG-------AHPDRGLALARQLGHVMYL
Q18E47_HALWD          APR-LDAQSLALDAIARRAITTDPNWNDGDYYDAE------TTPTDGLAIARQIGHVMYL
SST_SCHPO             GAR-SHPYSIALRFTQRQILMNDPYWNRGFYY-------DGVPPHTGMKLAREVATISYR
I1BUI1_RHIO9          CAR-SHPYSIALRHTQRQVLMADPNWNKGFYY-------KGIPPHVGMKLAREIATISYR
M3ISF8_CANMX          CAR-SHPYSIALRHTQRQVLMSDPNWNRGFYY-------GKIPPHVGMKLAREIATVTYR
W1Q867_OGAPD          CAR-SHPYSIAMRHCQRQVLMTDPNWNKGFYY-------GSLPPHTGMKLAREIATITYR
C5DPX0_ZYGRC          CAR-SHPSSIAMRHAQRQVLMGDPNWNRGFYYPTAAEP-NKIPPHVGMKLAREIATVTYR
E9DBY2_COCPS          CAR-SHPYSIAMRHTQRQVLMMDPNWARGFYY-------DSIPPHSGMKLAREIATVTYR
SST_EMEND             CAR-SHPYSIAMRHTQRQVLMMDPNWARGFYY-------DSIPPHSGMKLAREIATVTYR
Q6CAU6_YARLI          CAR-SHPYSIAMRHVQRQILMSDANWKRGNYY-------DSVPPHVGMKLAREVATITYR
I2FQ00_USTH4          CAR-SAPASIALRHAQRSVLMSDPNWNRGFYYQP-----RSLPPHTGMKLARQIATFTYR
K5XXI1_AGABU          TAR-SAPSSIAMRYAQRSVLMADPNWNNGFYYD-------GLPPHTGMKLARQIATITYR
Q5KGQ3_CRYNJ          CGR-SGLNGVGMRYAQRSVLMADPNWNRGFYYD-------GVPPHNGMKLARQIATITYR
SST_XANOR             SAQ-ALPFSIAIRSLQREAIRLDPHWNGGHYD-------DTRYPESGMRMARKLGVITYR
METXA_NOCFA           GAR-ATADQIGTQTTQIAAITADPDWQGGDYHD------TGRAPTTGMGIARRIAHLTYR
METXA_MYCLE           GVR-ATADQIGTQTTQIAAIKTDPNWQGGDYYE------TGRAPENGLTIARRFAHLTYR
METXA_THEFY           PAA-SSAQQIAWAAPQLHAIRSDPYWHGGDYYDR-----PGPGPVTGMGIARRIAHITYR
METXA_LEIXX           PPH-STADQIAFNSVQLGAIRTDPLFHGGSYYDEK----DGEGPHQGLALARRMALITYR
METXA_CORDI           SAR-ASAWQIGIQTAQISAIELDPHWNGGDYY-------SGHAPWEGIAAARRIAHLTYR
METXA_CORGL           SAR-ASAWQIGIQSAQIKAIENDHHWHEGNYYE------SGCNPATGLGAARRIAHLTYR
METXA_CORU7           SAR-ASAWQIGIQSAQIRVIEADPLWHGGDYYE------AGMGPVWGLGEARRIAHLTYR
A9WMJ0_RENSM          CGA-STAEQIALAQTQVLAIWQDANFDGGDYY-------SGRPPLAGLGLARRIAHISYR
METXA_THET8           PAR-HGPWARAFNHLSRQAILQDPEYQKG------------NPAPKGMALARGIAMMSYR
METXS_XANCP           AHR-AHPYAAAWRALQRRAVALGQLQCAE---------------HHGLALARQFAMLSYR
Q8PI58_XANAC          AHR-AHPYAAAWRALQRRAVALGQLQCAE---------------QHGLALARQFAMLSYR
METXS_BREDA           AHR-PHPLATAWRGIQRRILQLGLETGRI---------------DQAVGLARELAMTTYR
METXA_DEIRA           PAR-HSPWAIGLNTAARSAIALAP-------------------GGEGLKVARQIAMLSYR
                                         :                          .   .         

METXA_NOSP7           SWDSFTTRFGRQYDP---------------------------------------------
METXA_PELLD           SFRNFEEKFGRQRQE---------------------------------------------
MET2_YEAST            TRNSFENKFSRRSPS--------------------IAQQQKAQREETRKPSTVSEHSLQI
U9T077_RHIID          SRDSFESRFGRKFQD--------------------PKKHPTVSNSQKKTSLSPAEKALLI
R7Z2K7_CONA1          SRDSFESRFGRNTPD--------------------PSRRQNIN--GIQRPSSAGHEHFAI
C1G658_PARBD          SRNSFESRFGRNVPD--------------------PSKRQNIN--GTLRLPTPPNEHWAV
E9ED85_METAQ          SRNSFESRFGRNIPD--------------------PSKVQTIR--ERPRPSTPSEAHFHI
FUB5_GIBF5            SRDSLERRFGRDTGN--------------------KKKAKNKG--SETLPSNS----TPI
U5HBT3_USTV1          SRDSFESRFGRKEN---------------------PSTPREGSPKIDGASGLGRGKITDA
B8MN38_TALSN          SGESFEKRFGRK-----------------------PSSQRK-------------------
I2FWN4_USTH4          SRDSFESRFGRRVGKALKAGGQRLSGKKEEQVAKGEDERRSKSIAADAAEAHNEGNLSPR
W7M0B0_GIBM7          THSSFEKRFGRRRLETY------------------AAPNKMLSKVNGNRVPFAVDVQCAA
METXA_SALRD           SRPSLDGRFGRDAMP---------------------------------------------
METXA_PSYTT           NYNTYRHTQVDQEHT---------------------------------------------
METXA_CYCMS           HPMTFLQNQSETEEK---------------------------------------------
A0A2B5FQ06_9BACI      DAHYYETTFPRNSTE--------------------------------------------T
R8T2A6_BACCE          DAHYYETTFPRNSAE--------------------------------------------T
A9VL94_BACMK          DEHFYETAFPRNSIE--------------------------------------------M
Q72YZ7_BACC1          DEHFYETTFPRNSIE--------------------------------------------K
G7ZBS2_AZOL4          HWKWADAAFGRKWAEEG------------------------------------------K
METXA_NAUPA           SPKTFERKFGREYVK--------------------------------------------T
METXA_CARHZ           SDISWQYRFGRTHTYET------------------------------------------D
METXA_MOOTA           SDPSWNMKFGRNLVDP--------------------------------------------
METXA_SYMTH           SDESMWTQFGRNPQGEA------------------------------------------N
METXA_GEOLS           SDESMWQKFERRFSAK--------------------------------------------
METXA_CAUVC           SEPALQRKFGRELQ-RD------------------------------------------G
METXA_NITHX           SDAALHRKFGRRMQDRD------------------------------------------L
METXA_ZYMMO           SESGLTARFGRRLQSRQ------------------------------------------E
METXA_PELUB           SKNGLQEKFGRKLQERD------------------------------------------D
METXA_GLUOX           SEEALSRKFGRRVRHDA------------------------------------------A
METXA_DESPS           SDEAMRRKFGRNLQEKE------------------------------------------N
METXS_MAGMM           SEQGLHERFGRRLQDRD------------------------------------------A
METXS_NOCSJ           SAQSLETKFGHRRRSR-------------------------------------------G
METXS_ACIBS           SEEAMKQKFGRDLKSG-------------------------------------------K
METXS_PSEF5           SDDSMGEKFGRGLKSE-------------------------------------------K
METXS_DECAR           SDDQMGEKFGRELRNS-------------------------------------------A
METXS_NITEU           SDDSMASKFGRELRNG-------------------------------------------S
METXS_CUPNH           SDEDMAEKFGRELKTD-------------------------------------------D
METXA_HAEIN           TDLQLAKAFGRATKSDG------------------------------------------S
E1QJW4_DESB2          SKEVMERRFGLRTIDG-------------------------------------------G
