CLUSTAL format seed alignment for MF_00297

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NUDC_ECOLI      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_SHISS      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_ECOHS      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_ECO24      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_SHIBS      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_SHIFL      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_SHIF8      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_ECO57      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_SHIDS      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_ECOUT      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_ECOK1      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_ECOL6      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_ECOL5      ------------------------------MDRIIEKLDHGWWVVSHEQKLWLPK---GE
NUDC_CITK8      ------------------------------MDRIIEKLDHGWWIVSHEQKLWLPR---GE
NUDC_SALPA      ------------------------------MDRIIEKLESGWWIVSHEQKLWLPY---GE
NUDC_SALTY      ------------------------------MDRIIEKLESGWWIVSHEQKLWLPY---GE
NUDC_SALTI      ------------------------------MDRIIEKLESGWWIVSHEQKLWLPY---GE
NUDC_SALCH      ------------------------------MDRIIEKLESGWWIVSHEQKLWLPY---GE
NUDC_ENT38      ------------------------------MDRIIEKLDRGWWIVSHEQKLWLPA---GE
NUDC_KLEP7      ------------------------------MDRIIEKLDRGWWVVSHEQKLWLPG---GE
NUDC_CROS8      ------------------------------MERTLENLDHGWWIVSHEQKLWLPK---AE
NUDC_YERPE      ------------------------------MELQLTGKESGWWIVSHENKLWLPK---GE
NUDC_YERPA      ------------------------------MELQLTGKESGWWIVSHENKLWLPK---GE
NUDC_YERPN      ------------------------------MELQLTGKESGWWIVSHENKLWLPK---GE
NUDC_YERPP      ------------------------------MELQLTGKESGWWIVSHENKLWLPK---GE
NUDC_YERPS      ------------------------------MELQLTGKESGWWIVSHENKLWLPK---GE
NUDC_YERP3      ------------------------------MELQLTGKESGWWIVSHENKLWLPK---GE
NUDC_YERE8      ------------------------------MELQLTGKESGWWIVSHENKLWLPK---GE
NUDC_PHOLL      ----------------------------MMMQQQITGTEHGWWIISNENRIWLPK---GE
NUDC_PECAS      ------------------------------MEQTLKGDETGWWVVSDAVQIWMPQ---GE
NUDC_HAEIN      -------------------------------MKILQQDDFGYWLLTQGSNLYLVN---NE
NUDC_HAEI8      -------------------------------MKILQQDDFGYWLLTQGSNLYLVN---NE
NUDC_MANSM      -------------------------------MQLIRSSDYGFWLLSQGSHIHLVN---NY
NUDC_PASMU      -------------------------------MNAIQPDDAGYWLLTQDSALYLIN---GE
NUDC_VIBCH      ---------------------MIRLQAIRRSRVEKSDGKNAYWCVVSGSDLWLVD---GQ
NUDC_VIBVU      ----------------------------MLSNSDSKHGQKAYWCVVSGSDLWLVD---GQ
NUDC_VIBPA      ----------------------------MLRKGDVNRVANAYWCVVAGSEIWLVD---GA
NUDC_DEIRA      -----------------MNRFPTERPADFVDDLKVPAAPDALFFIVREGKLLLSDA--GE
