CLUSTAL format seed alignment for MF_00300

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

AROC_ECOLI      -------MAGNTIGQLFRVTTFGESHG--------------LALGCIVDGVPPGIPLTEA
AROC_BLOFL      -------MAGNSIGQYFKVTTFGESHG--------------PAIGGIIDGVPPGLSLNAQ
AROC_NITMU      -------MSGNTFGKLFCVTSFGESHG--------------PALGCVVDGCPPGMELSAE
AROC_DICNV      -------MSGNSFGRAFVLTSFGESHG--------------AAIGGIIDGCPARIAIDSK
AROC_RHOCS      -------MAGNSFGTLFRFTTFGESHG--------------PAIGCIVDGVPPRLPLDEA
AROC_DESAL      -------MSGNTFGKAFRVTTWGESHG--------------PAVGAVVDGCPPGIPLTEE
AROC_SYNAS      -------MSGNTIGNVFRVTTWGESHG--------------GAIGAVIDGCPPGLGLSEQ
AROC_DESDA      -------MAGNTFGRALRLTTFGESHG--------------PGLGGIIDGCPAGLELTEA
AROC_DESAD      -------MSGNTFGQIFKVTTYGESHG--------------PGLGGVIDGCPAGIELSEE
AROC_HERA2      -------MPGNSFGRLFRISTWGESHG--------------VGLGVVIDGCPAGLELDLA
AROC_METTH      MILCGDSVAGNSTGEMFRVTTFGSSHG--------------PAVGAVIDGCPAGLELSED
AROC_METST      -------MVANTTGEIFKVTTFGLSHG--------------KALGATIDGCPAGLNLSNE
AROC_METJA      -----MVTLMNTYGDMFRVTVFGESHG--------------KAVGAVVDGCPANLPLSEE
AROC_METKA      ---------MNTLGRLFRVTTWGESHG--------------PALGAVVDGCPAGLPLSED
AROC_METAR      -------MTGNTFGNAFRITTFGESHG--------------PGLGVVIDGCPAGLPLTEA
AROC_METTP      ------MMSGSTFGTLFRVTTWGESHG--------------RAIGVVVDGCPAGIELSEM
AROC_HALMA      -------MNGNEFGRLFRMTTYGESHG--------------EAMGCTVSGVPAGVELSEE
AROC_HALMD      -------MNGNEFGRLFRLTTFGESHG--------------DAMGCTVSGVPAGVELSEE
AROC_BACFR      --------MFNSFGNIFRLTSFGESHG--------------KGIGGVIDGFPAGIVIDEE
AROC_SULMW      -------MAGNNFGKLFRVTTFGESHG--------------YALGGIIDGCPSGLKLNFE
AROC_CYTH3      --------MSNTYGTIFRITTFGESHG--------------NAVGVIVDGCPPNIEIDEA
AROC_PORGI      ---------MNTIGKLFRLTTFGESHG--------------KAIGGVIDGCPAGLFVDME
AROC_DESPS      --------MSSSFGTLYKVSTYGESHC--------------KGVGVVIDGCPPGLELSEA
AROC_SYNJB      ------MANGNSFGVLFCVTTYGESHG--------------GAVGVVVDGCPPRLPLSEA
AROC_LEPBJ      --------MPSSWGKIFKVGTFGESHG--------------KSVGVIVEGVPAGIPIRLE
AROC_LACP7      -------MSGSSFGSIFKIATWGESHG--------------KGIGVVVDGCPAGLTLNEE
AROC_BDEBA      -------MSASQFGSRFVITTFGESHG--------------TALGVVIDGCPAGVNFDEG
AROC_TREDE      -------MGANSFGRFFTLTTFGESRS--------------AGVGAVIDGCPAGIPLCAD
AROC_CHLPN      --------MKNSFGSLFSFTTWGESHG--------------PSIGVVIDGCPAGLELHES
AROC_PARUW      -------MASNSFGHLFKMTTWGESHG--------------KAMGVVIDGCPSGIFLTEQ
AROC_CAMHC      ---------MNTFGRKLRLTTFGESHG--------------NAIGGVIDGFPSGVKIDEK
AROC_HELAH      ---------MNTLGHFLRLTTFGESHG--------------SVIGGVLDGMPSGIKIDYE
AROC_CAMLR      ---------MNSFGIRFKFTSFGESHG--------------QAIGCVIDGMPAGVKFDFD
AROC_WOLSU      ---------MNRLGELWVLTTFGESHG--------------AGIGCVLDGVPAGLRVDEE
AROC_ZINIC      -------MFCNILGKIFTISCFGESHG--------------KVIGCIIGGCPSNIKLSNI
AROC_CARRP      --------MNNSYGEIIKISTFGESHG--------------LIIGALIDGFFSNLYISEK
AROC_RHOBA      --------MEILGGPHFAVAGAGESHG--------------PAVTTIIHGSPPGFRIRRC
AROC_DEHM1      --------MSNSLGKLFQITSFGESHG--------------DCVGVVIDGVPAGLAINVD
AROC_PYRAE      ---------MNTFGREFRITTFGESHG--------------KAVGVVIDGVPAGLPLSEE
AROC_IGNH4      -------MGGNTIGKMFSVTTWGESHG--------------KAIGAVIDGCPAGLPLSEE
AROC_SULAC      -------MPGNSLGKMFRITTFGESHG--------------PMIGVIVDGVPAGLYISKE
AROC_KORCO      -------MGGDIFGRELRLISFGESHG--------------PVVGAIVEGAPAGLPLSEE
AROC_PYRAB      -----------MRGRVLSFTLFGESHG--------------KGVGVVITGIPPGIKVSHE
AROC_AERPE      ------MASRDSLGEVFRVSIFGESHG--------------PGVGALVTGVPPGLEVDEA
AROC_THEVO      -------MVMFYLGNVLKLSLFGSSHG--------------ESVGSLVDGFPVGYKIPLD
AROC_ACESD      --------MSTTLGTKLKLTIFGESHG--------------VAIGGVIDGILPGIKLDMD
AROC_ATOPD      -------MMTSTFGTTVKVSIFGESHA--------------PKIGCTIEGLPAGFTVDLH
AROC_CHIPD      ---------MNSFGRLFRVNVFGESHG--------------ASVGVNIDGIPAGIPLTQE
AROC_HUNT2      -------MVGNTFGRIFRVTTCGESYAGAFRKNLQIPKELFGGLIAIVDGVPPGIKLTAD
AROC_MYCTU      ---------------MLRWITAGESHG--------------RALVAVVEGMVAGVHVTSA
AROC_CORJK      ------------MLFMLRWTTAGESHG--------------QALISMIENLPAGLSVSRE
AROC_KOCRD      ---------------MLRWLTAGESHG--------------EALVGIVEGVPAGVELTTG
AROC_TROW8      ---------------MLRWFTAGESHG--------------MELVAILEGLPAGIPVSLE
AROC_KORVE      ---------------MLRFQTAGESHG--------------EALVATLTGVPAGLPIDQA
AROC_MOOTA      ---------------MLRYLTAGESHG--------------RGLSVIVEGLPAGVPLTDG
AROC_THET2      ----------------MRFLTAGESHG--------------PELLAIIEGLPAGLPLSEE
AROC_SYMTH      ----------------MRYLTAGESHG--------------RALVTIVEGLPAGVPVDLA
AROC_ANAD2      --------------MTLRYLTAGESHG--------------PALVAIAEGFPAGLAVDFE
AROC_CARHZ      ---------------MFRYLTSGESHG--------------EGLYVILEGVPAGLKVDLD
AROC_RUBXD      --------------MRFGFSTAGESHG--------------PAEVVIVHGVPAGLRLLAE
AROC_ALKMQ      ---------------MFRLLTAGESHG--------------KSLVGVIEGFPANVKIDIE
AROC_ALKOO      ---------------MLRYLSAGESHG--------------KGLIAIIEGLPSNIPMDIN
AROC_GEOMG      ---------------MLRYLTAGESHG--------------PQLTAIIEGIPAGLKISEE
AROC_THEP3      ----------------MRYITAGESHG--------------EALIAVIEGLPSNLLIDEE
AROC_AQUAE      -----------MSLRYLRFLTAGESHG--------------KGLTAILEGIPANLPLSEE
AROC_CALBD      ----------------MRFLDAGETHG--------------KALIAIIEGFPAHVKIDIE
AROC_SYNWW      --------------MVLRFITSGESHG--------------KGLIGIVEQMPAGVEIGEE
AROC_UNCTG      ---------------MIRFTTAGESHG--------------EGLFVIIEGIPAGLTINSE
AROC_CHLP8      ---------------MIRYFTAGESHG--------------PALSAIVEGMPAGVALTES
AROC_CHLT3      ---------------MIRYLTSGESHG--------------PSLVAIVEGVPAGLALHPD
AROC_SALRD      ---------------MLRYLTAGESHG--------------EAIIGVLEGAPAQLPLTPD
AROC_GLOVI      ---------------MLRFLTAGESHG--------------PGLTIIVEGIPADLPLLAE
AROC_STRPN      ----------------MRYLTAGESHG--------------PRLTAIIEGIPAGLPLTAE
AROC_LACLM      ----------------MRYFTAGESHG--------------PRLTAIIEGVPAGLSLSAE
AROC_LYSSC      ----------------MRYLTAGESHG--------------PQLTTIIEGLPSLLPITAE
AROC_EXISA      ----------------MRYLTAGESHG--------------PGLTVIIEGAPAGLAIDIS
AROC_LACPL      ---------------MINYVTAGESHG--------------PQLTGVLTGIPAGLQLDID
AROC_LEUCK      ----------------MRYTTAGESHG--------------PEEIAVIEGIPAGLHITQE
AROC_DESHD      ----------------MRYLTAGESHG--------------PKLVGILEGVPSGAKIDKE
AROC_THEMA      ----------------MKLTIAGDSHG--------------KYMVAILEGLPSGIRVDEE
AROC_THESQ      ----------------MRLTIAGDSHG--------------KYMIAVLEGIPAGLKIDEE
AROC_CLOTE      ----------MERYTMLRFLDAGESHG--------------KAMMSIIDGIPSNFKVDID
                                      * :                               .   