METXA_HALSA           SKASMADKFGRRTATTD------------------------------------------T
Q18E47_HALWD          SKSSMQQKFARRAAGRD------------------------------------------A
SST_SCHPO             SGPEWEQRFGNRRAD--------------------------------------------P
I1BUI1_RHIO9          SGPEWELRFGRKRAK--------------------------------------------E
M3ISF8_CANMX          SGPEWEYRFGRQRAD--------------------------------------------E
W1Q867_OGAPD          SGPEWESRFGVERAD--------------------------------------------P
C5DPX0_ZYGRC          SGPEWESRFGTERLD--------------------------------------------D
E9DBY2_COCPS          SGPEWEKRFGRARAD--------------------------------------------P
SST_EMEND             SGPEWEKRFGRKRAD--------------------------------------------P
Q6CAU6_YARLI          SGPEWEQRFGRDRAD--------------------------------------------P
I2FQ00_USTH4          SGPEWEQRFGRARRVAPT------------------------------SERNEGSEGGQE
K5XXI1_AGABU          SGPEWDQRFGRQLR--ET------------------------------SESNTQKLG--P
Q5KGQ3_CRYNJ          SGPEWEQRFGRQMI----------------------------------SEQDAQLDAQGN
SST_XANOR             SALEWDGRFGRVRLD------------------------------------------SEQ
METXA_NOCFA           TEDELDHRFANHAQDGE------------------------------------------D
METXA_MYCLE           SEVELDTRFANNNQGNE------------------------------------------D
METXA_THEFY           GATEFDERFGRNPQDGE------------------------------------------D
METXA_LEIXX           SLSELNDRFERTWQSGI------------------------------------------S
METXA_CORDI           GELEIDERFGTSAQHGE------------------------------------------N
METXA_CORGL           GELEIDERFGTKAQKNE------------------------------------------N
METXA_CORU7           GELEVDERFGAEPQQGE------------------------------------------N
A9WMJ0_RENSM          SEAELGHRFGRAAQGGE------------------------------------------Q
METXA_THET8           APEGFEARWGAEPELG--------------------------------------------
METXS_XANCP           TPEEFSERFDAPPELING------------------------------------------
Q8PI58_XANAC          TPEEFSERFDAPPEVING------------------------------------------
METXS_BREDA           TQEEFGDRFDSEAPSHAG------------------------------------------
METXA_DEIRA           SPESLSRTQAGQRVPGV-------------------------------------------
                                                                                  

METXA_NOSP7           ------------------------------------------------------------
METXA_PELLD           ------------------------------------------------------------
MET2_YEAST            HNDGYKTKAST---------AIAGISGQKGQSVVSTASSSDSLNSSTSMTSVS-------
U9T077_RHIID          HNDGHKSE---------------NFSITNNNNKTTDAENNDNEHSTKSVPHV--------
R7Z2K7_CONA1          HNEGHKNAGSPRNSRTNSTADLQKSAAQSTKPASPSLNTDPEFHGSNTLPASSP------
C1G658_PARBD          HNDGHRSTRPP-------------PTPNNSGPESNEVFTDPQFNGATLFTAPS-------
E9ED85_METAQ          HNDGHNIKRKS------TSRQASASPGSNKATTPPADAPDPQFHGPRKHEGVD-------
FUB5_GIBF5            HSQGGADETPV-------------------------------------------------
U5HBT3_USTV1          WGTPRTQAERAEAAHNDGHRPTVATRPASPTSRSPSTMAPGTKGGDLPLTESG-------
B8MN38_TALSN          -----------------HFIPPTVEPACNGSSTHPSVNLPAP------------------
I2FWN4_USTH4          AKPYGSNSSPSSNGHSYLPSPTEAKPAEADPALSPTATTPPVPNTPHPPTELSDEAVTTT
W7M0B0_GIBM7          RDDGHYDK----------------------------------------------------
METXA_SALRD           ------------------------------------------------------------
METXA_PSYTT           ------------------------------------------------------------
METXA_CYCMS           ------------------------------------------------------------
A0A2B5FQ06_9BACI      LPYENFSAR---------------------------------------------------
R8T2A6_BACCE          LPYENFSAR---------------------------------------------------
A9VL94_BACMK          APYQEFSAL---------------------------------------------------
Q72YZ7_BACC1          EPYETFSAL---------------------------------------------------
G7ZBS2_AZOL4          DPKAAMGNQ---------------------------------------------------
METXA_NAUPA           DGMFELFGR---------------------------------------------------
METXA_CARHZ           QELFSHTSR---------------------------------------------------
METXA_MOOTA           RKYFQLEGQ---------------------------------------------------
METXA_SYMTH           PLHQGFAVA---------------------------------------------------
METXA_GEOLS           DGLFDFFGQ---------------------------------------------------
METXA_CAUVC           LSWGF-DAD---------------------------------------------------
METXA_NITHX           PTFSF-DAD---------------------------------------------------
METXA_ZYMMO           KSFGF-DAD---------------------------------------------------
METXA_PELUB           LKFGF-DAD---------------------------------------------------
METXA_GLUOX           TAVPA-SSSPSLF-----------------------------------------------
METXA_DESPS           LSYGF-DAD---------------------------------------------------
METXS_MAGMM           LSYGF-ETD---------------------------------------------------
METXS_NOCSJ           DAWTL-GPD---------------------------------------------------
METXS_ACIBS           FMYGF-DVE---------------------------------------------------
METXS_PSEF5           LNYDFHSVE---------------------------------------------------
METXS_DECAR           FSFGY-GVE---------------------------------------------------
METXS_NITEU           LAFNY-DVE---------------------------------------------------
METXS_CUPNH           IRFSF-DVE---------------------------------------------------