NUDC_PSEAE      -----------------------MAGEFRWQAGRPATAQVGGWVLAHCQQRFLQDDNGLL
NUDC_PSEAB      -----------------------MAGESRWQAGRPTTAQVGGWVLAHCQQRFLQDDNGLL
NUDC_PSEA7      -----------------------MAGEFRWQAGRPDTAQAGGWALAHCQQRFLQDDNGLL
NUDC_PSEU5      -------------------------MSLRWQAALLDPSLAGGWAVVHCRQQFLVDDSGVL
NUDC_PSEE4      -------------------------MSARWTTAVLDPQTTGGWAVARSPEGFLVDANGAL
NUDC_PSEF5      -------------------------MIERWTTAVLDTDLPGGWAVARGPDGFLYDDNGAL
NUDC_PSE14      -----------------------MAHPERWTTAVLDVEADGGLAVVQSDQGFLLDTNGAM
NUDC_PSEU2      -----------------------MSRPERWTTAVLDVEAPGGLAVVQGDQGFLLDANGVM
NUDC_PSESM      -----------------------MTRPQRWTTAVLDVEADGGLAVVQGDQGFLLDSNGAL
NUDC_MYCBO      MTNVSGVDFQLRSVPLLSRVGADRADRLRTDMEAAAAGWPGAALLRVDSRNRVLVANGRV
NUDC_MYCBP      MTNVSGVDFQLRSVPLLSRVGADRADRLRTDMEAAAAGWPGAALLRVDSRNRVLVANGRV
NUDC_MYCTU      MTNVSGVDFQLRSVPLLSRVGADRADRLRTDMEAAAAGWPGAALLRVDSRNRVLVANGRV
NUDC_MYCTA      MTNVSGVDFQLRSVPLLSRVGADRADRLRTDMEAAAAGWPGAALLRVDSRNRVLVANGRV
                                                        .   :       :       

NUDC_ECOLI      LPYGEAANFDLVGQRALQIGEWQGEP---VWLVQQQRRHD--------MGSVRQVID-LD
NUDC_SHISS      LPYGEAANFDLVGQRALQIGEWQGEP---VWLVQQQRRHD--------MGSVRQVID-LD
NUDC_ECOHS      LPYGEAANFDLVGQRALQIGEWQGEP---VWLVQQQRRHD--------MGSVRQVID-LD
NUDC_ECO24      LPYGEAANFDLVGQRALQIGEWQGEP---VWLVQQQRRHD--------MGSVRQVID-LD
NUDC_SHIBS      LPYGEAANFDLVGQRALQIGEWQGEP---VWLVQQQRRHD--------MGSVRQVID-LD
NUDC_SHIFL      LPYGEAANFDLVGQRALQIGEWQGEP---VWLIQQQRRHD--------MGSVRQVID-LD
NUDC_SHIF8      LPYGEAANFDLVGQRALQIGEWQGEP---VWLIQQQRRHD--------MGSVRQVID-LD
NUDC_ECO57      LPYGEAANFDLVGQRALQIGEWQGEP---VWLIQQQRRYD--------MGSVRQVID-LD
NUDC_SHIDS      LPYGEAANFDLVGQRALQIGEWQGEP---VWLIQQQRRHD--------MGSVRQVID-LD
NUDC_ECOUT      LPYGEAANFDLVGQRALQIGEWQGEP---VWLVQLQRRHD--------MGSVRQVID-LD
NUDC_ECOK1      LPYGEAANFDLVGQRALQIGEWQGEP---VWLVQLQRRHD--------MGSVRQVID-LD
NUDC_ECOL6      LPYGEAANFDLVGQRALQIGEWQGEP---VWLVQLQRRHD--------MGSVRQVID-LD
NUDC_ECOL5      LPYGEAANFDLVGQRALQIGEWQGEP---VWLVQLQRRHD--------MGSVRQVID-LD
NUDC_CITK8      LPYGEATNFDLVGQRALLIGEWEGEP---VWLVLQHRRHD--------MGSVRQVID-QD
NUDC_SALPA      LPHGLAANFDLVGQRALRIGEWQGEP---VWLVLQHRRHD--------MGSVRQVID-QD
NUDC_SALTY      LPHGLAANFDLVGQRALRIGEWQGEP---VWLVLQHRRHD--------MGSVRQVID-QE
NUDC_SALTI      LPHGLAANFDLVGQRALRIGEWQGEP---VWLVLQHRRHD--------MGSVRQVID-QD
NUDC_SALCH      LPHGLAANFDLVGQRALRIGEWQGEP---VWLVLQHRRHD--------MGSVRQVID-QD
NUDC_ENT38      LPHGDAEQFDLVGQPALKIGEWQGDA---VWLIQQNRRQD--------MGSVRQVMD-LD
NUDC_KLEP7      LPHGEAVNFDLVGQHALHIGEWQGES---VWMVRQDRRHD--------MGSLRQVLD-QD
NUDC_CROS8      LPYGRAADFGLTGEKALQIGLWEDAP---VWLVLQKREKD--------MASVRQLID-QD
NUDC_YERPE      LPQGNAANWSLQGTTARQIGEWQGQS---VWLIRQMMPSG--------MGSVRQLLD-VD
NUDC_YERPA      LPQGNAANWSLQGTTARQIGEWQGQS---VWLIRQMMPSG--------MGSVRQLLD-VD