AROC_ECOLI      DLQHDLDRRRPGT---SRYTTQRREPDQVKILSGV-FEGVT-------------------
AROC_BLOFL      DIQFDLNRRRPGT---SRYTSPRSEPDIVEILSGV-FNEKT-------------------
AROC_NITMU      DIQQDLDRRKPGT---SRHVTQRREPDTVEILSGV-FEGKT-------------------
AROC_DICNV      EIQKELDRRKPAR---SAYVSSRREADEIHLFSGI-FEGQT-------------------
AROC_RHOCS      FIQGFLDRRRPGQ---SRFVTQRQEPDAVRILSGV-FEGLT-------------------
AROC_DESAL      AIQVMMDRRKPGS---SAASTTRKEEDLVHILSGV-FEGLT-------------------
AROC_SYNAS      HIQAALDRRKPGV---GAFATPRQETDRIEILSGV-FEGRT-------------------
AROC_DESDA      HIQAELDRRKPGQ---GPTATKRKEADTVRLLSGV-FEGCT-------------------
AROC_DESAD      IIQLELDRRKPGQ---GIASTARKEADRVKILSGV-FEGRT-------------------
AROC_HERA2      AIQAQLDRRRVGQ---SRMTSARREPDEVEILSGM-FEGRT-------------------
AROC_METTH      DIQQELNRRRPGT---GALTTPRAESDRVEILSGI-FRGRT-------------------
AROC_METST      DIQNELNKRRPGT---SNLTTSRDEKDKVEILSGI-FNGMT-------------------
AROC_METJA      DIQKELDRRRPGQ---SIFSTPRKEEDKVEILSGI-FEGKT-------------------
AROC_METKA      DVQRELDRRRPGQ---SGVSTPRSERDRVEILSGV-HEGRT-------------------
AROC_METAR      DVQAELDKRKPGQ---SEVTTQRKEADMVEILSGV-FEGLT-------------------
AROC_METTP      DVQRELDRRRPGQ---STATTERHEADSVEILSGI-FEGIT-------------------
AROC_HALMA      EIQKDLDRRKPGQ---SMITTSRGEPDKVTINSGI-QDGYT-------------------
AROC_HALMD      AIQEDLDRRKPGQ---SMITTSRGEPDKVSIKSGL-QDGYT-------------------
AROC_BACFR      FVQQELNRRRPGQ---SVITTSRKEADKVEFLSGI-FEGKS-------------------
AROC_SULMW      EINNELNRRKPGQ---SSIVTQRKESDEVIFLSGI-FNGLT-------------------
AROC_CYTH3      FIQSEMARRKPGQ---SKIVTQRQEDDEIEILSGV-FEGKS-------------------
AROC_PORGI      TIERELLRRRPGQ---SHYTSPRQESDMVQFISGL-FRGET-------------------
AROC_DESPS      DIQRQLDRRRPGQ---NVLTTDRKEADQVMILSGT-ENGKT-------------------
AROC_SYNJB      DIQAELDRRRPGQ---SPITTPRQEADRCQILSGV-FQGFT-------------------
AROC_LEPBJ      EIQKDLDRRRPGQ---SNLTTPRDENDTVRVVSGV-FEGKT-------------------
AROC_LACP7      MIQTFLNRRKPGQ---TKYSTPRKEDDLVTILSGV-FEGKT-------------------
AROC_BDEBA      LLKKELERRRPGHHGSGQIVSGRQETDAPEVLSGV-FDGKT-------------------
AROC_TREDE      DIQKELNRRKPG--SSGPFSTKRNEDDICEILSGV-FEGRT-------------------
AROC_CHLPN      DFVPAMKRRRPG----NPGTSSRKENDIVQILSGV-YKGKT-------------------
AROC_PARUW      DINQELYWRKPGR---NELTSPRLEEDQVEILSGL-FNGQT-------------------
AROC_CAMHC      FIQAELDKRKPG----GKFATARKENDKVQIFSGI-FEGVS-------------------
AROC_HELAH      LLENEMKRRQGGR---NAFTTPRKEDDKVEITSGV-FEDFS-------------------
AROC_CAMLR      FLQEMLDKRKPGQ---NKFSTPRKEEDKAQVLSGV-FEGYT-------------------
AROC_WOLSU      FLNLELSRRRPGQ---SLYSTPRKESDRVEILSGV-MEGFT-------------------
AROC_ZINIC      DVQIEVNKRKPGI---SKYITSRKENDKIKILSGI-FNKKT-------------------
AROC_CARRP      FIQKNLNLRKPFT---SLFSTQRREQDKVKIFTGI-FKNKT-------------------
AROC_RHOBA      DVQPFLDRRRPGG---NKHGTPRNEKDKVVFLAGL-YRDDTDALLTGSKLTVDVDDQSFE
AROC_DEHM1      EIQVEVDKRKSRA---KAHATPRCEDDRIEIFSGI-LNNFT-------------------
AROC_PYRAE      DIKRELERRMFCH---IHWLNPRCEPEEFEILSGV-KNGHT-------------------
AROC_IGNH4      DLLVELSLRRP-G---RRFTTPRREPDVPEILSGV-FNGKT-------------------
AROC_SULAC      DIEFELSFRRP-G---KQFVSGRREKDEPEIVSGV-YNGRT-------------------
AROC_KORCO      DVQRILDLRRPGQ---SELVSQRAERDRVEILSGV-FNGFT-------------------
AROC_PYRAB      ELVKELE-RRKGI---PGLSTARSEPDNPIILSGI-FRGYT-------------------
AROC_AERPE      YINRELERRRPGG---P-YASPRREADRVEILSGV-FRGRT-------------------
AROC_THEVO      YIQKYMEYRRPGN---TIITSQRKEEDVVKIISGM-HNGFT-------------------
AROC_ACESD      YIEAVMKRRMPGQ---NDMSTPRKEADKAEMLSGV-FNGIT-------------------
AROC_ATOPD      ELKTFLQRRSPS----HPWDTPRKEIDNPKFVSGISAKGIL-------------------
AROC_CHIPD      DFLPDLERRKAG----AKGTTPRKEEDLPFIKSGV-FNDHT-------------------
AROC_HUNT2      FVQEELDKRRPGK---TPLDTPRKERDKVYIFSGVMEDDIT-------------------
AROC_MYCTU      DIADQLARRRLGY---GRGARMTFERDAVTVLSGIRHGSTL-------------------
AROC_CORJK      DVSYQLARRRLGY---GRGARMKFEADEVTFVGGVRHGKTL-------------------
AROC_KOCRD      MVQDALARRRLGY---GRGARMKFEQDRVRILGGVRHGLTQ-------------------
AROC_TROW8      HIGNELSRRRLGF---GRSARQKFEKDLVTLSAGVLHGSTL-------------------
AROC_KORVE      FLDRELWRRQQGF---GRGGRMKIERDTAHILSGVHHGKTI-------------------
AROC_MOOTA      DINTWLTRRQGGY---GRGGRMAIERDQAEILAGVRGGLTL-------------------
AROC_THET2      DINPWLEKRQKGY---GRGRRMVIERDRVEFRAGVRGGRTT-------------------
AROC_SYMTH      AIDRDLARRQSGY---GRGGRMKIEQDRVQVLSGIRHGKTL-------------------
AROC_ANAD2      AVDRDLRRRQKGY---GRGGRMKIETDAAQFLAGLRGGLTT-------------------
AROC_CARHZ      YINHELSRRQLGY---GRGERMKIEKDEAQILTGVRGGFAT-------------------
AROC_RUBXD      DVDRDLARRQLGY---GRGGRQKIERDRVEFLGGVRHGRTL-------------------
AROC_ALKMQ      EINRDLGRRQRGY---GRGGRMKIEKDRVEILSGVRGGKTL-------------------
AROC_ALKOO      RINADLGRRQQGF---GRGNRMKIEKDRVEILSGVRDGKTL-------------------
AROC_GEOMG      TINVDLARRQGGY---GRGGRMLIEKDQVQILSGVRWGETI-------------------
AROC_THEP3      FINKELKRRQGGY---GRGGRMAIEEDKVHVLSGIRNGKTI-------------------
AROC_AQUAE      EINHELRRRQRGY---GRGGRMKIEKDTAEILSGVRFGKTL-------------------
AROC_CALBD      NINHLLQLRQRGY---GRGKRMEIEKDRVKILSGVRNSFTT-------------------
AROC_SYNWW      DINRELQRRQKGY---GRGGRMKIESDRVEIFSGIRNGYSL-------------------
AROC_UNCTG      DIDLELARRQKGY---GRGQRMCIETDTVKVFSGMRHTVSL-------------------
AROC_CHLP8      DINDQLARRQQGY---GRGGRMKIETDRAEVLSGIRFGKTI-------------------
AROC_CHLT3      DLNIHLQRRQQGY---GRGNRMKIESDKAEILSGVRFGYTI-------------------
AROC_SALRD      DINEHLARRWLGY---GRGGRSKIENDTVHIYSGVRFGKTL-------------------
AROC_GLOVI      DIDRDLARRQVGF---GRGGRMSIETDRVTFRGGVRLGRTI-------------------
AROC_STRPN      DINEDLRRRQGGY---GRGGRMKIENDQVVFTSGVRHGKTT-------------------
AROC_LACLM      DINIELKRRQGGY---GRGGRMKIESDQVEITSGVRHGKTI-------------------
AROC_LYSSC      KINHDLKRRQGGH---GRGRRMQIETDTVEIVAGVRHGQTL-------------------
AROC_EXISA      QINAELKKRQSGY---GRGRRMQIESDQVEVRSGIRHGVTT-------------------
AROC_LACPL      AINTGLAARQGGF---GRGNRQQIEHDTVQIIGGVRHGVTL-------------------
AROC_LEUCK      DVNAQLARRQKGY---GRGERQKIETDTVTFLTGIRHQKTL-------------------
AROC_DESHD      TIDQALQERQKGP---GRGGRMKIEKDQITILSGVRGGLTT-------------------
AROC_THEMA      LIRRDLFRRRNCY---GRGKRMKMEEDAFEIVSGLWKGITT-------------------
AROC_THESQ      IIRRELFRRRNCY---GRGKRMSMEEDAFEIVSGVWGGITT-------------------
AROC_CLOTE      FINNELKRRQKCY---GRGGRMKIEKDKIQFLSGLRGTMTT-------------------
                 .   :  *               * :   .  *                          

AROC_ECOLI      ---------TGTSIGLLIEN----TDQRS----------------------QDYSAIKDV
AROC_BLOFL      ---------TGTSIGLIIKN----IDQRS----------------------QDYEEIKNL
AROC_NITMU      ---------TGTPIALLIRN----EDQRS----------------------KDYSKIMDT
AROC_DICNV      ---------TGTPIGFVIQN----CDQRS----------------------DDYAPFKAQ
AROC_RHOCS      ---------TGTPVMLEIVN----QDQRS----------------------RDYGEIRDR
AROC_DESAL      ---------TGTPISLMIKN----KDAKS----------------------SSYDQFKNL