METXA_HAEIN           FWGDY-------------------------------------------------------
E1QJW4_DESB2          PPRISLEPQ---------------------------------------------------
METXA_HALSA           ---ALPADPAAEF-----------------------------------------------
Q18E47_HALWD          RRDSFPVDPAAAF-----------------------------------------------
SST_SCHPO             SVSPAFCPD---------------------------------------------------
I1BUI1_RHIO9          NQSPALCPD---------------------------------------------------
M3ISF8_CANMX          TKPPALCPD---------------------------------------------------
W1Q867_OGAPD          SKQPALCPD---------------------------------------------------
C5DPX0_ZYGRC          ERSPVLCPD---------------------------------------------------
E9DBY2_COCPS          SKQPALCPD---------------------------------------------------
SST_EMEND             SKQPALCPD---------------------------------------------------
Q6CAU6_YARLI          TRAPALCPD---------------------------------------------------
I2FQ00_USTH4          ELDPALCPD---------------------------------------------------
K5XXI1_AGABU          DRMPALCPD---------------------------------------------------
Q5KGQ3_CRYNJ          PGVPRLSPD---------------------------------------------------
SST_XANOR             SEDDPFGLE---------------------------------------------------
METXA_NOCFA           PFD---------------------------------------------------------
METXA_MYCLE           PAT---------------------------------------------------------
METXA_THEFY           PMA---------------------------------------------------------
METXA_LEIXX           PLGD--------------------------------------------------------
METXA_CORDI           PLGPFRDPH---------------------------------------------------
METXA_CORGL           PLGPYRKPD---------------------------------------------------
METXA_CORU7           PLGKFRSPD---------------------------------------------------
A9WMJ0_RENSM          PISLERGEQPE-------------------------------------------------
METXA_THET8           ------------------------------------------------------------
METXS_XANCP           ------------------------------------------------------------
Q8PI58_XANAC          ------------------------------------------------------------
METXS_BREDA           ------------------------------------------------------------
METXA_DEIRA           ------------------------------------------------------------
                                                                                  

METXA_NOSP7           --------------------------------SEKFAIASYLQHQGQKLTERFDANTYII
METXA_PELLD           --------------------------------DGTFKAVSYMHHQGGRLVERFDANTYIT
MET2_YEAST            --------------------SVTGEVKDIKPAQTYFSAQSYLRYQGTKFINRFDANCYIA
U9T077_RHIID          -----------------------------------FSAQSYLRYQGDKFVNRFDANCYIN
R7Z2K7_CONA1          ------------SLAPPISRTTSTLTGATKRTPTYFSAQSYLRYQGEKFIKRFDANCYIA
C1G658_PARBD          ------------------SPTSTTPSERSWRPTTYFSAQSYLRYQGQKFVKRFDSNCYIA
E9ED85_METAQ          --------------------SESLTGGETLPQSQYFSAQSYLRYQGTKFVKRFDSNCYIA
FUB5_GIBF5            ---------------------------AFDRADSNFAAQSYLRYQAKKFSDRFDSNCYIA
U5HBT3_USTV1          ------------------------EPLPPPSPPPIFSAQSYLRYQGDKFVRRFDANCYIH
B8MN38_TALSN          ---------------------------PSKTPMRQFSAQDYLDYQGAKFLRRFDANCYLH
I2FWN4_USTH4          SNGTHATLPPALTTAAAAAVQRLVEPFSPSTAPQIFSAQSYLRYQGDKFVKRFDANCYIH
W7M0B0_GIBM7          --------------------------------SGIFLAQSYLRYQGEKFNARFDANCYLH
METXA_SALRD           -----------------------------EQDGTPYAVESYLHHHGNKLVDRFDANCYVA
METXA_PSYTT           --------------------------------ADHFRASTYQKYQGEKLSKRFNAKCYWY
METXA_CYCMS           --------------------------------RDDFKISSYLRYQGLKLANRFNAMSYWI
A0A2B5FQ06_9BACI      -----------------------------------TSFEQNINALTLQNITFVDANSWMY
R8T2A6_BACCE          -----------------------------------TSFEQNINALTLQNITFVDANSWMY
A9VL94_BACMK          -----------------------------------TSFEKEINKVTCKSIDLVDANSWMY
Q72YZ7_BACC1          -----------------------------------TLFEKEINKVTNRSIALVDANSWMY
G7ZBS2_AZOL4          -----------------------------------YAIEAWLDKAASGRAAVSDANHFLY
METXA_NAUPA           -----------------------------------FQVESYLEYNGAMFPKWFDPLSYIY
METXA_CARHZ           -----------------------------------FEIENYLYYQGDKLVKRFDANTYLY
METXA_MOOTA           -----------------------------------FEVESYLAYQGRKLVDRFDANSYLY
METXA_SYMTH           -----------------------------------YQVESYLHYQGRKLVERFDANSYLY
METXA_GEOLS           -----------------------------------FEVERYLNYNGYNFVDRFDANCFLY
METXA_CAUVC           -----------------------------------FQVESYLRHQGSSFVDRFDANSYLY
METXA_NITHX           -----------------------------------FQVESYLRHQGSSFVERFDANSYLY
METXA_ZYMMO           -----------------------------------FQIESYLRHQGIRFVERFDANSYLY
METXA_PELUB           -----------------------------------FQIESYLRYQGSVFVDRFDANSYLY
METXA_GLUOX           --------------------------------GEMFEVESYLRHQGSSFVRRFDANSYLT
METXA_DESPS           -----------------------------------FQVESYLRYQGNKFVHRFDANSLLY
METXS_MAGMM           -----------------------------------FAVESYLSYQGSSFVKRFDANSYLY
METXS_NOCSJ           -----------------------------------YEVEHYLQHQGQVFLGRFDALSYLY
METXS_ACIBS           -----------------------------------FQVESYLRYQGEQFSRNFDADTYLI
METXS_PSEF5           -----------------------------------FQVESYLRYQGEEFSGRFDANTYLL
METXS_DECAR           -----------------------------------FEVESYLRYQGDKFAGYFDANTYLL
METXS_NITEU           -----------------------------------FQIESYLHHQGDKFADLFDANTYLL