NUDC_YERPN      LPQGNAANWSLQGTTARQIGEWQGQS---VWLIRQMMPSG--------MGSVRQLLD-VD
NUDC_YERPP      LPQGNAANWSLQGTTARQIGEWQGQS---VWLIRQMMPSG--------MGSVRQLLD-VD
NUDC_YERPS      LPQGNAANWSLQGATARQIGEWQGQP---VWLIRQMMPSG--------MGSVRQLLD-VD
NUDC_YERP3      LPQGNAANWSLQGATARQIGEWQGQP---VWLIRQMMPSG--------MGSVRQLLD-VD
NUDC_YERE8      LPQGNAANWSLQGATARQIGEWQGQA---VWLIRQMMSTD--------MGSVRQLLD-VD
NUDC_PHOLL      LPFGMATQWSLQGKIALPIGEWQGEK---VWLIRQKMVSN--------MVSLRQIVA-SD
NUDC_PECAS      LPRGTATEWSLQGKTARQIGEWQGQP---AWLVCQGRDTD--------MASVRQLLD-QD
NUDC_HAEIN      LPFGIAKDIDLEGLQAMQIGEWKNYP---LWLVAEQESDER------EYVSLSNLLS-LP
NUDC_HAEI8      LPFGIAKDIDLEGLQAMQIGEWKNHP---LWLVAEQESDER------EYVSLRNLLS-LP
NUDC_MANSM      LPEGRAEDFHLQGKKGMVIGELDRQP---LWLVEEQPNDTR------AYFDLRDQLY-LP
NUDC_PASMU      LPQGKAADFQLQGYNGMIIGELNGRP---LWLVEEIADDQR------TYFSLRSLLA-LP
NUDC_VIBCH      IPYGSAEQWDLPQEKAILVDRYQNSPV--YWLNAADIEQDR------PLTSLRELLG-VD
NUDC_VIBVU      LPLATSNELNLVAEKAQKIGSYNNHPV--MWLNEADVEQSL------EMHSLRECLH-FP
NUDC_VIBPA      VPFGSAEQFSLPEENARQIGDYLGSPV--MWINFADLEQDL------PLVSLRDCLH-FP
NUDC_DEIRA      LPSG----HSLAGQAVIALGRLGERPVF-ALPLTGEAPAGA------QLVGLRQCFGVLP
NUDC_PSEAE      FPREWLKRQELPLLAEHGVGHWQGEPVYVLELDEPIELPGM------AWAPLRQFMLHGD
NUDC_PSEAB      FPREWLKRQELPLLAEHGVGHWQGEPVYVLELDEPIELPGM------AWAPLRQFMLHGD
NUDC_PSEA7      FPREWLKRQDLPLLAEHGVGHWQGEPVYLLELDEPLELPGM------AWTPLRQFMLHGD
NUDC_PSEU5      FPRDWLKRLELPLLSEQGLGHFDGEPVFLFELDVPADVPGA------RWQGLRQFMQQVD
NUDC_PSEE4      FPRDWLKRQELDVLCEHGIGHFDGQPVFLLELRTASEVQGC------NWQGLRRFMLEGD
NUDC_PSEF5      FPRHWLKGQDLPLLAEHGIGHLDGEPVYLLELSARAEVPGC------GWKGLRAFMLEGD
NUDC_PSE14      FPRGWLAGLDLPVQSEHGIGYFEGEPVYLLVLERSVAVEGC------SWQGLRQFMLEGD
NUDC_PSEU2      FPRGWLAGQDLPVQSEHGIGYFEGEPVYLLVLERSVAVEGC------AWQGLRQFMLEGD
NUDC_PSESM      FPRSWLRALDLPVQSEHGIGYFDGEPVYLLVLQHSVVVEGC------AWQGLRQFMLEGD
NUDC_MYCBO      LLGAAIELADKPPPEAVFLGRVEGGR--HVWAVRAALQPIADPDIPAEAVDLRGLGRIMD
NUDC_MYCBP      LLGAAIELADKPPPEAVFLGRVEGGR--HVWAVRAALQPIADPDIPAEAVDLRGLGRIMD
NUDC_MYCTU      LLGAAIELADKPPPEAVFLGRVEGGR--HVWAVRAALQPIADPDIPAEAVDLRGLGRIMD
NUDC_MYCTA      LLGAAIELADKPPPEAVFLGRVEGGR--HVWAVRAALQPIADPDIPAEAVDLRGLGRIMD
                .                 :.                               :        

NUDC_ECOLI      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_SHISS      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_ECOHS      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_ECO24      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_SHIBS      VVLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_SHIFL      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_SHIF8      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_ECO57      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_SHIDS      VGLFLLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_ECOUT      