AROC_SYNAS      ---------TGTPIALLIRN----RDANS----------------------GAYDGLRNI
AROC_DESDA      ---------TGTPIAFFIAN----EDQRS----------------------RDYGNLAEA
AROC_DESAD      ---------TGTSIGFHIEN----TDQRS----------------------HDYSKIMNV
AROC_HERA2      ---------TGTALAMLIRN----TNARS----------------------SDYDAIKHL
AROC_METTH      ---------DGTPIAGIVRN----LDADS----------------------KSYSNIKNT
AROC_METST      ---------DGTPITAIIFN----KDQRS----------------------KNYDNLKNN
AROC_METJA      ---------TGAPICSIVYN----KNMRP----------------------KDYSKIKDT
AROC_METKA      ---------LGTPISMIVWN----EDVDS----------------------SKYEPIRTR
AROC_METAR      ---------TGTPIAMLVRN----ADARS----------------------AAYENIRNI
AROC_METTP      ---------TGTPISMLVWN----RDARS----------------------SHYDSIRHT
AROC_HALMA      ---------TGTPIGMVIQN----KDARS----------------------GKYEPFITA
AROC_HALMD      ---------TGTPIGMVIQN----KDARS----------------------GKYEPFITA
AROC_BACFR      ---------TGCPIGFIVWN----ENQHS----------------------NDYNNLEKV
AROC_SULMW      ---------TGTPIGFIIKN----KDHNS----------------------KDYFNLKEI
AROC_CYTH3      ---------TGTPIAMMVRN----ADQRS----------------------KDYSHIADR
AROC_PORGI      ---------TGAPIAFMIDN----KDVRS----------------------ADYDSLSSI
AROC_DESPS      ---------LGTPIALHVNN----RDQRP----------------------GDYGDISDL
AROC_SYNJB      ---------LGTPIHILVRN----QDARP----------------------QDYQEMATT
AROC_LEPBJ      ---------IGSPIALVVEN----QNTNS----------------------KDYENLRTT
AROC_LACP7      ---------TGTPISMMIAN----ETARS----------------------ADYSEIASF
AROC_BDEBA      ---------LGTPMAIIVRN----QDARS----------------------QDYSVIKNS
AROC_TREDE      ---------LGSPIAVLVRN----KETSS----------------------KDYENLKDV
AROC_CHLPN      ---------TGTPLSLQILN----TDVDS----------------------SPYENSERL
AROC_PARUW      ---------TGAPISLIIWN----KDVNS----------------------SAYEGMHTL
AROC_CAMHC      ---------IGTPIGFIIFN----ENQKS----------------------KDYENIKNL
AROC_HELAH      ---------TGTPIGFLIHN----QRARS----------------------KDYDNIKNL
AROC_CAMLR      ---------TGTPISVLVYN----ENTRS----------------------KDYE--KDV
AROC_WOLSU      ---------TGTPLAMFIPN----ENQKS----------------------SDYESIRSI
AROC_ZINIC      ---------TGAPIAIIIKN----NDKKS----------------------RDYDNIKNI
AROC_CARRP      ---------TGAPVLMLIKN----NDKQS----------------------SDYNNISLN
AROC_RHOBA      TEGYEDGFTTGEPIAAIVLS----TSKKSGDY-------------------TQFSGPTGE
AROC_DEHM1      ---------TGAPICLVIWN----KNIDS----------------------SEYERTRSK
AROC_PYRAE      ---------QGTPIAIVIWN----KRAIS----------------------SYYDELWMK
AROC_IGNH4      ---------TGMPISIIIRN----RDVIS----------------------SYYEKIKET
AROC_SULAC      ---------TGAPLTIIIRN----NDVIS----------------------SLYEEVKHK
AROC_KORCO      ---------TGAPISMIVRN----EDIDS----------------------SYYEEISRF
AROC_PYRAB      ---------TGTPIAVLFEN----KDVDS----------------------SYYEDIKDK
AROC_AERPE      ---------TGAPILLFIRN----VDVKP----------------------GFYEEFRYK
AROC_THEVO      ---------DGSPITMIIEN----KNVIS----------------------SYYEELKEN
AROC_ACESD      ---------TGAPIAFEIRN----SNQHS----------------------SDYEKTKNL
AROC_ATOPD      ---------DGFPLTAELPN----NNVRQ----------------------KDYTATKLV
AROC_CHIPD      ---------TGAPITILFEN----NNTRS----------------------TDYEKLREF
AROC_HUNT2      ---------TGAPVGMIIPN----DVIEDEHI-------------------NKHKSYKEV
AROC_MYCTU      ----------GGPIAIEIGN----TEWPKWETVMAADPVDP-----AELADVARNAPLTR
AROC_CORJK      ----------GSPVAVMIGN----TEWPKWTTIMSADPIDESDPEVAKEMASGRGAKLTR
AROC_KOCRD      ----------GGPVAIEIAN----TEWPKWQDVMSSDPVDP-----QVLEGRARNAPLTR
AROC_TROW8      ----------GSPVAIRITN----SEWGKWEKIMTPEVPCK-----SDMSDAKRAQGLYK
AROC_KORVE      ----------GSPIAILIRN----NDWKNWQESLPVE-----------EGDSAKHKPVKS
AROC_MOOTA      ----------GSPIALFIAN----RDWENWQEIMAPGP-----------EARA-ARVVTR
AROC_THET2      ----------GAPVALAIKN----ADFKNWAEIMDPAP-----------GNWPRKRALTA
AROC_SYMTH      ----------GSPVALLVEN----RDWLNWTEVMSPAPLEAY------TDPRAAQKVRTR
AROC_ANAD2      ----------GAPIALAVWN----KDHENWKDLVSPYAR--------------GGKKFTQ
AROC_CARHZ      ----------GAPITIKVKN----RDYENWEKFMRTTGEIE------------PGREVTV
AROC_RUBXD      ----------GSPVAMLVRN----RDYANWERRMNPAPVED------------PPEPITL
AROC_ALKMQ      ----------GSPISFLIEN----KDYANWEPYMNPEAVDG------------EEKRVTQ
AROC_ALKOO      ----------GTPLTLMIEN----LDYKNWTSIMSVEKLE-------------KQNIIVE
AROC_GEOMG      ----------GSPVTLCVVN----RDWVNWQEKMSPHERHRD-----------DKIRVTR
AROC_THEP3      ----------GSPLTLEIIN----KDYENWKNKKTPE--------------------VTR
AROC_AQUAE      ----------GSPIALFIRN----RDWENWKEKMAIEGEPSP-----------SVVPFTR
AROC_CALBD      ----------GAPITLMIEN----RDYENWRSFMDATQCDVD-----------TK-KVTV
AROC_SYNWW      ----------GTPISYLIRN----QDFENWQEIMATGECKRH-----------EEKIVNR
AROC_UNCTG      ----------GSPIAMYIAN----KDFKNWTKIMSPTSVDS------------EVTPLLR
AROC_CHLP8      ----------GSPVAMVIRN----RDWENWTVPMAQFDDNSA-----------EVQKITI
AROC_CHLT3      ----------GSPISFAIKN----KDWANWTNKMNQFENPSE-----------PVATIDI
AROC_SALRD      ----------GSPISFRIDNGAYEKDKAGWPEKMAIEGEPPE-----------DMEKVTM
AROC_GLOVI      ----------GSPIAMTLEN----RDFKNWEVPMSVSPVDLDD---EAVRAQLEAKRITR
AROC_STRPN      ----------GAPITMDVIN----KDHQKWLDIMSAEDIEDRLKS---------KRKITH
AROC_LACLM      ----------GSPITLNVTN----RDFKNWEQIMAAQDVEDKIKK---------QRRLTK
AROC_LYSSC      ----------GSPVALVVAN----DDWKHWTKIMGAEPLAEDVNPE------DIKRQISR
AROC_EXISA      ----------GAPITFWIEN----KDHTHWKHVMQAEPIESDIEV---------KRRVSR
AROC_LACPL      ----------GSPIALTIMN----RDHAHWAAIMDPVSPATATNT---------LRQVTR
AROC_LEUCK      ----------GSPITLNVHN----DDHNNWSKIMAPNEPQTSENS---------LRKVLR
AROC_DESHD      ----------GAPIALEIIN----RDWANWEKIMAWGD-EADLES----------RKVMT
AROC_THEMA      ----------GAPVTILIPN----R---------AGNPVK--------------DVR-SV
AROC_THESQ      ----------GAPVTILVPN----K---------AGNPVK--------------DVR-SV
AROC_CLOTE      ----------GNPITMAIYN----NDSPNWEKILSGEVKK--------------DEKITI
                          * .:   . .                                        

AROC_ECOLI      FRPGHADYTYEQKY--GLRDYRGGGRSSARETAMRVAAGAIAKKYLAE----KFG-IEIR
AROC_BLOFL      YRPGHADYTYEKKY--GLRDYRGGGRSSARETAIRVAAGAIAKKYLYK----INK-INIR
AROC_NITMU      FRPGHADYVYWQKY--GIRDYRGGGRSSARETAVRVAAAAIAKKWLRA----RYG-VVIR
AROC_DICNV      FRPSHADYTYQKKY--GIRDYRGGGRASARETAVRVTGGAIAKAVLQQ----LCA-IKVR
AROC_RHOCS      FRPGHADWTYQAKY--GIRDHRGGGRSSARETASRVAAGAVARRVLET----APAPVTVR
AROC_DESAL      FRPGHGDLSYQRKY--GIRDYKGGGRASARETAGRVAAGAVAGLLLER----VGI--KTF
AROC_SYNAS      FRPGHGDYTYFKKY--GLRDHRGGGRASGRETAARVAAGAVAALVTAA----AGI--DVL
AROC_DESDA      FRPGHADWAYFQKYN-GLRDHRGGGRSSGRETAARVAGGVIAKKILAR----RGV--TIL
AROC_DESAD      YRPGHADRTFDAKY--GFRDYRGGGRSSGRETVSRVAGGAVAQEFLRQ----QSI--SCQ
AROC_HERA2      YRPGHADHSYDAKY--GFRDYRGGGRSSARETAARVAAGAVARQILAT----MGI--SLV
AROC_METTH      PRPGHGDYTWRARF--RNYDYRGGGRGSGRVTIGHVIGGAVAKKLIG------NYGLTVT
AROC_METST      PRPGHGDFCWREKF--GNYDYRGGGRGSGRVTIGHVIGGAVSKKLLQ------QHNITTT