METXS_CUPNH           -----------------------------------FQVESYLRYQGDKFAEYFDANTYLL
METXA_HAEIN           -----------------------------------FQVESYLSYQGKKFLERFDANSYLH
E1QJW4_DESB2          -----------------------------------FAIQEFFQKIGQGGSGGVDPNSLIY
METXA_HALSA           --------------------------------FATRDVESYLDYQADTFVARFDANSYLY
Q18E47_HALWD          --------------------------------FPYRDVESYLDYQAEKFVDRFDPNSYLY
SST_SCHPO             -----------------------------------FLIETYLDHAGEKFCLQYDPNSLLY
I1BUI1_RHIO9          -----------------------------------FLIETYLDHQGEKFCLQYDPNSLLY
M3ISF8_CANMX          -----------------------------------FLVETYLDHAGEKFCLEYDANSWLY
W1Q867_OGAPD          -----------------------------------FLIETYLDHAGEKWCLEYDPNSFLY
C5DPX0_ZYGRC          -----------------------------------FLIETYLDHQGEKFSLEYDANSFLY
E9DBY2_COCPS          -----------------------------------FLIETYLDHAGEKFSLDYDPNSLLY
SST_EMEND             -----------------------------------FLIETYLDHAGEKFCLEYDANSLLY
Q6CAU6_YARLI          -----------------------------------FLIETYLDHAGEKFCLEYDANSLLY
I2FQ00_USTH4          -----------------------------------FLIETYLDHQGEQFCLKYDANSLIY
K5XXI1_AGABU          -----------------------------------FLIETYLDHQGEQFCLKYDANSLIY
Q5KGQ3_CRYNJ          -----------------------------------FLIETYLDHQGERFCLTYDANSLIY
SST_XANOR             -----------------------------------FQVESYLEGHARRFVRFFDPNCYLY
METXA_NOCFA           --------------------------------GGRWAVQSYLEHQAEKLCRRFDPATYVL
METXA_MYCLE           --------------------------------GGRYAVQSYLEHQGDKLLARFDAGSYVV
METXA_THEFY           --------------------------------GGRFAVESYLDHHAVKLARRFDAGSYVV
METXA_LEIXX           --------------------------------GGRFAVESYLDFHGNKFTRRFDANSYLT
METXA_CORDI           ---------------------------------QRFAVTSYLQHQGIKLAQRFDAGSYVV
METXA_CORGL           ---------------------------------QRFAVESYLDYQADKLVQRFDAGSYVL
METXA_CORU7           ---------------------------------QRFSVEGYLDRQAMKLRNRFDAGSYVT
A9WMJ0_RENSM          --------------------------------LNRYQVESYLDHQATKLVQRFDANSYIV
METXA_THET8           --------------------------------------ETYLDYQGEKFLRRFHAESYLV
METXS_XANCP           --------------------------------RVRVAAEDYLDAAGAQYVARTPVNAYLR
Q8PI58_XANAC          --------------------------------RVRVAAEDYLDAAGAQYVARTPVNAYLR
METXS_BREDA           --------------------------------QAYPVC-DYLQARGRAYRDRTTPSRWLS
METXA_DEIRA           -----------------------------------PAVTSYLHYQGEKLAARFDEQTYCA
                                                                                  

METXA_NOSP7           LTHAMDGHDIARDRTAPNL----------SDYESV-------------------------
METXA_PELLD           LTRAMDMHDLGRGR---------------SGYEEA-------------------------
MET2_YEAST            ITRKLDTHDLARDRV--------------DDITEV-------------------------
U9T077_RHIID          LTRKMDSHDIGKDR---------------GKLEDV-------------------------
R7Z2K7_CONA1          ITRKLDTHDVSRGRTDGDVPDSPSSSSSVPALKSA-------------------------
C1G658_PARBD          ITRKLDTHDVSRHRADPD---------STTPVKDA-------------------------
E9ED85_METAQ          MTRKLDTHDVSRGR--------------AETIGDA-------------------------
FUB5_GIBF5            LTNKLDTHDLARGR--------------TRTITEA-------------------------
U5HBT3_USTV1          LTRKMDAHDVGRGR-------------PSNPPP---------------------------
B8MN38_TALSN          LTHKMDMHDVRRGRVPEGCHSNL--NGEGSPPDNI-------------------------
I2FWN4_USTH4          LTRKMDSHDVARDRWGWRFTPDSLSRHSGCKPESMEEEDE--------------------
W7M0B0_GIBM7          ILDKIDSHDIARGRYPGFS--------DDEAMLKV-------------------------
METXA_SALRD           LTRQMDTHDVARGR---------------GDYAKV-------------------------
METXA_PSYTT           LSKAMDSHNVGRNR---------------GDCKKA-------------------------
METXA_CYCMS           LSKAMDSHDIGRGR---------------GGTPVA-------------------------
A0A2B5FQ06_9BACI      TAKATLLHDLAHGFSSLEGALSQIEAD---------------------------------
R8T2A6_BACCE          TAKATLLHDLAHGFSSLEGALSQIEAD---------------------------------
A9VL94_BACMK          TAKAVLLHDIAHGFSSLEEALSNIEAN---------------------------------
Q72YZ7_BACC1          TAKAVLLHDIAHGFSSLEEALSNIEAN---------------------------------
G7ZBS2_AZOL4          LVKANQTFVTGNG-ASLEDGLAKIKAP---------------------------------
METXA_NAUPA           ILKAISLFDISRGFVSLEDAFSQIKDK---------------------------------
METXA_CARHZ           LLKAMDLHDISRGRGRYREILKELKTP---------------------------------
METXA_MOOTA           LTKAVDLHDVSQGRGSYNEVWRDFPCP---------------------------------
METXA_SYMTH           LTRAMDLMDLGRGRGSYEEAHARIQAR---------------------------------
METXA_GEOLS           LAKALDLYDVAWGYESMTDAFSRITAP---------------------------------
METXA_CAUVC           ITRAMDYFDIAASHGGVLAKAFTRARNV--------------------------------
METXA_NITHX           LTRAMDYFDIAADHNGVLAAAFRDTRT---------------------------------
METXA_ZYMMO           ITRATDYFDLAEEHGGKLANAFRGTKS---------------------------------
METXA_PELUB           ITRAMDYFDLVKEHHGNLSKAFEKTKT---------------------------------
METXA_GLUOX           ITRAMDYFDLAAEHDGDLANPFRKSQT---------------------------------
METXA_DESPS           ITKASDYFDIVERISTSGPETELTAPQQ--------------------------------
METXS_MAGMM           ITKAMDYFDPFPD-AETTVQRLTGVES---------------------------------
METXS_NOCSJ           LTRLLDYFDPFAD-PGTAAA-LRSTAT---------------------------------
METXS_ACIBS           MTKALDYFDPSREYGHSLTEAMSKTKC---------------------------------
METXS_PSEF5           MTKALDYFDPAANCDDDLAKTFAHATA---------------------------------
METXS_DECAR           MTKALDYFDPSREDDGNLTATMARTQA---------------------------------