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_ECOK1      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_ECOL6      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_ECOL5      VGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_CITK8      VGLFQLAGRGVQLAEFYRSHKFCGYCGHPMYPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_SALPA      AGLFQLAGRGVQLAEFYRSHKFCGYCGHPMHPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_SALTY      AGLFQLAGRGVQLAEFYRSHKFCGYCGHPMHPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_SALTI      AGLFQLAGRGVQLAEFYRSHKFCGYCGHPMHPSKTEWAMLCSH--CRDRYYPQIAPCIIV
NUDC_SALCH      AGLFQLAGRGVQLAEFYRSHKFCGYCGHPMHPSKTEWAMLCSH--CRERYYPQIAPCIIV
NUDC_ENT38      AGLFQLAGRGVQLAEFYRSHKFCGYCGHAMHPSKTEWALLCSH--CRERYYPQIAPCIIV
NUDC_KLEP7      PGLFQLAGRGIQLAEFYRSHKFCGYCGHPMHASKSEWAMLCSH--CRERYYPQIAPCIIV
NUDC_CROS8      AGLFQLAGRGVQLAEFYRSHKYCGYCGHEMHPSKTEWAMLCGH--CRERYYPQIAPCIIV
NUDC_YERPE      RGLFQLAGRGVQLAEFYRSHRFCGYCGHEMHASRTEWASLCNH--CRERYYPQIAPCVIV
NUDC_YERPA      RGLFQLAGRGVQLAEFYRSHRFCGYCGHEMHASRTEWASLCNH--CRERYYPQIAPCVIV
NUDC_YERPN      RGLFQLAGRGVQLAEFYRSHRFCGYCGHEMHASRTEWASLCNH--CRERYYPQIAPCVIV
NUDC_YERPP      RGLFQLAGRGVQLAEFYRSHRFCGYCGHEMHASRTEWASLCNH--CRERYYPQIAPCVIV
NUDC_YERPS      RGLFQLAGRGVQLAEFYRSHRFCGYCGHEMHASRTEWASLCNH--CRERYYPQIAPCVIV
NUDC_YERP3      RGLFQLAGRGVQLAEFYRSHRFCGYCGHEMHASRTEWASLCNH--CRERYYPQIAPCVIV
NUDC_YERE8      RGLFQLAGRGVQLAEFYRSHRYCGYCGHQMHASRTEWACLCNH--CRERYYPQIAPCVIV
NUDC_PHOLL      RGLFQLAGRGVQLAEFYRSHQYCGYCGNEMHHSVSEWACLCHH--CHERYYPQIAPCIIV
NUDC_PECAS      VGLFQLAGRGVQLAEFYRSHRFCGYCGHEMVRSKTELACLCHH--CKERYYPQIAPCIIV
NUDC_HAEIN      EDEFHILSRGVEINHFLKTHKFCGKCGHKTQQTQDELAVQCIH--CGYQTYPVICPSIIV
NUDC_HAEI8      EDEFHILSRGVEINHFLKTHKFCGKCGHKTQQTQDELAVQCIH--CGYQTYPVICPSIIV
NUDC_MANSM      ERTFNLLNRGVELNHFFKTHQFCGKCGDKTMQTEDEWAVQCTNEECNYRTYPVICPSIIV
NUDC_PASMU      EAHFNLLNRGVELNHFFKTHRFCGKCGHPTDLVQQEWAIQCQNPSCSHRTYPVICPCIIV
NUDC_VIBCH      EALFLAASKAVQYGHMSQTIRFCPQCGGRNYLNHQQLAMQCHD--CRTLHYPRIFPCIIV
NUDC_VIBVU      EPLFLLMSKAIQYGHMTQTMRFCPQCGGRNHLNHNQLAMQCGE--CRTLHYPRIFPCIIV
NUDC_VIBPA      EPLFMLLSKAIQYGHMTQSLRFCPQCGGRNFLNNNQFAMQCGE--CRTLHYPRIFPCIIV
NUDC_DEIRA      DGLFGLAGLAVQLVDFQRSHQFCGACGTPMRPGEGDRARRCPS--CGLRVYPRVAPAIIV
NUDC_PSEAE      FDQFCMLGYASQIGIWARHNRFCGNCGTRMQAQDHERVMQCPQ--CGLHQYPRLSPSMIV
NUDC_PSEAB      FDQFCMLGYASQIGIWARHNRFCGNCGTRMQAQDHERVMQCPQ--CGLHQYPRLSPSMIV
NUDC_PSEA7      FDQFCMLGYASQIGIWARHNRFCGNCGTRMQALGHERVMQCPQ--CNLHQYPRLSPSMIV
NUDC_PSEU5      PDLFRLLGYATQIGTWVSQHRFCGSCGSPMHARAGERAMYCPA--CGVQHYPRLSPSMIV
NUDC_PSEE4      FDTYKVLGYAAQIGTWAREHRFCGSCGQPMTQIHWERAMYCQP--CDLRSYPRISPSMIV
NUDC_PSEF5      HTLYKVLGYAAQIGTWAREHRYCGSCGRPMAQVPGERAMYCQP--CDLRSYPRISPSMIV
NUDC_PSE14      FAVFQMLGYAAQVSTWAREHRFCGACGRATVQIRGERAMFCEH--DNLRLYPRISPSMIV
NUDC_PSEU2      FAVFQMLGYAAQVSTWAREHRFCGACGRATVQIRGERAMFCEH--DNLRLYPRISPSMIV