AROC_METJA      PRPGHADLTYRLKY--KNYDYRGGGRASGRVTIGHVIGGAIAKKLLSY-----TYNIKII
AROC_METKA      PRPGHADVTYRWKY--GHVDYRGGGRASGRTTVGIVMGGAVAKKLLREAPSNDPLGIEIV
AROC_METAR      ARPGHADFGYMEKY--GMRDYRGGGRSSGRETLSRVAGGAVAKKLLS------LYGVEVH
AROC_METTP      PRPGHADYTYHVKY--GIRDHRGGGRASARETVGRVAAGAVARKLLS------EFGVEIA
AROC_HALMA      PRPSHGDYTYSAKF--GTRNWGGGGRSSARETVNWVAAGGVAKQVLEQ----SDYDVQIK
AROC_HALMD      PRPSHGDYTYSAKF--GTRNWGGGGRSSARETVNWVAAGGVAKQVLAQ----SDYDVQIK
AROC_BACFR      YRPSHADYTYTVKY--GIRDHRGGGRSSARETISRVVGGALAKLALR------QLGIHIT
AROC_SULMW      YRPSHSDFTYYKKY--GIRDYRGGGRSSARETVSRVVAGAIAKQLLK------IYNIFIK
AROC_CYTH3      FRPSHADYTYQEKY--GFRDYRGGGRSSARETLARVAAGALAKMILA------KVNIKIQ
AROC_PORGI      FRPGHADYTYFHKY--GIRDTRGGGRSSARETAVRVVAGAVAKQLLA------PLGIRCT
AROC_DESPS      PRPSHADFTYQMKY--GIRASSGGGRASARETIGTVAAGAVAMKVLKK-----KYGIEIV
AROC_SYNJB      FRPSHADATYQAKY--GIRNWQGGGRASARETIGRVAAGAIAKKILRL-----AAGVEIL
AROC_LEPBJ      YRPSHADYTYQMKY--GFRAHVGGGRSSVRETIGRVAAAAIARMILKD-----DLGIETV
AROC_LACP7      YRPGHADYTFDAKY--GFRDYRGGGRSSGRETIGRVAAGAIAAALLK------ELGIEVF
AROC_BDEBA      PRAGHADDMWRNKF--GHSDHRGGGRSSGRETVSRVMAGSVAQMMMKH------VSAPTK
AROC_TREDE      YRPGHADYSYDLKY--GHRDYRGGGRSSGRETIGRLIGGAVAKKMLE-------------
AROC_CHLPN      YRPGHSQYTYEKKF--GIVDPNGGGRSSARETACRVAAGVVAEKFLAN------QNIFTL
AROC_PARUW      FRPGHANYTYSNKY--GIFDYRGGGRASARETVCRVAAGAIAKKILSD------VGISVV
AROC_CAMHC      FRPGHADFGYFKKFV--IRDYRGGGRSSARETAVRVAAGAFAQILLN------EFDICVQ
AROC_HELAH      FRPSHADFTYFHKYG--IRDFRGGGRSSARESAIRVAAGAFAKMLLK------EIGIVCE
AROC_CAMLR      FRPAHADFTYYHKYG--IRDYRGGGRASARESIARVAAGALAQMLLK------EFDIEIM
AROC_WOLSU      FRPGHADFTYHYKYG--LRDHRGGGRSSARETAARVAGGAVAKMFLK------ELGISIF
AROC_ZINIC      FRPGHADYTYWNKYK--NIDFRGGGHSSGRLTANIVSASSITKKYLFK-----NYGIVFK
AROC_CARRP      FRPGHADYTYFLKYK--FRDYRGGGRSSARETACRVASGCVFKNLIY------NKGVIVR
AROC_RHOBA      VRPGHTDLVKFHQSK-GFVDVRGGGRSSYRSTITDVIGGSVARIILRE-----CFGTRFV
AROC_DEHM1      IRPGHADFTGFVKYG-GFNDFRGGGRFSGRITAGHVMAGAIARKLIS------TIGIEVI
AROC_PYRAE      PRPGHADLAYYLKYG-KFYDHRGGGRASGRTTAAIVAAGAVAKKLLS------QLGVDVC
AROC_IGNH4      PRPGHADLAYIKKYGYEHWDYRGGGRASGRETAARVAAGAVAKKLLG------CLGVVVS
AROC_SULAC      PRPGHADLPYIMKYGYENWDYRGGGRSSARETASRVAASAIAKKLLM------LTDTVIG
AROC_KORCO      PRPGHADYVARLKYS-GYNDFRGGGRFSGRLTVSMCMAGAVAMKILE------KLGIEVM
AROC_PYRAB      PRPGHADYPARIKYF-GYNDYRGGGHFSGRLTVGIVTAGYFAKKILE------KYGIRIR
AROC_AERPE      PRPGHADYVAYERYL-GHQDYRGGGIFSGRRTAALVAAGAIAKLVLA------RYGVRVY
AROC_THEVO      PRPGHSDYTLYVKYG-DFRNYEGGGFLSGRMTAPLVAAGALAKSYLD------SLGIKIT
AROC_ACESD      MRPGHADYTGYMKYK-GYSDYRGGGHFSGRLTAVLTFAGAIASYILE------GANIFIT
AROC_ATOPD      PRPGHADFSAWAKWG-NSYKQTGGGHFSARLTAPLCIAGGIALQILH------AQGITIA
AROC_CHIPD      PRPGHADFVATHKYG-GFEDYRGGGHFSGRLTLNLVAAGVIAKKIL-------GPGISVK
AROC_HUNT2      VRPGQAGYTFFKKYG-QFADNIGAGRASGRETAARVAAGAVAKAVLDT------MGIDVI
AROC_MYCTU      PRPGHADYAGMLKYGFDD-ARPVLERASARETAARVAAGTVARAFLR-----QALGVEVL
AROC_CORJK      PRPGHADFSGMVKYDHDE-ARPILERSSARETAARVAAGTFARALLR-----EVLGVEVL
AROC_KOCRD      PRPGHADLTGMQKYGFDE-ARPVLERASARETATRVALGVVASQIL------AALGVRLV
AROC_TROW8      PRPGHADLVGMQKYGFQN-SRLVLERASARETAARVACGAVAKAFL------QQLDIFIL
AROC_KORVE      PRPGHADLAGALKYNFPE-ARYVLERASARETTARVAAGAIAKLLL------RQIGADVL
AROC_MOOTA      PRPGHADLAGGLKYHQAD-LRNILERASARETAARVAAGAVAAVLL------KELAIELA
AROC_THET2      ARPGHADLAGGMKYGHKD-LRDVLERASARETAMRVAVGAVALKLL------SLLGVEGV
AROC_SYMTH      PRPGHADLAGALKYDHAD-LRNVLERASARETAARVAAGSLAKQYL------APFGIRVA
AROC_ANAD2      VRPGHADLAGALKYGLDD-ARDVLERASARSTAVTVALGALAKALL------STLGVEVC
AROC_CARHZ      PRPGHADLAGGLKYGHKD-LRNVLERASARETAVRVAAGAVAKLFL------AEFGVRIY
AROC_RUBXD      PRPGHADLAGMQKYGFGD-LRNVLERSSARETVARVAAGAVARRLL------GEFGVRVF
AROC_ALKMQ      PRPGHGDLTGTLKYGFDD-IRNVLERSSARETAVRVAIGSLAKQLM------REFHIEVY
AROC_ALKOO      PRPGHGDLVGSLKYNHKD-IRNVIERTSARDTAIRTAIGAVVKQFL------SIFDIEIL
AROC_GEOMG      SRPGHADLPGAMKYNHRD-VRNILERSSARETAMRVAVGSVARAFL------ASFGVTVS
AROC_THEP3      PRPGHADLAGAIKYNQRD-LRNILERSSARETAARVAVGSVAKLLL------KELDIYVK
AROC_AQUAE      PRPGHADLSGGIKYNQRD-LRNILERASARETAARVAVGAVCKKFL------SEFGIKIG
AROC_CALBD      PRPGHADLAGCLKYEFDD-ARNVLERASARETAIRVAVGAVCEELL------KMFGIKLY
AROC_SYNWW      PRPGHADLAGAMKYNQSD-MRNILERASARETAARVAAGAMFKKLL------ESFNIRVY
AROC_UNCTG      PRPGHADLPGFMKYGVND-FRDILERASARETAARVAAGAVCKALL------KEFEISIV
AROC_CHLP8      PRPGHADLTGFVKYGFDD-IRPVIDRSSARETAARVAAGSLARAFL------RQLGIQIG
AROC_CHLT3      PRPGHADFSGRIKYGFND-IRPVIERSSARETAARVGACSISRKFL------HDLGIEIG
AROC_SALRD      PRPGHADLAGKQKYEHDD-MRPVIDRSSARETAMRVACCSVARRLL------NEFGIEVG
AROC_GLOVI      LRPGHADYPGAVKYGLAD-VRNILERSSARETASRVAAGAIAKQLL------RQFNVHVH
AROC_STRPN      PRPGHADLVGGIKYRFDD-LRNSLERSSARETTMRVAVGAVAKRLL------AELDMEIA
AROC_LACLM      PRPGHADLVGGMKYEFED-LRNVLERSSARETTMRVAVGAVAKKLL------HELEIEVA
AROC_LYSSC      PRPGHADLVGGMKYGHRD-LRNVLERSSARETTVRVAVGSVAKALL------NELGISIV
AROC_EXISA      PRPGHADLVGGMKYDHRD-LRDVLERSSARETAARVAVGAFCKQLL------QQVGVSLF
AROC_LACPL      PRPGHADLVGGMKYGHRD-LRNVLERSSARETAMRVAIGQICKQLL------AQLDIHLV
AROC_LEUCK      PRPGHADLVGGIKYRHHDDLRNVLERSSARETTMRVAVGAVAKKLL------AEIGVDVH
AROC_DESHD      PRPGHADLTGYLKYRTEV--RNVLERASARETAMRVAIGNIAVQIL------EALGVEIR
AROC_THEMA      PRPGHIDYAAWVKYKLPD-LNIYVERSSARWTVALTAAGSLLKSLL------KEFGIEVL
AROC_THESQ      PRPGHIDYAAFVKYKLPD-LNVYVERSSARWTVALTAAGALLKSLL------REFNIDVL
AROC_CLOTE      PRPGHGDLVGYFKYGTGD-IRDSIERTSARETSIRTAVGALCKQIL------KGIGIEVR
                 *..:       :              * * :        .                   

AROC_ECOLI      GCLTQMGDIPLD----------------IK--DWSQVE-QNPFFCPDPDKI-------DA
AROC_BLOFL      AYLKQIGHIHCD----------------FK--DWIYVN-NNPFFCPNPEQI-------TE
AROC_NITMU      GHMAQLGPVEIP----------------FK--QWEAVG-ENPFFSADPDIV-------PS
AROC_DICNV      AYLSQIGCHRLA----------------FE--SWQAVS-SNPFSCPNQHQL-------SV
AROC_RHOCS      GALVQVGPHRVD----------------RARWDWAEVE-RNPFFCPDAGTA-------AL
AROC_DESAL      AYTLELGSVRAK----------------NIDPEAVSK---NPFACPDMEAA-------EK
AROC_SYNAS      AYTIALGGVSIS----------------ESGTTVNRESLANPLCCPDQEAA-------RR
AROC_DESDA      GGCVELGGIAAP----------------LWGLDMD-GAAARPYCAAAPSVV-------SQ
AROC_DESAD      AYTVRIGGIDGE----------------VKAPEK---AHELPFFSADPDVI-------PS
AROC_HERA2      AYTLSLGHLKAQ----------------IIDENE---IENNIMRCPDPAVA-------EQ
AROC_METTH      GHVVQVGDVKA---------------DTVSLKRIGEYAESNPVRCADPRAA-------RQ
AROC_METST      AHVTSIHNIHST--------------KKFTLNTIKENITKNNVRCADLEVA-------TL
AROC_METJA      GYTIKIGKIEGDFSYYKNPEVFE---NEKSLERLIEIIESNPLRCPSMN-E-------KE
AROC_METKA      GHVVRVGSVEAD----------P---GDLSAEEIMQYAESNPVRCADPDAA-------EE
AROC_METAR      AHTVAIGNVRAK---------------PATIEEIKANVWKNPVRCADLSAA-------DA
AROC_METTP      GYVSELGGISASLPRWTSRGS-I---EREELLDIRERAESSPIRCPDAAAS-------SR
AROC_HALMA      AHVCQIGDVEAG---------------PVTFEDMLEHSEENEVRCADPEAA-------EE
AROC_HALMD      AHVCQIGDVVAD---------------DVTWEEMLEHSEDNEVRCGDPDAA-------EE