METXS_NITEU           MTKALDYFDPAQDYDGNLSAAFARAQA---------------------------------
METXS_CUPNH           ITRALDYFDPALAFGGDLTRAMAQTQA---------------------------------
METXA_HAEIN           LLRALDMYDPSLG-YDNVKEALSRIKA---------------------------------
E1QJW4_DESB2          LTKAMDFFDLSRGRDDLAQAFAGGRAK---------------------------------
METXA_HALSA           LLRAMDAYDLAAGRPSVADALAAFDGD---------------------------------
Q18E47_HALWD          LTRAMDDYDLAEGYEDDARAIAAFEGE---------------------------------
SST_SCHPO             ISKAMDMHDMSASHQRSLSENRKKNQHKLD-----------KYLSADVSAEEIIKLNEDT
I1BUI1_RHIO9          ISKAMDIFDMSRSRLEHLQALRDQNTPKLQ-----------QLLTSDNEDHRQLAEACRS
M3ISF8_CANMX          VSKAMDLFDLGYENRTKAITARLKAESSYS-----------GQ----SLKDLPKLTIP--
W1Q867_OGAPD          ISKAMDLFDMSLSARTKAARSRQQTEARYN-----------GE----YVPDSELEYKPVD
C5DPX0_ZYGRC          ISKTMDLFDLSLSHKERSIRRRARAKELYE-----------SG----TLNEAQDPLLD--
E9DBY2_COCPS          VSKAMDLFDLSRSQQQATRQRRVKNEERIS-----------SSSRPPHNDPSCSLTLP--
SST_EMEND             ISKAMDLFDLGLTQQLATKKQRAEAQAKIS-----------SGTNT-VNDASCSLTLP--
Q6CAU6_YARLI          VSKGMDLFDLGVESTKHTKAIRARTRQ--------------------HENEAAQCPLP--
I2FQ00_USTH4          ISKAMDLFDMSDHSLADLERRRTRAHGP-------------PSPTERGLAVGDSTPPPR-
K5XXI1_AGABU          ISKAMDLFDMSYPALEALQIKPMPEYSRN------------TSSTEQVHKTSHSKSHPP-
Q5KGQ3_CRYNJ          ISKAMDLFDMTGPALTSLAKRFNDAYPDQPPFPYPDDPVSISCCAPRGAAEAHDHNTPEE
SST_XANOR             LSRSMDWFDLAEYVDDKPAADMGIDSPGAD------------ALPAAKSETGVSTAST--
METXA_NOCFA           LTEAMNRHDVGRGRGGVAAAL-AATPV---------------------------------
METXA_MYCLE           LTETLNSHDVGRGRGGIGTAL-RGCPV---------------------------------
METXA_THEFY           LTQAMNTHDVGRGRGGVAQAL-RRVTA---------------------------------
METXA_LEIXX           LVQAMNSHDVGHDGSGLAAAL-SRVTA---------------------------------
METXA_CORDI           LTEALNRHDIGRGRGGLNKAL-SAITV---------------------------------
METXA_CORGL           LTDALNRHDIGRDRGGLNKAL-ESIKV---------------------------------
METXA_CORU7           LTDALNRHDLGRDRGGMNAAL-GNSTV---------------------------------
A9WMJ0_RENSM          LTEALMSHDVGRGRGGLEQALLAAASV---------------------------------
METXA_THET8           LSRAMDTHDVGRGRGGVEEALKRLRAI---------------------------------
METXS_XANCP           LSESIDLHRIDPAAVAV-------------------------------------------
Q8PI58_XANAC          LSESIDLHRIDPAQVRV-------------------------------------------
METXS_BREDA           LSDSIDRHRVEPEAITA-------------------------------------------
METXA_DEIRA           LTWAMDAFQPSSADLKAVRA----------------------------------------
                                                                                  

METXA_NOSP7           ---------------------------------------------------LGSIQQPTL
METXA_PELLD           ---------------------------------------------------VCAMTQPVE
MET2_YEAST            ---------------------------------------------------LSTIQQPSL
U9T077_RHIID          ---------------------------------------------------LNSIQQQTL
R7Z2K7_CONA1          ---------------------------------------------------LAQIEQPCL
C1G658_PARBD          ---------------------------------------------------LSQIQQPAL
E9ED85_METAQ          ---------------------------------------------------LAMIEQPTL
FUB5_GIBF5            ---------------------------------------------------LSLIEQPTL
U5HBT3_USTV1          ---------------------------------------------------LSLAPPGAL
B8MN38_TALSN          -----------------------------------------------TAAVLSRVPSHAL
I2FWN4_USTH4          -----------------------------------ALLNVLSFLSAHPPSPLKPQPPAVL
W7M0B0_GIBM7          ---------------------------------------------------LGQIRQRTL
METXA_SALRD           ---------------------------------------------------LRAIEQPSL
METXA_PSYTT           ---------------------------------------------------LAKIKAETL
METXA_CYCMS           ---------------------------------------------------LSNIKCKVL
A0A2B5FQ06_9BACI      ----------------------------------------------------------VL
R8T2A6_BACCE          ----------------------------------------------------------VL
A9VL94_BACMK          ----------------------------------------------------------VL
Q72YZ7_BACC1          ----------------------------------------------------------VL
G7ZBS2_AZOL4          ----------------------------------------------------------VL
METXA_NAUPA           ----------------------------------------------------------LH
METXA_CARHZ           ----------------------------------------------------------LL
METXA_MOOTA           ----------------------------------------------------------CL
METXA_SYMTH           ----------------------------------------------------------VL
METXA_GEOLS           ----------------------------------------------------------IQ
METXA_CAUVC           ---------------------------------------------------------RFC
METXA_NITHX           ---------------------------------------------------------RFC
METXA_ZYMMO           ---------------------------------------------------------RFC
METXA_PELUB           ---------------------------------------------------------KFL
METXA_GLUOX           ---------------------------------------------------------RFC
METXA_DESPS           ---------------------------------------------------------KYL
METXS_MAGMM           ---------------------------------------------------------HFL
METXS_NOCSJ           ---------------------------------------------------------RFQ
METXS_ACIBS           ---------------------------------------------------------QFL
METXS_PSEF5           ---------------------------------------------------------KFC