NUDC_PSESM      FAVFQMLGYAAQVATWAREHRFCGACGRATVQIAGERAMYCEH--DNLRLYPRISPSMIV
NUDC_MYCBO      DTSSQLVSSASALLNWHDNARFSALDGAPTKPARAGWSRVNPI--TGHEEFPRIDPAVIC
NUDC_MYCBP      DTSSQLVSSASALLNWHDNARFSALDGAPTKPARAGWSRVNPI--TGHEEFPRIDPAVIC
NUDC_MYCTU      DTSSQLVSSASALLNWHDNARFSALDGAPTKPARAGWSRVNPI--TGHEEFPRIDPAVIC
NUDC_MYCTA      DTSSQLVSSASALLNWHDNARFSALDGAPTKPARAGWSRVNPI--TGHEEFPRIDPAVIC
                       . .          ::.   *                       :* : *.:* 

NUDC_ECOLI      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_SHISS      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_ECOHS      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_ECO24      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_SHIBS      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_SHIFL      AIRRDD----SLLLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_SHIF8      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_ECO57      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_SHIDS      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_ECOUT      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_ECOK1      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_ECOL6      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_ECOL5      AIRRDD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_CITK8      AIRRAD----SILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_SALPA      AIRRED----SILLAQHVRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_SALTY      AIRRED----SILLAQHVRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_SALTI      AIRRED----SILLARHVRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_SALCH      AIRRED----SILLAQHVRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVK
NUDC_ENT38      AIRRDD----SILLAQHVRH-----RNGIHTVLAGFVEVGETLEQTVAREVMEESGIKVK
NUDC_KLEP7      AIRRDD----AILLAQHTRH-----RNGVHTVLAGFVEVGETLEQAVAREVMEESGIRVK
NUDC_CROS8      AIRRDD----KILLAQHTRH-----RNGVYTVLAGFVEVGETLEQAVAREVMEESNIRIK
NUDC_YERPE      AIRRGD----EILLAQHVRH-----RGGINTVLAGFVEVGETLEQAVSREVLEESNIHIK
NUDC_YERPA      AIRRGD----EILLAQHVRH-----RGGINTVLAGFVEVGETLEQAVSREVLEESNIHIK
NUDC_YERPN      AIRRGD----EILLAQHVRH-----RGGINTVLAGFVEVGETLEQAVSREVLEESNIHIK
NUDC_YERPP      AIRRGD----EILLAQHVRH-----RGGINTVLAGFVEVGETLEQAVSREVLEESNIHIK
NUDC_YERPS      AIRRGD----EILLAQHVRH-----RGGINTVLAGFVEVGETLEQAVSREVLEESNIHIK
NUDC_YERP3      AIRRGD----EILLAQHVRH-----RGGINTVLAGFVEVGETLEQAVSREVLEESNIHIK
NUDC_YERE8      AIRRGD----EILLAQHVRH-----RGGINTVLAGFVEVGETLEQAVSREVLEESNIHIK
NUDC_PHOLL      GIRRDD----HILLAQHQHH-----RGGVYTVLAGFVEVGETLEEAVVREVMEESNIKIR
NUDC_PECAS      AIRRGE----EILLAQHNRH-----RGNMYTVLAGFVEVGETLEQTVVREVMEESQIQIK
NUDC_HAEIN      AVRRGH----EILLANHKRHYSP--NGGIYTTLAGFVEVGETFEQAVQREVFEETGISIK
NUDC_HAEI8      AVRRGH----EILLANHKRHYSP--NGGIYTTLAGFVEVGETFEQAVQREVFEETGISIK
NUDC_MANSM      AIRRGK----EILLANHRRHAPKYGKGGMYTTLAGFVEVGESFEQTIHREVFEETGIKVK