AROC_BACFR      AYTSQVGPIKL---------------EGNYTDYDLDLIETNPVRCPDPEKA-------KE
AROC_SULMW      AYVSSIGNLNF---------------SENYNKLDLSKIENTPIRCPDIKLS-------EK
AROC_CYTH3      AYVSQVGPLKL---------------TTDYKALNIPNAETNIIRCPDDAVA-------AK
AROC_PORGI      AYTSQIGPVCIP--------------QENAKEYSPEEVESSPIRCPDPNAS-------GL
AROC_DESPS      AWVESVGPIQAS--------------GINPDTISREEVDKQISRCPDQITA-------AE
AROC_SYNJB      AYVQRVKDVEAQ---------------VDPSSVTAEQVEANIVRCPDPQAA-------AA
AROC_LEPBJ      AWVDSIGTIQST--------------IGEKYPKSREEVDQNEVRCPDAVSA-------DQ
AROC_LACP7      TYTKSIGPIQI-----------------DYHKCQKENLTLSPLCMPDLEAS-------QK
AROC_BDEBA      VIGYASQIGP----------MTL---TDAERAEVSKKDIDSFQARFPSSRD-------QE
AROC_TREDE      --AFAIKDGK----------KTI---EVQVRAEEIAGIKTSLPLKEDEALP-------EP
AROC_CHLPN      AYLSSLGSLT-----------LP---HYLKISPELIHKIHTSPFYSPLPN--------EK
AROC_PARUW      AYLYSIGEIEGKI-------ELS---DHVNNVPLLQQTIRNSSLFSPSPAA-------EK
AROC_CAMHC      SGIFSIGSINKG-------GEIS---NAKNLKMDFDYAQTSEIFSLFKEFE-------NE
AROC_HELAH      SGIVKIGGIE-----------------AKNY--DFNHALKSEIFALDKEQE-------EV
AROC_CAMLR      SGVFGVGSID------------S---KLSNDEFDFNCAKNSEVYALDKNLE-------QS
AROC_WOLSU      SGVFQVGEHT-------------------SDVRDFAHARKSVVNALDPLME-------EL
AROC_ZINIC      GYVKQIGKNK--------------------ILFESWDLINFKLNIANIKKK-------NI
AROC_CARRP      SYIKKIGFLK--------------------INFKYWNY-TLNRFFSNLLFI-------NE
AROC_RHOBA      SSICQVGSLKSKQS----LADTL---TIDNIDEIETSLGEAEIASIDHEFA-------NE
AROC_DEHM1      GYTAELGGIVAKL---------------PKTKDIRQNISQSDVNCPDLTATK-------K
AROC_PYRAE      GHIIELGGIEVRR---------------SYTFEEVKSSWAKPLPVVDDEALA-------A
AROC_IGNH4      GYVVELGGVEFPS---------------AEDAEESLRSRLSPFRV--LCCEE-------K
AROC_SULAC      AHLKSLGPVELDE---------------DVSFREIFCSKYSPVRASKKWLEE-------K
AROC_KORCO      AYSLEIGGERAEG---------------FTLDDARNYRYMNPVRAPNEES-------YLR
AROC_PYRAB      AYIKRIGRVEAKQ---------------LTLEEILSSE--NP-FCPDEEA-------FEK
AROC_AERPE      AYVKSIGGVEARVE-------------PRDSEEFRRAIDRDPLKCPDPEA-------SER
AROC_THEVO      SYMKSIGEVT-----------------CDEIRGDP-YNFETRIPDPEKNS---------L
AROC_ACESD      AHVLSIGEVIDENLN-----SMT---GSAQLRDKL-KQMELPVISEEKEI---------F
AROC_ATOPD      AHVLKIKNINDTPFK-----LID---NSVEANKLLALQMNQLLQAAPQELPFLDAQTGEK
AROC_CHIPD      ATLKEVAGLPDA---------------------------EQGLEAA--------------
AROC_HUNT2      AFVTEIHGIKAQE--------------NITYEMAKANYRKNEINCPDLEKA-------KE
AROC_MYCTU      SHVISIGASAP-YEG-PPPRA-----------EDLPAIDASPVRAYDKAAE-------AD
AROC_CORJK      SHVISIGRSEP-YEG-PSPEF-----------SDLEGIDASPVRAFDSAVE-------ES
AROC_KOCRD      SHTTAVAEVAV-PEGAPLPGP-----------QDVPALDADPLRCFDAETS-------AA
AROC_TROW8      SHVKQIGSIKIDYEQGAYPRF-----------CDLEAIDSSPVRCFDKNTS-------EK
AROC_KORVE      SHVIAVGTARLENTEVQWEKL-----------VELAQRDNVLLGCVDPEAE-------QR
AROC_MOOTA      FHVVRIGPVEVREQVDWEA---------------ACRAVESPVYCADPEAG-------RA
AROC_THET2      GYVPGMAGVWAKVPFSWDL---------------VPRIEESPLRMTDPEAE-------AE
AROC_SYMTH      GYVRSIGPVEAQPPAGLDLD------------GIVARAEASPVRCPDPAAS-------AR
AROC_ANAD2      SRVVAIGPREIRPDAPPTP-------------AQRDAIEASDLHVDDEALA-------AE
AROC_CARHZ      SHVLRIGSVEVEYPGGLPE-------------EELKKADEHPLRCLDAQVE-------GR
AROC_RUBXD      SAVYRIGEVAMDRALAAAG---------------AGKADRSEVRCPDPEVS-------ER
AROC_ALKMQ      SHVTAIGSVSLGEPVENIEKIK--------------RAEDSEVRCLDPEVE-------KA
AROC_ALKOO      SHVISIGRAHYVPFVEDLFQYKS-------------QIEASPVRCLNPTIE-------ER
AROC_GEOMG      GFVVELGGIKAERRGLSSDRL-------------RELAAKSELATYDPEAE-------AR
AROC_THEP3      SKVLEIGGVKAE----------------------------------------------EK
AROC_AQUAE      SFVVSIGQKEVEELKDKSYFANPEKLLS-----YHEKAEDSELRIPFPEKD-------EE
AROC_CALBD      NHVVEIGRVRLTKSYSFDDTE------L-----FEQALSSSDLFCIDKEAE-------MK
AROC_SYNWW      SQVKSIGPVQVKTWQVNEQNWQD----------LREKVDESPLHSVDTEKE-------PL
AROC_UNCTG      SYTSQIGDVTADISSVEECKIWH-------------DAEISCVRCPDAKAS-------EK
AROC_CHLP8      SYISTIGPVSEASAPAALPE---LLDAG--AESLAAEADKSPVRMIDPATS-------EA
AROC_CHLT3      SYVSAIGQAFETEPNHHAVK---ILEKG--AETLMHEADESPVRMLNKDLE-------KQ
AROC_SALRD      SHVVRIGDVGFDEPEEWADRRNALIEEGGGASALYETADESATRMIDDGMT-------ER
AROC_GLOVI      SHVVEIGGVGAGESVRPALPTFEEWK------DLFERVDQNDLRC-HPDLY-------ER
AROC_STRPN      NHVVVFGGKE-IDVP--ENLTVA---------EIKQRAAQSEVSIVNQERE-------QE
AROC_LACLM      NHVVNFGGRE-ISSP--EHLSVQ---------EIRETAGRSDLSIFDESQA-------ED
AROC_LYSSC      AHVTEIVGIK-ADTSLVEGKTVD---------EIRAIVEADPCYCVDPVAS-------AK
AROC_EXISA      SYVKVIGGER-AESR--TFDSLQ---------EAQAVVDASPVRTLDEAAA-------LR
AROC_LACPL      GYVQQIGPKQ---VTADLTLSVD---------QLQAQIAQNDLRLPDAALV-------PE
AROC_LEUCK      GFVVNVGPAKSDLSTLTQYQDLE---------ALRQVTESFETRALDAAAD-------KA
AROC_DESHD      GQVLSVGKVH------MDSEDTP---------EYWQRVQASEWKVGDPKGE-------EA
AROC_THEMA      GFVTRLGNVEARDIPGDFEELK-------------RRRDESVVFCPDPEAT-------KE
AROC_THESQ      GFVTRLGNVEAKNIPDNFEELR-------------RKRDESAVFCPDPEAT-------EG
AROC_CLOTE      SKVYSIGNLFDEKVDLFDQCKY-------------KKIDNSLLRCYNEEVE-------KS
                                                                            

AROC_ECOLI      LDELMRALKKEGDSIGAKVTVVASGV------PAGLGEPV--FDRLDADIAHALMSINAV
AROC_BLOFL      LDLFIRNLKKLGNSVGAKVTIIAENL------PIGLGEPV--FDRLDADLAHALMSINAV
AROC_NITMU      LEEFMDKLRKSGDSVGARIRVVAEGV------PVGWGEPV--YDRLDAEIAYGMMSINAV
AROC_DICNV      IAQYLEDIQRRGNSVGTEITVVAEQV------PAGLGEPV--FDRLDADIAKALMSINAV
AROC_RHOCS      WADYLDGVRKAGSSIGAVVEVVASGV------PAGWGEPI--YDKLDGDLARAMMTINAV
AROC_DESAL      MEARVNEVRKDGDSLGGIVQVQAAGV------PAGLGEPV--FDKLDAQIAKAMMSIGAV
AROC_SYNAS      MTGRLEEARNAGDSLGGIVGIVVRGC------PAGLGEPV--FDKMDAQLAGALMSIGTV
AROC_DESDA      WDALVAEARKAGETLGGIVRIEAHNV------PAGLGEPV--FDKLDAVLAHAVMSVGAV
AROC_DESAD      WEERIKEVRSQGDTLGGVVEVCIKGV------PAGLGEPV--FDKLDARLAYALMSVGAV
AROC_HERA2      MIAYVDQARRDLDSLGGVVEVRARGV------PAGLGEPV--FDKLDALIGHAMFSIPAV
AROC_METTH      MEKVILDARSRGDSVGGVVEVVVLGA------PPGLGDPV--FSKLDADMARALMGIGSV
AROC_METST      MEDEILKLKERGDSTGGKVEIIIDNV------PVGLGQPV--FDKIDGDFAKALMNIGAV
AROC_METJA      MEEYVLKAMENKDSVGGVVEIVALNV------PVGVGNPI--FNKLNGELARALMSINAV
AROC_METKA      MLGEIERARENGDSVGGTIEVIAENV------PPGLGDPV--FGRLDGELAGALMNIPAV
AROC_METAR      MLREVSAAREASDSVGGIVEIVATGV------PAGVGTPA--FDKLDACLAYALMGIGGV
AROC_METTP      MLSLLDSVRSDGDSIGGVVEVIAIGV------PPGLGEPV--FDKLDADLAKALMSIGAV
AROC_HALMA      MRDVADQHQKEGDSIGGAIYFECRGV------PSGLGAPR--FDSFPSRLGQAMYSIPAV
AROC_HALMD      MRDLADEYQKEGDSIGGAIYFECRGV------PRGLGAPR--FDSIPARLGQAMYSIPAV
AROC_BACFR      MQDLIYKIKGEGDTIGGVLTCVIKGC------PIGLGQPV--YGKLHAALGNAMLSINAA
AROC_SULMW      MIYYINNIRKKGDTIGGIITCNIKNV------PIGIGEPV--FDKLHAELGKAMLSINAV
AROC_CYTH3      MIEFIDETRKNKDTIGGVVSCVIEGV------PVGLGEPV--FDKLHAELGKAMLSINAV
AROC_PORGI      MEAVIETAKKESDSVGGIVDCQISDV------PVGWGEPL--YGKLHAALGAAMLSINAA
AROC_DESPS      MEKFITELKERGDSTGGIVTCCIRNS------PVGLGEPI--YEKLEAKLAQAMLAIPAS
AROC_SYNJB      MIQKIEEAAREGDSLGGVVECVARRV------PRGLGSPV--FDKLEADLAKAVMSLPAS