METXS_DECAR           ---------------------------------------------------------NFL
METXS_NITEU           ---------------------------------------------------------DFL
METXS_CUPNH           ---------------------------------------------------------SFL
METXA_HAEIN           ---------------------------------------------------------RYT
E1QJW4_DESB2          ----------------------------------------------------------AL
METXA_HALSA           ----------------------------------------------------------AL
Q18E47_HALWD          ----------------------------------------------------------TL
SST_SCHPO             SVLPDVPYQEIA-----------NEDRAPEPDPE----------TNLIAGLAPLKDTPVM
I1BUI1_RHIO9          AVGHSTALEGQK-----------ALVADVNRDPET---------TDLIEGMRDIR-MPAL
M3ISF8_CANMX          ----DIPYEEKS----------TKSVTTLEESLHD-----------LKKGMTRLANKDVL
W1Q867_OGAPD          QCSFDEPMRENK----------RTRRMTPEEAAED-----------LKRGLAKLAAKEVL
C5DPX0_ZYGRC          ------RTSDKK----------RHRTSTVEQSYQD-----------LKQGCKPLLDNDVL
E9DBY2_COCPS          ----AKPYEEQPAELSDLASADESMSSADSASSPSSSFQLFQPPPDLVAGLTPLKDHPIL
SST_EMEND             ----EQPYQEQP---SASTSAEQSASASETGSAPN----------DLVAGLAPLKDHQVL
Q6CAU6_YARLI          ----DKLIEEQP------------RSEVKTPSRQD-----------LVDGVKNVAKHKVL
I2FQ00_USTH4          -----PRKRQHI---------STLSSPAAHAYVPA-----------LARGMARLSHIPTL
K5XXI1_AGABU          -----PLN--------------------PPSHLPD-----------LAAGMAPLKDIPTL
Q5KGQ3_CRYNJ          QEKLEKETKKKL---------ARFIPTSKSPHLAD-----------LAQGLQRLKDIPTL
SST_XANOR             ----------------------------------------------VLAGLARIRIARAL
METXA_NOCFA           ---------------------------------------------------------PCV
METXA_MYCLE           ---------------------------------------------------------PVV
METXA_THEFY           ---------------------------------------------------------RTM
METXA_LEIXX           ---------------------------------------------------------TTL
METXA_CORDI           ---------------------------------------------------------PIM
METXA_CORGL           ---------------------------------------------------------PVL
METXA_CORU7           ---------------------------------------------------------PTM
A9WMJ0_RENSM          ---------------------------------------------------------RFT
METXA_THET8           ---------------------------------------------------------PSL
METXS_XANCP           ---------------------------------------------------------PTV
Q8PI58_XANAC          ---------------------------------------------------------PTV
METXS_BREDA           ---------------------------------------------------------PVT
METXA_DEIRA           ---------------------------------------------------------PVL
                                                                                  

METXA_NOSP7           VVAIDSDILYPP-VEQQELANLIPNAQ--------------LSWLKSTHGHDAFLIDMAA
METXA_PELLD           ILSIDSDVLYPK-SEQQELACLLPNSK--------------ILYLDEPYGHDAFLIDVER
MET2_YEAST            IIGIQSDGLFTY-SEQEFLAEHIPKSQ--------------LEKIESPEGHDAFLLEFKL
U9T077_RHIID          VIGIESDGLFTI-SEQYKLAEFIPNSE--------------MVTIQSPDGHDGFLLEFDQ
R7Z2K7_CONA1          ILGIQSDGLFTF-AEQEELAAAIPNSV--------------LKTIDSPEGHDAFLLEFEQ
C1G658_PARBD          VIGIESDGLFTF-AEQQELADGIPNSR--------------LKSIDSPEGHDAFLLQFEQ
E9ED85_METAQ          VLGIESDGLFTF-AEQEEIAEHVKNAR--------------LERIESPEGHDAFLLQFEQ
FUB5_GIBF5            VLGIRSDGLYTL-AEQEQIARTVPNAK--------------LREIVSDDGHDAFLIEWSQ
U5HBT3_USTV1          VIAISTDGLFTL-SEQRELASALPEAD--------------LIVVDSPDGHDGFLLEFEQ
B8MN38_TALSN          VVGIESDVLFLP-TQQHDLATSLPDAK--------------LVMLKSPDGHDAFLLEFER
I2FWN4_USTH4          VASIESDGLFAP-PEQVLIHRLVEGSK--------------FVSVKSSDGHDGFLLEFEQ
W7M0B0_GIBM7          VVGVPTDGLYPL-SEQIFLSQGLKNAT--------------FATLQSDDGHDAFLIEGEQ
METXA_SALRD           VVGIDSDVLYPL-SEQEELAEHLPSAT--------------LEVLSAPHGHDTFLIELDA
METXA_PSYTT           VIAVQSDLLFPV-EEQRFLAQYIPKGK--------------LEIIDSIYGHDGFLIEVEK
METXA_CYCMS           SIGVDTDILFTS-EESRYISKHVPKGT--------------YREISSIYGHDAFLIEYEQ
A0A2B5FQ06_9BACI      MIPCKQDLLQPS-RYNYEMVELLQKQG----------KYAEVYEIESINGHMAGVFDVHL
R8T2A6_BACCE          MIPCKQDLLQPS-RYNYKMVELLQKQG----------KYAEVYEIESMNGHMAGVFDVHL
A9VL94_BACMK          MIPCKQDLLQPP-RYNYKMVDILQKQG----------KYAEVYEIESINGHMAGALDVHL
Q72YZ7_BACC1          MIPCKQDLLQPS-RYNYKMVDMLQKQG----------KYAEVYEIESINGHMAGAFDIHL
G7ZBS2_AZOL4          LIPSADDLVFPPDRNMRPLKDRLEKQGN---------AVEYTEAITSTLGHLDGVANIAK
METXA_NAUPA           LISFSGDTLFFP-EEMRDIKNYMDKVG----------GKCNYFEINSDYGHDSFLVELEK
METXA_CARHZ           AIGIDTDFLYPT-YQQKEIVEALKEAK----------KEAYYWELSSPHGHDAFLIEFSK
METXA_MOOTA           GIGISSDFLFPP-YQVQEIVRMINDGG----------GHARYAEIDSPYGHDAFLIEFNQ
METXA_SYMTH           AVGIRSDLLFPT-YLQRETVELVRASG----------GRAEYVEMDSPWGHDAFLLDFPL
METXA_GEOLS           FFAFSSDWLYPP-YQTEEMVTCLQGLG----------KEVEYHLIQSAYGHDAFLLEHET
METXA_CAUVC           VLSFSSDWLYPT-AENRHLVRALTAAG----------ARAAFAEIESDKGHDAFLLDEPV
METXA_NITHX           VVSFTSDWLFPT-SESRATVHALNAGG----------ARVSFAEIETDRGHDAFLLDLPE
METXA_ZYMMO           VISFDSDWLYPT-SESRVIVHALNAAG----------AAVSFMELSNPNGHDSFLLDAPD
METXA_PELUB           IISFTSDWLYPT-SENKEIVIALNAIG----------AEVGFVEIESDKGHDSFLLKVPK
METXA_GLUOX           VVSFSSDWLFPT-SQSRLLVRALNRAG----------ANVSFVEIESDRGHDAFLLEEPD
METXA_DESPS           VISYSSDWLYPT-YQARDLVKALKRSG----------RNVSFSEIESDCGHDAFLIPDDR
METXS_MAGMM           VMSFDTDWRFDT-SRSKELVRILHRSL----------KDCTFQEFSSPAGHDAFLLPHPS
METXS_NOCSJ           LTSFDSDWRFDS-TQSARMTAELKALG----------VAVDWAELASPFGHDSFLLQPPG
METXS_ACIBS           IVSFTTDWRFAP-SRSQEIVDALITNH----------KPVSYLDIDAEQGHDSFLFPIPL