NUDC_PASMU      AVRRGA----QILLANHQRH-----KGGIYTTLAGFVEVGETFEQAVHREVLEETGIQIQ
NUDC_VIBCH      AVRKQQ----QILLAQHPRH-----RNGMYTVIAGFVEVGETLEQCVAREVLEETGIVVT
NUDC_VIBVU      AVRKQQ----HILLAQHPRH-----RSGMYTVIAGFVEVGETLEQCVAREVKEETGIEVT
NUDC_VIBPA      AVRKEN----QILLAQHPRH-----RNGMYTVIAGFLEAGETLEDCVAREVHEETGIHVK
NUDC_DEIRA      LISRGTGPDTEFLLLRGPRQ-----APDVFTTLAGFVEPSETLEAAVHREVGEEVGVKVR
NUDC_PSEAE      LVTRGD----EVLLARSPRF-----VPGVYSTLAGFVEAGESVEQCVVREVREEVGVEVA
NUDC_PSEAB      LVTRGD----EVLLARSPRF-----VPGVYSTLAGFVEAGESVEQCVVREVREEVGVEVA
NUDC_PSEA7      LVTRGD----EVLLARSPRF-----VPGVYSTLAGFVEAGESVEQCVVREVREEVGVEVA
NUDC_PSEU5      LVTRGD----ELLLARSPRF-----APGVYSTLAGYVEPGESVEQCVAREVREEVGVDIH
NUDC_PSEE4      LITRGD----EVLLARSPRF-----VTGVYSTLAGFAEPGESAEECLVREVREEVAIEVR
NUDC_PSEF5      LITRGD----EILLARSPRF-----VTGVYSTLAGFAEPGESAEDCLIREVREEVSIEVR
NUDC_PSE14      LVTRGD----EILLARSPRF-----VTGMYSALAGFVEPGESAEDCVHREVMEEVQVRIK
NUDC_PSEU2      LVTRGD----EILLARSPRF-----VTGMYSALAGFVEPGESAEDCVHREVMEEVQVRIK
NUDC_PSESM      LVTRGD----EVLLARSPRF-----VSGMYSALAGFVEPGESAEDCVHREVMEEVQVRIK
NUDC_MYCBO      LVHDGA---DRAVLARQAAW-----PERMFSLLAGFVEAGESFEVCVAREIREEIGLTVR
NUDC_MYCBP      LVHDGA---DRAVLARQAAW-----PERMFSLLAGFVEAGESFEVCVAREIREEIGLTVR
NUDC_MYCTU      LVHDGA---DRAVLARQAAW-----PERMFSLLAGFVEAGESFEVCVAREIREEIGLTVR
NUDC_MYCTA      LVHDGA---DRAVLARQAAW-----PERMFSLLAGFVEAGESFEVCVAREIREEIGLTVR
                 :          :* .            : : :**: * .*: *  : **: **  : : 

NUDC_ECOLI      NLRYVTSQPWPFPQSLMTAFMAEYDSGD-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_SHISS      NLRYVTSQPWPFPQSLMTAFMAEYDSGD-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_ECOHS      NLRYVTSQPWPFPQSLMTAFMAEYDSGD-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_ECO24      NLRYVTSQPWPFPQSLMTAFMAEYDSGD-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_SHIBS      NLRYVTSQPWPFPQSLMTAFMAEYDSGD-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_SHIFL      NLRYVTSQPWPFPQSLMTAFMAEYDSGD-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_SHIF8      NLRYVTSQPWPFPQSLMTAFMAEYDSGD-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_ECO57      HLRYVTSQPWPFPQSLMTAFMAEYDSGD-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_SHIDS      NLRYVTSQPWPFPQSLMTAFMADYDSGD-IVIDPKELLEANWYRYDN-LPLLPV----PG
NUDC_ECOUT      NLRYVTSQPWPFPQSLMTAFMAEYDSGE-IVIDPKELLEAHWYRYDD-LPLLPP----PG
NUDC_ECOK1      NLRYVTSQPWPFPQSLMTAFMAEYDSGE-IVIDPKELLEAHWYRYDD-LPLLPP----PG
NUDC_ECOL6      NLRYVTSQPWPFPQSLMTAFMAEYDSGE-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_ECOL5      NLRYVTSQPWPFPQSLMTAFMAEYDSGE-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_CITK8      NLRYVTSQPWPFPQSLMTAFMAEYDSGE-IVIDPKELLEAGWYRYDD-LPLLPP----PG