AROC_LEPBJ      MRSLILKMKEAGDSVGGTIKCVSYNL------PPGLGDPV--YDKLDGDLAKAILSIPAC
AROC_LACP7      AEDYLEQCIHNLDSSGGMIECIISGV------PAGIGEPV--FDKLDAQLAKAIFSIGAV
AROC_BDEBA      VADLLKKAQDNGESHGGVAEILIQNP------PAHLGQPV--FHKLKSDLAMAFLSVGAT
AROC_TREDE      IFEKLSALASNGDSAGCILSCSVLNV------SEGLGSPV--FGKLDAVLSQALMSIGAV
AROC_CHLPN      IQEILTSLHDDSDSLGGVISFITSPI------HDFLGEPL--FGKVHALLASALMSIPAA
AROC_PARUW      MKGVLEEARKEGDSVGGIVEAMAFNV------PCGWGDPV--YEKLEANLAKAMLSIPAS
AROC_CAMHC      MKNEILNAKNAHDSVGGNVVTRVKNV------PAGLGEVL--YDKIDAKIAYALMGINGV
AROC_HELAH      QKTAIRNAIKNHDSIGGVALIRARSLKRNQKLPIGLGQGL--YAKLDARIAEAMMGFNGV
AROC_CAMLR      FKDEILKAKKAKDSIGARVFTRVKNP------IKGLGEPL--YDKLDSKLAHAIMGVNAV
AROC_WOLSU      FKEEIEKARGAHDSIGGAIEVRAKGM------PIGLGEPL--YHKLDGALGGALMGLNAV
AROC_ZINIC      IKKYIKYINKIGDSCGANINLIIKNL------PIGIGNPI--FDKLNSRISYYLMNINAI
AROC_CARRP      IKDIINNCKNSCNSLSSEIVIIINGL------EPSLGDPL--YKKINSTISNYLLSINAT
AROC_RHOBA      AGELIKETRKRGNSLGAAVEVVAVGV------PPLLGQPL--YQSLKVRLMGALGGLNAV
AROC_DEHM1      MLALIQQAAEEGDSLGGVVECLGLNL------PVGLGEPV--FDTLEGELAKAMFAIPAV
AROC_PYRAE      MLETLRKNAAEGDSVGGGVEIWAVGV------PPGLGEPH--FGKIKAELAMAAFSIPAV
AROC_IGNH4      AEEVLKEALERRDSVGGVVEAVAWNA------PAGLGEPV--FDKLKADLAKAMMSIPAS
AROC_SULAC      YEELIKQATVEGDSWGGVAEVIADNV------PIGLGEPV--FDKLKSDLAKALLSIPAV
AROC_KORCO      MAAAIERARREGDSLGGIVEAIALNV------PPGLGEPI--FDTIEGDIAKAMFSIPAV
AROC_PYRAB      MVEEIELARREGDSVGGIVEVVAVNV------PPGLGGPY--EEDIEADLASAFFRIPAV
AROC_AERPE      MRRLVEEARREGDSLGSVVEAVAFNV------PPGLGDPP--LGGVDALLARAVMAIPAA
AROC_THEVO      ATSLLVDIMKSGDSIGGRIDTIVEGL------PPGVGEPF--FNSVESEISRAMFSIPAV
AROC_ACESD      MRNLIQDAKSNHDSIGGVVECAVTGV------PAGIGNPF--FDSVESRLSHMLFSIPAV
AROC_ATOPD      TRALLTQLRSEKNTVGGIIECVATGV------PAGIGCPH--FQGLENTISAAVFGVPAV
AROC_CHIPD      --------IAAKDSVGGIVECVVEGL------PIGLGEPF--FDSVESTIAHAVFSIPAI
AROC_HUNT2      MIEELKRIKEEGDSVGGVVEIIARGV------PAGLGEPV--FDKLQATLAHALMSIGAI
AROC_MYCTU      MIAQIEAAKKDGDTLGGVVEAVALG------LPVGLGSFTSGDHRLDSQLAAAVMGIQAI
AROC_CORJK      MIDEIKAAKKSGDTLGGIVEVVVKG------LPIGLGSHVSGDERLDAQLAAALMGIQAI
AROC_KOCRD      MVAAVDAAHKAGETLGGVVEVLAEG------MPPGLGSYVHWDRRLDSRLAGALMGIQAI
AROC_TROW8      MKDELHRIKRCGDTLGGVFEVLAYG------LPPGLGSYVHWDRRLDAMLSAAIMSIQAV
AROC_KORVE      MKEQVDQVLRTGDTVGGVFEVVAHN------LPPGLGTYVEWDRRLDGLLAMAVMSLQAV
AROC_MOOTA      MVAAIEEARQQGDTLGGVVEVLARG------VPAGLGSHVHWDRRLDGRLAQALMSIPAI
AROC_THET2      AIRRIDQAKAEGDTLGGIIEARFRG------LVPGLGSHVHWDRKLDGRLAQMALSIPAV
AROC_SYMTH      MVEEIDAAKRDGDSLGGVVEVVAAG------LPPGLGSHVHWDRKLDGALGAALLSIQAA
AROC_ANAD2      WRALIDAEKARGGSIGGAFDVYATG------LPIGVGSHVHPDRRLDARLAGALCGVQAI
AROC_CARHZ      MLKWVDRARENGDTLGGIFEVVVFG------LPPGLGSYVHWDRKLDGRLAGALMAIPSA
AROC_RUBXD      MKAEIDAARHARDALGGEFVVVAEG------CPPGLGSYADWRDRLDARLAAAVVSINAI
AROC_ALKMQ      MIEEIKRAKEEGDSLGGIFEIHVTG------VPRGLGSYVQWDHKLDAKLAHALMSIQAI
AROC_ALKOO      MMGEIQRAKETGDSLGGVFEVIVRN------VPIGIGSYAHFDRKLDGILAQGLMSLQAI
AROC_GEOMG      MKAFIDSVKDAGDTAGGVVEVVVTG------APVGLGSHVQWDRKLDARLAMAVMSIQAI
AROC_THEP3      WRRTIDEAKSKGDTLGGIIEIVIEG------VPVGLGSHVQWDRKLDALLAYHVMSVQAI
AROC_AQUAE      FKTYIDEVKEKGESLGGVFEVFALN------VPPGLGSHIQWDRRIDGRIAQAMMSIQAI
AROC_CALBD      MKEEIDIAKQIGDSVGGIAEVICKN------VPYGIGSHVHWDRKLDAQIAHSVMSIQSV
AROC_SYNWW      MREAIDQARSKGESLGGSFEVGVIG------VPPGLGSYISWESRLDSQICALLMSIPAI
AROC_UNCTG      MIQLIKKAGEKGDTLGGKVVVVTKN------VPAGLGSHTQWDLKLDGRLAQSLISIQAV
AROC_CHLP8      AIAAIDQAKADGDTLGGIVEVYITG------VPMGLGSYVQHDRRLDSALAAAIMSIQAI
AROC_CHLT3      AMELIDTAKKAGDTLGGIVEVFVTG------LPIGLGSYVQYDRRLGADLGAAILSIQAV
AROC_SALRD      CVEHIDQTKKDRDSLGGVYEVVVTG------VPPGLGSYVHWDRRLDGQLVQAICSIQAQ
AROC_GLOVI      LRSRVVEAAKGGYTLGGAVELAAYGE-----IPVGLGSHVHYDRRIDGLLAGAAMSVHTV
AROC_STRPN      IKDYIDQIKRDGDTIGGVVETVVGG------VPVGLGSYVQWDRKLDARLAQAVVSINAF
AROC_LACLM      LRTYIDQIKKAGDTIGGIIETRVEG------VPAGLGSYVQYDRKLDAKIAGAVVSINAF
AROC_LYSSC      MVDAIDEAKKAGDSIGGVVEVIVEG------MPAGIGSYVHYDRKLDAKLAAAMLSINAF
AROC_EXISA      MMRRIDEAKANGDSIGGIVCTEVHG------VVPGLGSYVQYDRKLDAKIAQAVMSVNAF
AROC_LACPL      IHELITATKKAGDTLGGVIRVVAEN------VPAGLGSYTNWDTKLDGQLAAAVMGVNAM
AROC_LEUCK      IRDVIDSTKRDANTVGGQVQVMATG------VPVGLGSYISADDKLDAKIARAIVGINAF
AROC_DESHD      LDAQLQEARSQGESLGGVLQIQVRN------LLPGLGSYVQWDRKLDGRLAQAVLSVQAI
AROC_THEMA      MVAEIDRAKEEGNTLGGKVKVIARG------VPAGIGSYSDLFKKLDSKIGSLFFAIPAV
AROC_THESQ      MISEIDRAKEEGNTLGGKVKVIARG------VPAGIGSYSDLFKKLDSKIGSLFFAIPAV
AROC_CLOTE      FVKKIDICREQGETIGGTVFLSVRG------VPIGLGSYSQWDRKLDALLSYAIMSLQGV
                             : .                    *        .   :      .   

AROC_ECOLI      KGVEIGDGFDVVALRGSQNRDE--ITKDG-------------------FQSNHAGGILGG
AROC_BLOFL      KGIEIGDGFSAITKLGSEYRDE--ITSQG-------------------FQSNHSGGILGG
AROC_NITMU      KGVEIGAGFASVSQKGTEHSDE--ISPGG-------------------FLSNNAGGILGG
AROC_DICNV      KAVAIGDGFTSANQYGSMFRDER-TARDG-------------------FLSNHAGGILGG
AROC_RHOCS      KGVEIGAGFAAAELSGEENADEMRAGPDGQ----------------PLFLSNRAGGILGG
AROC_DESAL      KGVEIGAGFEAARLTGSVNNDPILE-DG--------------------FETNNAGGTLSG
AROC_SYNAS      KGVEIGAGFAVAGMKGSESNDPLSP-GG--------------------FLANASGGILAG
AROC_DESDA      KGVEVGEGFAAAALRGSQNNDPLLPADAPEP-------------GRARFASNHAGGILGG
AROC_DESAD      KGVEIGAGCKAADALGSENND-FMDGDG--------------------FCSNNAGGVLGG
AROC_HERA2      KAVEIGSGIEAGNARGSQNNDPFIQRAD----------------GSIGTSSNHAGGILGG
AROC_METTH      KGVEIGMGFEVAEHRASEINDEFYLDDDG----------------KVRTTTNTSGGILGG
AROC_METST      KAVEVGCGIESSTLTGHEMNDEYYIEDN-----------------KIQTKTNNAGGIVGG
AROC_METJA      KGVEIGAGFKAAEMYGSEMNDEMYFDDDK----------------NIRFKTNNCGGILGG
AROC_METKA      KAVEVGSGVRCSEMHGSEHNDPIWWDGHP----------------VVDG--DNSGGVLGG
AROC_METAR      KAVEIGAGIASAGMRGSEMNDEFCTEDG-----------------KVRTKTNRCGGILGG
AROC_METTP      KAVEIGAGFESARLRGSEMNDPLFYENG-----------------RISFERNNAGGILGG
AROC_HALMA      NDFEYGIGREARTTKGSEYTENWEFDED----------------GHPTPVGNDHGGIQGG
AROC_HALMD      TDFELGIGRDARTATGTDYTEDWEFGESEATASENASGDEPRARGDPKPVGNDHGGIQGG
AROC_BACFR      KAFEYGDGFKGLKQKGSEQNDVFYNN-NG----------------RIETRTNHSGGIQGG
AROC_SULMW      KVFEYGSGFVGTKIKGSNHNDIFTNN-E-------------------TTKTNFSGGIQGG
AROC_CYTH3      KGFEYGSGFEGVEQFGSQHNDKFYAD-EQG---------------NVRTQTNNSGGIQGG
AROC_PORGI      KGFEVGDGFALASMRGSEANDQMVAA-EDG---------------GISFLSNHSGGISGG
AROC_DESPS      KGFEIGSGFAGSRQLGSEHNDLFIWK--DN---------------RLGTSTNNSGGIQGG
AROC_SYNJB      KGFEIGSGFAGTYLTGKQHNDEFYMT--PG---------------GWRTRSNRSGGIQGG
AROC_LEPBJ      KGFEVGSGFSGTLLTGSSHNDEFYVEGGTG---------------KVRTKTNNSGGLQGG
AROC_LACP7      KGFEIGSGFEVAKQLGSENNDGFAFD-ANG---------------KLIKLTNHSGGILGG
AROC_BDEBA      NGFELGLGFEAAEVKGTQFHQ---------------------------GPQDAYGGIRGG
AROC_TREDE      KGIEIGGGFYSASITGSENND---------------------------ISKNFSGGILGG
AROC_CHLPN      KGFEIGKGFASAQMRGSQYTDPFVMEGENI-----------------TLKSNNCGGTLGG
AROC_PARUW      KGFEIGEGFKASQMRGTEHNDLFGIQNDQI-----------------SFVTNHAGGTLGG