METXS_PSEF5           VMSFTTDWRFSP-ARSRELVDALMAAR----------KDVCYLEIDAPQGHDAFLIPIPR
METXS_DECAR           IASFTTDWRFTP-ARSKEIVAALLANG----------RNVSYAEIDLNFGHDSFLMEDAH
METXS_NITEU           VLSFTSDWRFSP-ERSRDIVKALLDNK----------LNVSYAEIPSSYGHDSFLMQDDY
METXS_CUPNH           VASFGTDWRFAP-SRSRELVKALLDNK----------RPVSYAEIDAPHGHDAFLLDDPR
METXA_HAEIN           LVSVTTDQLFKP-IDLYKSKQLLEQSG----------VDLHFYEFPSDYGHDAFLVDYDQ
E1QJW4_DESB2          LVSYRSDWRYPP-AASEQLRQAMAQAG----------LEASHVELQSDFGHGAFIYDAHG
METXA_HALSA           VLSFTGDWHFTA-AQSATVADAFRAGGA---------AGVAHHVVDSDYGHDAFLVDSAA
Q18E47_HALWD          LISFTGDWHFTT-EQSEALAEAFRSVST---------P-VAHHVIESDHGHDAFLVEPDK
SST_SCHPO             VMGVESDNLMPV-ECQRETARCLEKAGNKQ------VVYHELDANESFYGHDTFLIYRKD
I1BUI1_RHIO9          VLGVQSDILFPV-WQQKEIAECLRAGGNKH------VTYYELDA---MFGHDTFLIDRVS
M3ISF8_CANMX          VVGVESDILFPV-WQQREIADVLMENN-----TSGKVEYFELGTDVSNYGHDTFLLSLDD
W1Q867_OGAPD          VIGVESDILFPA-WQQREMADLLRQGARERGGDGSNIRHVELSKEDSFYGHDTFLLALDH
C5DPX0_ZYGRC          VVGVKSDGLMPC-WQQREIYSLLDGDT------NPNVAHVELQESESYFGHDTFLLDLEH
E9DBY2_COCPS          VMGVASDILFPA-WQQREIADSLRAAGSEK------VKHVELGEDVSLFGHDTFLLDLKN
SST_EMEND             VIGVASDILFPA-WQQREIAETLIQAGNKT------VEHIELGNDVSLFGHDTFLLDVKN
Q6CAU6_YARLI          VIGIASDILFPS-WQQKEIAEVLRESVRQQGGNEFGIHHIELGEDVSMYGHDTFLLDVEN
I2FQ00_USTH4          VIGVQSDILFPV-EQQREIAECLRLNGNDN------VRYYELDA---PHGHDSFLIDVAN
K5XXI1_AGABU          VLGVQSDILFTV-EQQREIADALRMAGNEN------VSYYELGG---VWGHDTFLLDVLN
Q5KGQ3_CRYNJ          VLGVQSDVLFPV-EQQRELSDALKLTGNSR------VTYYELGG---VWGHDTFLLDVQN
SST_XANOR             AIGANTDILFPV-QQQEQIADGLRAGDADA-------RFIGLDS---PQGHDAFLVDFAR
METXA_NOCFA           VGGVDSDRLYPLHTQQELADLLPGCARLEV--------------VHSRDGHDGFLTETAA
METXA_MYCLE           VGGITSDRLYPLRLQQELAEMLPGCTGLQV--------------VDSTYGHDGFLVESEA
METXA_THEFY           VAGVSSDFLYPLAQQQELADGIPGADEVRV--------------IESASGHDGFLTEINQ
METXA_LEIXX           VVGIDSDRLFPVDGQELIASHLPAALDGRVP-----------LVVRSHFGHDGFLIEDDL
METXA_CORDI           IAGVDTDILYPYHQQEHLSRNLGNLLAMAK--------------ISSPVGHDAFLTEFRQ
METXA_CORGL           VAGVDTDILYPYHQQEHLSRNLGNLLAMAK--------------IVSPVGHDAFLTESRQ
METXA_CORU7           VCGIDTDILYPYHQQEHLSRNLGTFLGLSQ--------------ITSPTGHDGFLIEARQ
A9WMJ0_RENSM          LASVSSDRLYLPAQTEQLAAAVPGGVSVRS--------------IDSKVGHDAFLLETGQ
METXA_THET8           FVGIDTDLLYPAWEVRQAAKAAGARYR----------------EIKSPHGHDAFLIETDQ
METXS_XANCP           VVAVEGDRLVPLADLVSLVEGLGPRGS--------------LRVLRSPFGHDAFLKEIDR
Q8PI58_XANAC          VVAVEGDRLVPLADMVSLVEGLGPRGS--------------LRVLRSPYGHDAFLKEIDR
METXS_BREDA           LIGFTTDRLCPIEDMRELADRLPNLWR--------------FEQHASVYGHDAFLKEDKL
METXA_DEIRA           VVGISSDLLYPA-AEVRACAAELPHAD--------------YWELGSIHGHDAFLMDPQD
                            *                                          **         

METXA_NOSP7           ---LNEIIQQNHEFVLF-------------------------------------------
METXA_PELLD           ---VSRMVRDFLQAISRKG-----------------------------------------
MET2_YEAST            ---INKLIVQFLKTNCKAITDA------APRAWGGDVGNDE-----TKTSVFGEAEEVTN
U9T077_RHIID          ---INRHLVRFINKFLPEISEKELCNIKDVEGFEGDKQDDDGKIKATKESLFGEAEVVKW
R7Z2K7_CONA1          ---VNAHLLQFMNEVLPDLMAR-------TPTEIGSAGEQDGELGVTKSSTFGEAEVEDI
C1G658_PARBD          ---VNRYILEFFREVLPDIMNA-------SGNDADGVVDRVGQL--TKSSTFGEAEVEDI
E9ED85_METAQ          ---VNNYILGFLKEVLPDIMNK-------EGQAPEEPG--VGKL--TKSSTFGEAEVEDI
FUB5_GIBF5            ---LNWLLVGFLHESLPDIMQR-------AAL----------------------------
U5HBT3_USTV1          ---INTHISRFLKLRLPEIYER----EPVAPVDETEGANGSNGFQVQHTSLFGEAEAGDI
B8MN38_TALSN          ---LNHLIIDRLKSQFPTMYEGFV--ERVANVDMSTLTNGTS---------VGEMD----
I2FWN4_USTH4          ---INEAVGAFLSEVLEEVYAREP--IQVAQPAKEGGEQRGE----VKESVFGEVE--DV
W7M0B0_GIBM7          ---LNGLLRSFFGSDHDLQTSIE-------------------------------------
METXA_SALRD           ---LNDLVSTWRANICSSVAA---------------------------------------
METXA_PSYTT           ---IKSLVHKHFKL----------------------------------------------
METXA_CYCMS           ---LQYILKSFYLENNG-------------------------------------------
A0A2B5FQ06_9BACI      ---FEKKVDEFLKRRVFV------------------------------------------
R8T2A6_BACCE          ---FEKKVDEFLKRQV--------------------------------------------
A9VL94_BACMK          ---FEKKVYEFLNRKVSSFV----------------------------------------
Q72YZ7_BACC1          ---FEKKVYEFLNRKVSSFV----------------------------------------
G7ZBS2_AZOL4          ---AGETITQFLAK----------------------------------------------
METXA_NAUPA           ---FDFIISDILKGEV--------------------------------------------
METXA_CARHZ           ---MAPILSNFLEYVAGRRATINF------------------------------------
METXA_MOOTA           ---LAAIIQPFLKELRPDLAA---------------------------------------
METXA_SYMTH           ---IEEPIRRFLQELEAEENA---------------------------------------
METXA_GEOLS           ---FTPMVRSLLERVAP-------------------------------------------
METXA_CAUVC           ---MDAALEGFLASAERDRGLV--------------------------------------
METXA_NITHX           ---FFDIAHAFLVSAGKTRGLAAAGE----------------------------------
METXA_ZYMMO           ---LHRTVHGFLEGDRA-------------------------------------------
METXA_PELUB           ---FLNTLGDYIKTAYSKN-----------------------------------------
METXA_GLUOX           ---FDRTIRGFIAGAAEHAALKAGER----------------------------------
METXA_DESPS           ---LEQLMRGFLAGIYTGIAEI--------------------------------------
METXS_MAGMM           ---YEKSLGSFLLRTWQSITGGQA------------------------------------
METXS_NOCSJ           ---YHERIAEFLG-----------------------------------------------