NUDC_SALPA      NLRYVTSQPWPFPQSLMTAFMAEYDSGE-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_SALTY      NLRYVTSQPWPFPQSLMTAFMAEYDSGE-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_SALTI      NLRYVTSQPWPFPQSLMTAFMAEYDSGE-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_SALCH      NLRYVTSQPWPFPQSLMTAFMAEYDSGE-IAIDPKELLEANWYHYDD-LPLLPP----PG
NUDC_ENT38      NLRYVTSQPWPFPMSLMTAFMADYDSGD-IVIDPKELLEANWYRYDD-LPLLPP----PG
NUDC_KLEP7      NLRYVTSQPWPFPQSLMTAFMADYADGE-IVVDKKELLTADWYRYDD-LPLLPP----PG
NUDC_CROS8      NLRYVTSQPWPFPQSLMTAFTADYDSGE-IQIDTKELIDAGWYRYDQ-LPLLPA----PG
NUDC_YERPE      NLRYVTSQPWPFPHSLMMAFMADYDSGE-LCHDPKELLNAGWYRYDQ-LPLLPP----PG
NUDC_YERPA      NLRYVTSQPWPFPHSLMMAFMADYDSGE-LCHDPKELLNAGWYRYDQ-LPLLPP----PG
NUDC_YERPN      NLRYVTSQPWPFPHSLMMAFMADYDSGE-LCHDPKELLNAGWYRYDQ-LPLLPP----PG
NUDC_YERPP      NLRYVTSQPWPFPHSLMMAFMADYDSGE-LCHDPKELLNAGWYRYDQ-LPLLPP----PG
NUDC_YERPS      NLRYVTSQPWPFPHSLMMAFMADYDSGE-LCHDPKELLNAGWYRYDQ-LPLLPP----PG
NUDC_YERP3      NLRYVTSQPWPFPHSLMMAFMADYDSGE-LCHDPKELLNAGWYRYDQ-LPLLPP----PG
NUDC_YERE8      NLRYVTSQPWPFPHSLMMAFMAEYDSGE-LRHDPKELLNAGWYRYDQ-LPLLPP----PG
NUDC_PHOLL      NLRYVASQPWPFPHSLMMAFLADYDSGE-IRHDPQELISADWYHYDQ-LPLIPP----HN
NUDC_PECAS      NLRYVSSQPWPFPHSLMMAFMADYAGGD-IKHDPKELRDAGWFRYDQ-LPQLPP----PG
NUDC_HAEIN      NLRYFGSQPWAFPNSQMVGFLADYESGE-ITLQESEIHDAQWFSYDQPLPELPP----TG
NUDC_HAEI8      NLRYFGSQPWAFPNSQMVGFLADYESGE-ITLQESEIHDAQWFSYDQPLPELPP----TG
NUDC_MANSM      NIRYFGSQPWAFPNSQMVGFLADYESGE-IRLQEEEIADAKWFRYDEPYPEFPE----KG
NUDC_PASMU      NLRYFGSQPWAFPNSAMIGFLADYAGGE-ICVQEMEIHDAQWFDYNAPLPELPP----KG
NUDC_VIBCH      NIRYFGSQPWAFPSSMMMAFLADYDTGE-LKPDYSELSDANWFGIEN-LPPVAP----RG
NUDC_VIBVU      NIRYFGSQPWAFPSSMMMAFLADYHAGE-LKPDYSELADAKWFTSDN-LPPVAP----TG
NUDC_VIBPA      NIRYFGSQPWAFPSSMMMAFLADYDSGE-LNPDYTELSDAQWFGVKE-MPPVAP----TG
NUDC_DEIRA      QVQYRFSQPWPFPHSLMLAFTAEYAGGD-IVPQPGEVEEAQWFTVSD-LPQLPP----TF
NUDC_PSEAE      NLEYIGSQNWPFPHSLMLGFHAEYVSGE-IVPQEDEIEDAQWFSLDA-LPPLPA----QR
NUDC_PSEAB      NLEYIGSQNWPFPHSLMLGFHAEYVSGE-IVPQEDEIEDAQWFSLDA-LPPLPA----QR
NUDC_PSEA7      NLEYIGSQNWPFPHSLMLGFHAEYVSGE-IVPQEDEIEDAQWFSLDA-LPPLPA----QR
NUDC_PSEU5      PPQYIASQGWPFPHSLMLGFHAEYAGGE-IVPQPEEIEDARWFHIDN-LPALPA----RQ
NUDC_PSEE4      NIQYVGSQCWPFPHSMMLGFHAEYAGGE-IVMQPDEIEDAQWFSVHD-LPPLPA----GR
NUDC_PSEF5      NIQYVGSQCWPFPHSMMLGFHAEYAGGE-IIPQEDEIEDAQWFSVHA-LPPLPA----SR
NUDC_PSE14      NLKYMGSQCWPFPHSMMLGFHAEYDSGD-IVPQAEEIEDARWFHIDD-LPPLPA----NR
NUDC_PSEU2      NLRYRGSQCWPFPHSMMLGFHAEYESGE-IVPQAEEIEDARWFHVDD-LPPLPA----NR
NUDC_PSESM      NLKYMGSQCWPFPHSMMLGFHAQYAGGD-IVPQVDEIEDARWFHIDD-LPPLPA----NR
NUDC_MYCBO      DVRYLGSQPWPFPRSLMVGFHALGDPDEEFSFSDGEIAEAAWFTRDEVRAALAAGDWSSA
NUDC_MYCBP      DVRYLGSQPWPFPRSLMVGFHALGDPDEEFSFSDGEIAEAAWFTRDEVRAALAAGDWSSA
NUDC_MYCTU      DVRYLGSQQWPFPRSLMVGFHALGDPDEEFSFSDGEIAEAAWFTRDEVRAALAAGDWSSA
NUDC_MYCTA      DVRYLGSQQWPFPRSLMVGFHALGDPDEEFSFSDGEIAEAAWFTRDEVRAALAAGDWSSA
                  .*  ** *.** * * .* *    .: :  .  *:  * *:      . ..       