AROC_CAMHC      KAVEIGAGVKASEMIGSENNDEILPFGK--------------------FKTNHSGGILGG
AROC_HELAH      KAVEIGKGIESSLLKGSEYNDLMNQKG---------------------FLSNRSGGILGG
AROC_CAMLR      KAIEIGSGIQSSYMYGSQNNDEL-KDGV--------------------FLSNHSGGILGG
AROC_WOLSU      KAVEIGEGLSAARLKGSENNDPLRLEG---------------------FKSNHAGGILGG
AROC_ZINIC      KAINIGNGIKGIKYKGSKFNDIITKKG---------------------FKTNNSGGILGG
AROC_CARRP      KSICFGFNFKNKNS--FQVKDEIKNSG---------------------FTSNNNGGILAG
AROC_RHOBA      QSCEIGSGVDVIPRTGSENNDPIRSSG---------------------YQSNTHGGLLGG
AROC_DEHM1      KGVEFGAGFEASRLRGSKNNDPFSI-QANHIRTT----------------SNKCGGVLGG
AROC_PYRAE      VALDWGAGRALAKMRGSEANDPIII-KSGRPALE----------------SNKIGGVLGG
AROC_IGNH4      VGFEVGWGFKLARLRGSEARDKIVS-SAGEATVE----------------GDKAGGMLGG
AROC_SULAC      VGFEYGLGFKASKMKGSEANDEIVIKDNGKLGWR----------------YNKAGGILGG
AROC_KORCO      KGVEFGSGFRAARMRGSEHNDPIRVIDGKIRYK-----------------KNDHGGAIGG
AROC_PYRAB      KGVEFGLGFKVAEKRGSEVNDPYVIRDGKVVTK-----------------TNNHGGVLGG
AROC_AERPE      KAVEFGEGFALAFMRGSEAHDSPRAVGGRIVHE-----------------TNRSGGIVGG
AROC_THEVO      KAIEFGDGFTLSKMKGSEANDPFTVLDGHILTK-----------------TNHNGGILGG
AROC_ACESD      KGIEFGDGFEMSKARASMVNDQMSIIDGEVTHK-----------------SNHNGGILGG
AROC_ATOPD      KAIEFGSGMNVANLLGSENNDAYEVRDGSVVPT-----------------TNHAGGILGG
AROC_CHIPD      KGIEFGAGFAAARMKGVEHNDA--ILDASGKTA-----------------TNHAGGVVGG
AROC_HUNT2      KGIEFGEGFGHTKLKGSESNDVPYYDEASGRVR---------------FKTNRAGGILGG
AROC_MYCTU      KGVEIGDGFQTARRRGSRAHDEMYPGPDG-----------------VVRSTNRAGGLEGG
AROC_CORJK      KGVEIGDGFEEARRRGSEAHDEMEAAANGG----------------VHRLSNRAGGLEGG
AROC_KOCRD      KGVEVGDGFRTAQRPGSLAHDETL-RADGS----------------VHRVSNRAGGIEGG
AROC_TROW8      KAVEIGDGLAISALPGSEAHDQIV-LESGL----------------LTRMSNHSGGVEGG
AROC_KORVE      KAVEIGEGVSVAATFGSGAQDEIGYEREHES-----------KFTGFTRTSNHAGGIEGG
AROC_MOOTA      KGVEIGAGFRVAALPGSRAHDAIAYRKGQG----------------FYHPTNRAGGLEGG
AROC_THET2      KGVEIGPAFENAMKRGSEVHDAIYWSPERG----------------FYRETNRAGGLEGG
AROC_SYMTH      KGVEIGDGFLGARRRGSEVHDEIGWSPDRG----------------YFRYTNRAGGLEGG
AROC_ANAD2      RAVEIGDGTQVG-RPGYEFHDAIHHDPARG----------------FWRDTNRAGGLEGG
AROC_CARHZ      KGVEIGDGIALANIPGRMAVDEIYYENGH-----------------FYRKTNKAGGLEGG
AROC_RUBXD      KGVEIGDAFEAARRRSSEVQDEIVR-RGGA----------------LGRASNRLGGLEGG
AROC_ALKMQ      KGVEVGCGFDQAQKKGSQVHDEIFFS----------------QEKDYYRKTNYAGGIEGG
AROC_ALKOO      KAVEIGNGIEGSSKMGSQFHDEIKYS----------------EAKGYYHDTNRAGGIEAG
AROC_GEOMG      KGVEIGLGFETARRPGSQVHDEIYFDSSRIAHG---------EATGFFRKTNNAGGIEGG
AROC_THEP3      KAVEIGLGFEAARKPGSLVHDEIYYD----------------EERGFYRKTNNAGGIEGG
AROC_AQUAE      KGVEIGLGFEAARRFGSQVHDEIGWS----------------EGKGYFRHSNNLGGTEGG
AROC_CALBD      KGVEIGMGFEAARRFGSEVHDEIYYD----------------DKKGFYRKTNNAGGIEGG
AROC_SYNWW      KAAEIGEGIANSAEPGSRVHDEIFYS----------------EEGGLHRKSNRAGGIEGG
AROC_UNCTG      KAVEFGAGTKLASLLGALSHDEIFYD----------------VTRGFYRDTNRAGGIEGG
AROC_CHLP8      KGVEIGPAFDNARKPGSEVHDELFAGGE----------------KGLRRKTNRAGGIEGS
AROC_CHLT3      KGFEIGHAFKNAVSFGSEVHDEFYLDKN----------------GNPQRKTNRAGGLEGG
AROC_SALRD      KAAEVGDGFFNAHRPGSQVHDPIEPREDG--------------AQAYPRRTNHAGGTEGG
AROC_GLOVI      KAVEVGIGTAAARETGADVQDEFINAAGE-----------------IARTSNHAGGIEGG
AROC_STRPN      KGVEFGLGFEAGYRKGSQVMDEILWSKED----------------GYTRRTNNLGGFEGG
AROC_LACLM      KGVEFGLGFEAGKRPGSQVMDEIIWSENK----------------GYTRSSNQLGGFEGG
AROC_LYSSC      KGVEFGLGFEMARRKGSEVHDEIIWTEEE----------------GYTRATNRLGGLEGG
AROC_EXISA      KGVEFGEGFEMAYRPGSEVMDPIAYGDN-----------------GYTRLSNHLGGFEGG
AROC_LACPL      KGVEIGDGFAAASHYGSQVMDEISWDEHA----------------GWSRLTNHLGGFEGG
AROC_LEUCK      KGVQFGGGFDNAEKYGDQVMDEIFWRPEK----------------GFYRGSDNLGGFEGG
AROC_DESHD      KGVAFGMGFTAGQHFGSEVHDPIGYDSGR----------------GYYRYSNNAGGIEGG
AROC_THEMA      KGVVIGS---EEMWYGFDYLDEFELEDGK-----------------IKRKTNNLGGIEGG
AROC_THESQ      KGVVIGS---EEMWYGFDYLDEFELEDGR-----------------IKRRTNNLGGIEGG
AROC_CLOTE      KAIEFGNG-MNLNLRGSTFNDEILYEKGK-----------------FKRPTNNCGGIESG
                     *              :                              :  **  ..

AROC_ECOLI      ISSGQQ------------------IIAHMALKPTSSITVPGRTINRF--GEEVEMITKGR
AROC_BLOFL      ISTGQP------------------IIMHIAIKPTSSIKIPGKTVTNH--NQETQIITTGR
AROC_NITMU      ISTGQD------------------IVVNIAVKPTSSIRLPRRSVDKM--GNPAIVETHGR
AROC_DICNV      ISSGQT------------------IVASAVFKPTSSIPIPAKSVDQN--GDDCIISVRGR
AROC_RHOCS      ISTGQD------------------IVVRFAVKPTSSILTPRRTIDTA--GHETEIVTKGR
AROC_DESAL      VSSGQD------------------IVVRVAVKPIPSISVPQQTIGLD--GKADTIQVGGR
AROC_SYNAS      ITNGEQ------------------INMRVACKPIPSISRSQKTVDRE--GNPVTLSIGGR
AROC_DESDA      ISSGQD------------------IVLRVAVKPIASIAVTQKTVDRQ--GQPVDILIGGR
AROC_DESAD      ISSGQD------------------VVVRAYVKPIPSISKPQQTVDRD--GNATEIKIGGR
AROC_HERA2      ISSSEE------------------IVVRLTAKPPASIAQEQTTVDQA--GEPATIVVKGR
AROC_METTH      ISSGMP------------------ITARIAVKPTPSISVPQKTVDLER-MEETTIEVRGR
AROC_METST      MTNGMP------------------IILKISVKPTPSVSGIQNTVNLEK-RENSTIEIEGR
AROC_METJA      ISCGTP------------------IVLRIAVKPTPSIGKKQKTINLKT-LENVEIEIEGR
AROC_METKA      ISHGGR------------------LVVRVHVKPTPSVSVPQRTVDLES-EEEVEIEVEGR
AROC_METAR      ISTGMP------------------IVCRAAIKPTPSISRPQRTVNLET-GAETIIEITGR
AROC_METTP      ISTGAP------------------ILCRMAVKPTPSIARSQRTVDMVS-GESVDISVRGR
AROC_HALMA      ITTGQP------------------IYGEVSWHAPVSIPKTQETVDWET-GEGKEITVTGR
AROC_HALMD      ITTGDP------------------IYGEVTWHAPVSFPKTQETVDWET-GERKEITVTGR
AROC_BACFR      ISNGQD------------------IFFRVAFKPVATVLMEQETVNID--GIDTTLKARGR
AROC_SULMW      LSNGMD------------------IYFNVGFKPVATIMNKQKSIDIN--FFKNQILVKGR
AROC_CYTH3      ISNGED------------------IYFRVAFKPVATIMIDQESINDK--GETVTVSGKGR
AROC_PORGI      ISTGQD------------------IRFRVAFKPTPTIGQKQQTVNEQ--GESISLSAVGR
AROC_DESPS      ISNGEP------------------ILFRVAFKPTATISLPQETATFT--GKTETMQAKGR
AROC_SYNJB      ISNGED------------------IVLRVAFKPTATIRQPQNTVTLN--GQETVLAARGR
AROC_LEPBJ      ISNGEE------------------LVIRAAFKPTSTIFKKQNTINLK--GEETTLEAKGR
AROC_LACP7      ISDGSE------------------IIFRAAIKPTPSIKKEQQTVNKS--GENINVSIKGR
AROC_BDEBA      ISTGES------------------ILLRVSFKPTSSI----LDVAKKG-----------R
AROC_TREDE      ISCNMDYPLNLNHENGRKDENTCQIDFRIAVKPVPSIKMNQASFNKKGEKC--MLSVGGN
AROC_CHLPN      ITIGVP------------------IEGRIAFKPTSSIKRPCATVTKTKKETTYRTPQTGR
AROC_PARUW      ISTGEP------------------IIIKVPFKPTSSINKVQTSLNEKGEICDYRLPTGSR
AROC_CAMHC      ITNGDE------------------IIVKSHFKPTPSIFLAQNTIDESG-AVKTL-SLKGR
AROC_HELAH      MSNGEE------------------IIVKIHFKPTPSIFQSQQTIDIKG-NECEC-LLKGR
AROC_CAMLR      ISNGGF------------------IDIKTYFKPTPSIFLPQQTQNIQG-ENIIR-ELKGR
AROC_WOLSU      ISNGSE------------------LVARVYFKPTPSIFLPQETLNEEG-DEVIC-ALKGR
AROC_ZINIC      ISTGQD------------------IKISIFIKPTSSIKIPQKSINKFN-KKVKF-IIKGR
AROC_CARRP      ITNGQP------------------LVIKILFKPTSSTSRKIKTINEKL-KNITN-KTYGR