METXS_ACIBS           ---YVKTLRAFLGGEEHLKSTSLEAS----------------------------------
METXS_PSEF5           ---YLQAFSHYM------NRITL-------------------------------------
METXS_DECAR           ---YHGVVDAYL------RNIKL-------------------------------------
METXS_NITEU           ---YHQLIRAYM------NNIAL-------------------------------------
METXS_CUPNH           ---YHNLMRAYY------DRIAEEIGA---------------------------------
METXA_HAEIN           ---FEKRIRDGLAGN---------------------------------------------
E1QJW4_DESB2          ---VGRVMADFLAELARRGPQT--------------------------------------
METXA_HALSA           ---VGPPLADFLAAGTDGAAVTDATGGV--------------------------------
Q18E47_HALWD          ---VGPPLRDFLADGINGRAVHDTADSNADNDSGFAPVHASLFSQ---------------
SST_SCHPO             LDLVGGKLKKFLELS---------------------------------------------
I1BUI1_RHIO9          ---VGGAIKGHLELLDKDFIK---------------------------------------
M3ISF8_CANMX          ---IGKPLNHNSSSCHPVYPNGVATNYHEHSNLQITQMEQTKPTTRKRNRSQQNLGYVVV
W1Q867_OGAPD          ---IGGPVSDFLEN----------------------------------------------
C5DPX0_ZYGRC          ---IGRSIGQFLCK----------------------------------------------
E9DBY2_COCPS          ---IGGPIQQFLQ-----------------------------------------------
SST_EMEND             ---VGGAVRKFLD-----------------------------------------------
Q6CAU6_YARLI          ---VGGPIKRFLEH----------------------------------------------
I2FQ00_USTH4          ---VGGAIRGFLE-----------------------------------------------
K5XXI1_AGABU          ---VGSAIRGFLSIAP--------------------------------------------
Q5KGQ3_CRYNJ          ---VGGAIRGFLH-----------------------------------------------
SST_XANOR             ---FGPAVRDFLQGC---------------------------------------------
METXA_NOCFA           ---IGKLLVETMRLARAHR-----------------------------------------
METXA_MYCLE           ---VGKLIRQTLELADVGSKEDACSQ----------------------------------
METXA_THEFY           ---VSVLIKELLAQ----------------------------------------------
METXA_LEIXX           ---IGGQLRRLFAA----------------------------------------------
METXA_CORDI           ---MERILRHFMELSEGIDDSFRTKLER--------------------------------
METXA_CORGL           ---MDRIVRNFFSLISPDEDNPSTYIEFYI------------------------------
METXA_CORU7           ---MGNVLEKFLVTAEKLAKDPEQRANILQQHHH--------------------------
A9WMJ0_RENSM          ---IAALIAPALA-----------------------------------------------
METXA_THET8           ---VEEILDAFLP-----------------------------------------------
METXS_XANCP           ---IDAILTTALRTTGETA-----------------------------------------
Q8PI58_XANAC          ---IDAILTTALRSTGETP-----------------------------------------
METXS_BREDA           ---VADILTSVLKDIDQ-------------------------------------------
METXA_DEIRA           ---LPERVGAFLRS----------------------------------------------
                                                                                  

METXA_NOSP7           ----------------
METXA_PELLD           ----------------
MET2_YEAST            W---------------
U9T077_RHIID          ----------------
R7Z2K7_CONA1          TAW-------------
C1G658_PARBD          TAW-------------
E9ED85_METAQ          TAW-------------
FUB5_GIBF5            ----------------
U5HBT3_USTV1          TRW-------------
B8MN38_TALSN          ----------------
I2FWN4_USTH4          TRW-------------
W7M0B0_GIBM7          ----------------
METXA_SALRD           ----------------
METXA_PSYTT           ----------------
METXA_CYCMS           ----------------
A0A2B5FQ06_9BACI      ----------------
R8T2A6_BACCE          ----------------
A9VL94_BACMK          ----------------
Q72YZ7_BACC1          ----------------
G7ZBS2_AZOL4          ----------------
METXA_NAUPA           ----------------
METXA_CARHZ           ----------------
METXA_MOOTA           ----------------
METXA_SYMTH           ----------------
METXA_GEOLS           ----------------
METXA_CAUVC           ----------------
METXA_NITHX           ----------------
METXA_ZYMMO           ----------------
METXA_PELUB           ----------------
METXA_GLUOX           ----------------
METXA_DESPS           ----------------
METXS_MAGMM           ----------------
METXS_NOCSJ           ----------------
METXS_ACIBS           ----------------
METXS_PSEF5           ----------------
METXS_DECAR           ----------------
METXS_NITEU           ----------------
METXS_CUPNH           ----------------
METXA_HAEIN           ----------------
E1QJW4_DESB2          ----------------
METXA_HALSA           ----------------
Q18E47_HALWD          ----------------
SST_SCHPO             ----------------
I1BUI1_RHIO9          ----------------
M3ISF8_CANMX          HNSVSIFLLVEECMDY
W1Q867_OGAPD          ----------------
C5DPX0_ZYGRC          ----------------
E9DBY2_COCPS          ----------------
SST_EMEND             ----------------
Q6CAU6_YARLI          ----------------
I2FQ00_USTH4          ----------------
K5XXI1_AGABU          ----------------
Q5KGQ3_CRYNJ          ----------------
SST_XANOR             ----------------
METXA_NOCFA           ----------------
METXA_MYCLE           ----------------
METXA_THEFY           ----------------
METXA_LEIXX           ----------------
METXA_CORDI           ----------------
METXA_CORGL           ----------------
METXA_CORU7           ----------------
A9WMJ0_RENSM          ----------------
METXA_THET8           ----------------
METXS_XANCP           ----------------
Q8PI58_XANAC          ----------------
METXS_BREDA           ----------------
METXA_DEIRA           ----------------