NUDC_ECOLI      TVARRLIEDTVAMCRAEYE------
NUDC_SHISS      TVARRLIEDTVAMCRAEYE------
NUDC_ECOHS      TVARRLIEDTVAMCRAEYE------
NUDC_ECO24      TVARRLIEDTVAMCRAEYE------
NUDC_SHIBS      TVARRLIEDTVAMCRAEYE------
NUDC_SHIFL      TVARRLIEDTVAMCRAEYE------
NUDC_SHIF8      TVARRLIEDTVAMCRAEYE------
NUDC_ECO57      TVARRLIEDTVAMCRAEYE------
NUDC_SHIDS      TVARRLIEDTVALCRAEYE------
NUDC_ECOUT      TVARRLIEDTVAMCRAEYE------
NUDC_ECOK1      TVARRLIEDTVAMCRAEYE------
NUDC_ECOL6      TVARRLIEDTVAMCRAEYE------
NUDC_ECOL5      TVARRLIEDTVAMCRAEYE------
NUDC_CITK8      TVARRLIEDTVAMCRAEYE------
NUDC_SALPA      TVARRLIEDTVAMCRAEYD------
NUDC_SALTY      TVARRLIEDTVAMCRAEYD------
NUDC_SALTI      TVARRLIEDTVAMCRAEYD------
NUDC_SALCH      TVARRLIEDTVAMCRAEYD------
NUDC_ENT38      TVARRLIEDTVAMCRADYEV-----
NUDC_KLEP7      TVARRLIEDTVAMCRAEFE------
NUDC_CROS8      TVARRLIEDTVARCRADDE------
NUDC_YERPE      TVARRLIEDTVVLCRE-HSDLSQ--
NUDC_YERPA      TVARRLIEDTVVLCRE-HSDLSQ--
NUDC_YERPN      TVARRLIEDTVVLCRE-HSDLSQ--
NUDC_YERPP      TVARRLIEDTVVLCRE-HSDLSQ--
NUDC_YERPS      TVARRLIEDTVVLCRE-HSDLSQ--
NUDC_YERP3      TVARRLIEDTVVLCRE-HSDLSQ--
NUDC_YERE8      TVARRLIEDTVVLCREEQFDDGE--
NUDC_PHOLL      TIARRLIEDTIVLCRNT--------
NUDC_PECAS      TVARRLIEDTVVLCRAYHENEG---
NUDC_HAEIN      TIARKLIHVTLELCKAEHKCD----
NUDC_HAEI8      TIARKLIHVTLELCKAEHKCD----
NUDC_MANSM      TIARALIEATLKLCAEHQDK-----
NUDC_PASMU      TIALKLIEHTLQLCAEEERKAT---
NUDC_VIBCH      TIARALIEQTLADIAQDQA------
NUDC_VIBVU      TIARALIEQTLLNMRSDS-------
NUDC_VIBPA      TIARALIEQTISDILSD--------
NUDC_DEIRA      TASRRLLDDALATLRLSGDFATT--
NUDC_PSEAE      SIARHLIDLYLARRSGAAEPVLPG-
NUDC_PSEAB      SIARHLIDLYLARRSGAAEPVLPG-
NUDC_PSEA7      SIARHLIDLYLARRSGAAEPVLPG-
NUDC_PSEU5      SIARYLIELYLARRLGRPEPVLPG-
NUDC_PSEE4      SIARYLIDLYVARRLGLAEPVLPA-
NUDC_PSEF5      SIARYLIDLYVARRLGHAEPVLPG-
NUDC_PSE14      SIARYLIEAYLAERSGAPEPVLPG-
NUDC_PSEU2      SIARYLIEAYLAERSGAPEPVLPG-
NUDC_PSESM      SIARYLIEAYLAERSGAPEPVLPG-
NUDC_MYCBO      SESKLLLPGSISIARVIIESWAACE
NUDC_MYCBP      SESKLLLPGSISIARVIIESWAACE
NUDC_MYCTU      SESKLLLPGSISIARVIIESWAACE
NUDC_MYCTA      SESKLLLPGSISIARVIIESWAACE
                : :  *:   :