AROC_RHOBA      ITTGSP------------------LVARVGFKPTSTINLPQDSVNKRL-DEIEFELAKGR
AROC_DEHM1      ISDGMP------------------LQFRVAVKPTPSISLSQPTVNIDT-MTNTSLEIRGR
AROC_PYRAE      ITVGEP------------------IYFRVWFKPTPSVRKPQRTVDLAK-MEPAVLEFKGR
AROC_IGNH4      ISVGAP------------------IRIRVAFKPTSSIMIPEKTVNIHT-LEETEVEVPGR
AROC_SULAC      LSNGEK------------------LVLRCAFKPTSSIRKPQKTVDLRT-SEESTIRVIGR
AROC_KORCO      ITTGEP------------------IILRVAFKPTPSIAKPQETVDLEL-LRNVEIKVKGR
AROC_PYRAB      ITTGMP------------------IIARIAFKPTPSIYLPQRTVDLRE-MKEVEIKLRGR
AROC_AERPE      LTNGMP------------------IVFRVAFKPPSSIPKPRRTVDLRS-LGEAWVSGKGR
AROC_THEVO      MTTGMP------------------VKFSIAVKPTPSIHKKQDTINLIS-KEKSEITVKGR
AROC_ACESD      ITNAMP------------------IIFKTAIKPTPSIAMSQNTVDINN-SSDAIIEIKGR
AROC_ATOPD      ISTGAP------------------IWFRCALKPISSIGLSQHSVNLQT-MESEQLVVQGR
AROC_CHIPD      ITNGNP------------------LVFRVAVKPTSSTPKEQHTLNIKS-GEVENFSVKGR
AROC_HUNT2      ISNGED------------------IRIRVAVKPTPTISIPQKTVNMYT-LENVEVEFNTR
AROC_MYCTU      MTNGQP------------------LRVRAAMKPISTVPRALATVDLAT--GDEAVAIHQR
AROC_CORJK      MTNGEE------------------LRVRAAMKPISTVPRALKTVDMAT--GEAATGIHQR
AROC_KOCRD      MSTGDL------------------LRVRAAMKPIATVPRSLHTVDVAT--GEPARAHHQR
AROC_TROW8      VTTGSA------------------LRISGSMKPISTVPRALKTVDIST--RQPANADHQR
AROC_KORVE      VSNGQD------------------ILVRGYLKPISTLRRPLGSVDFAT--REPLKAAYER
AROC_MOOTA      LTNGET------------------LVLRAAMKPIPTLMHPLPSVDLVT--KQPATASIER
AROC_THET2      MTTGEE------------------LVVRAALKPIATLMKPLPTVDVVT--HEPKDAARER
AROC_SYMTH      MTNGMD------------------LVVRVAFKPIATLYKPLRSVEIDT--HVEAAAGIER
AROC_ANAD2      MTDGMP------------------LRVRAYMKPIPTMLHPLATVDLAT--RAATQARYER
AROC_CARHZ      VTNGMP------------------LIAKVSLKPIPTQVKPLKSVDIVT--KETKPAQVER
AROC_RUBXD      MTNGEP------------------VVVAAAMKPISTIARALRTVDLST--GEEARAFRER
AROC_ALKMQ      MSNGEN------------------IHLRCAMKPIPTLYKPLRTVDIET--KEAVLATVER
AROC_ALKOO      VSNGED------------------ILIRGYMKPIPTLMKPLKTVDMGT--KEVKEAIIER
AROC_GEOMG      ITNGEE------------------IVIRAAMKPIPTLYKPLSSVDMLT--KEPFEATVER
AROC_THEP3      ISNGSP------------------IVIKAAMKPIPTLLKPLTSIDINT--KEEVKAAYER
AROC_AQUAE      ITNGMP------------------IVVRVAMKPIPTLKNPLRSVDIET--KEEMKAGKER
AROC_CALBD      ISNGMD------------------IVVRAAFKPIPTLYKPLKSVDIRT--FQPAEAAVER
AROC_SYNWW      ISNGET------------------VWARAYMKPIPTLYKPLTSVNTKL--WQEEKADIER
AROC_UNCTG      MSNGEP------------------IVVTCTMKAIPSLANPLHSVNLAT--KETAEAEAIR
AROC_CHLP8      MSSGQP------------------IHIRAAMKPISSLVSPLRSFDLAT--LEAVQSRFER
AROC_CHLT3      MTNGET------------------LHLRVAMKPIATLMSPLSSFDFKT--MSPAASHIER
AROC_SALRD      TTTGMP------------------LVVRGYMKPIPTLIKPLDSVDTAT--GEPEPTRYER
AROC_GLOVI      MTNGQP------------------VLLRAYLKPLPTMRKALRSIDLVS--REPFEAHYER
AROC_STRPN      MTNGQP------------------IVVRGVMKPIPTLYKPLMSVDIET--HEPYKATVER
AROC_LACLM      MTNGEQ------------------LIVRGVMKPIPTLYKPLMSIDTES--HEPYKASVER
AROC_LYSSC      MSTGMP------------------IVVRGVMKPIPTLYKPLQSVDIET--KEPFKASVER
AROC_EXISA      MTTGMP------------------ILCSAVMKPIPTLYKPLQSVDIDT--KEAFLAQIER
AROC_LACPL      MTNGMP------------------IVVKAAMKPIPTLYKPLQSVDIAT--KVSQKASVER
AROC_LEUCK      MTTGEA------------------IVVRGVVKPIPTLYRPMQSVDIDT--HQDHRASIER
AROC_DESHD      MTNGEP------------------VIIEAVMKPIPTLYSPLSTVNLET--KEVMEASVER
AROC_THEMA      ITNGED------------------VWVNVSVKPIPTTGKPLKSVDLRT--MEPAKTPYVR
AROC_THESQ      ITNGED------------------VWVNVFVKPIPTTGKPLNSVDLRT--MEPAKTPYVR
AROC_CLOTE      VSNGEN------------------IEMKVYIKPIPSIKKNIRTVNLRN--RKETTTRYER
                 :                      :      :.  :                       .

AROC_ECOLI      HDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIPRW------------------
AROC_BLOFL      HDPCIGIRIIPIAEAMVAIILMDHILRFRAQCGDRKII----------------------
AROC_NITMU      HDPCVGIRATPIAEAMLALVLMDHALRNRAQNADVACTTPKIPGHTGPREGQEEGPSDSE
AROC_DICNV      HDPCVGLRAVPIVEAMVSLTLCDHLLRQRGQNGQR-------------------------
AROC_RHOCS      HDPCVGIRAVPVGEAMMACVLADHFLRHRALVGAPGPVGNGGPVEDGDPVGG--------
AROC_DESAL      HDISAIPRVNVVCEAMLNLVLADFVLRQAQVRALELFAKQ--------------------
AROC_SYNAS      HDVCVIPRIIPVCEAMVQIVLADFLLRQKAVTL---------------------------
AROC_DESDA      HDLSAIPRIVPVLEAMTALALADALLLQQRMGLGL-------------------------
AROC_DESAD      HDICAIPRIVPVLKSMAMLTVADFILLQRRMG----------------------------
AROC_HERA2      HDPTVLPRLVPVAEAMLALVLVDCVLQQRAARL---------------------------
AROC_METTH      HDPCICPRVVPVAEAAVAIVLADHMIRAGFIHPTYIGNE---------------------
AROC_METST      HDPCICPRITTVAEAVCNMVLADHMIRAGYIHPDKIN-----------------------
AROC_METJA      HDPVIVPRIVPVAEAMVAITLADLMIKGGFIHPCSL------------------------
AROC_METKA      HDPCICPRAVPVAESVVAIVLADAVLRAGYVNPDSVELPAASVEDRWRTLKRHL------
AROC_METAR      HDPSIVPRAVPVAEAMVALVIVDQMISGGLINPVSAGAVDASRNR---------------
AROC_METTP      HDPSIPPRIVPVAEAMVALVLADHILRQRSARLR--------------------------
AROC_HALMA      HDPVLPPRAVPVVEAMLACTVLDFMLLGGRINPDRLDGRPGEYDTDYHPSSPQNDPEDAD
AROC_HALMD      HDPVLPPRAVPVVEAMLYCTVLDFMLLGGRINPDRLDDRPGEYDTDYHPSSPRNDPEDAD
AROC_BACFR      HDPCVLPRAVPIVEAMAAMTILDYYLLDRMTQL---------------------------
AROC_SULMW      HDPCVLPRAVPIVEAMSALVLYDNMLNNRVYKI---------------------------
AROC_CYTH3      HDPCVVPRAVPIVEAMAAIVMVDFYLRNKAIRLD--------------------------
AROC_PORGI      HDPCVVPRAVPVVEAMTWLTLADAYLASRSGRCAHSSLKCNG------------------
AROC_DESPS      HDPCVVSRAIPIVESMAALVLLDMAMRQESRKSFF-------------------------
AROC_SYNJB      HDPCVLPRAVPMVEAMVALVLCDHLLRHHAQCGSLVLSEVPLPVAAAPQA----------
AROC_LEPBJ      HDPCVLPRAVPIIEAVVNLVLVDAYLYQRAINPQWFQKWARIPDYYKDLEL---------
AROC_LACP7      HDPIIVPRAVVVVEAMAALTLADLLLSGMSSKMDYVKKIYQK------------------
AROC_BDEBA      HDPCIVTRAIPVLEAMTWLVLADHYLWSKTDRI---------------------------
AROC_TREDE      HDICLFPRIVPVVEAMCYLVLADAFLVSKIERF---------------------------
AROC_CHLPN      HDPCVAIRAVPVVEAMINLVLADLVLYQRCSKL---------------------------
AROC_PARUW      HDPCVAIRAVPVVEAMMALVLVDAFLMSKFCQLN--------------------------
AROC_CAMHC      HDPCIAVRGSVVATAMMRLIVADMMLLNLGSTLTSLKKFYL-------------------
AROC_HELAH      HDPCIAIRGSVVCESLLSLVLADMVLLNLTSKIEYLKTIYNEN-----------------
AROC_CAMLR      HDPCVGIRGSIVVNAMVAICMADALLLNASSNLQNLQRVYGKNK----------------
AROC_WOLSU      HDPCVAIRGGVVCEALVALVLADMALLRLGNRLQDVKEFYGKGR----------------
AROC_ZINIC      HDTCIGIRILSVAESMLSLVIMDFILNFNSYKI---------------------------
AROC_CARRP      HDPCVGLRAVPVIESMLYTILINKILKKKIYE----------------------------
AROC_RHOBA      HDPCVGVRAGVTLESRMAIELLNSVLAYQATAHCGDSIKLF-------------------
AROC_DEHM1      HDTCIVPRAVSVVEAMTCIVLADLALRAGMIPRVIKQ-----------------------
AROC_PYRAE      YDVSVVPKALVALEAMTAITLADHALRAGLVRRDRPLRDPVV------------------
AROC_IGNH4      HDPAIVLRAVSVVESMFAIVLVDHAIRAGLLNPVRV--EWGPHCQRVWELYADRVP----
AROC_SULAC      HDPAVAIRGVSVAEAMVALVLVDHALRSGYIPPVKLSEDQARIIEEKWRRYVEECKPMQE
AROC_KORCO      HDPCVVPRAVVVVESMLAFTIADHIMRSMRGAI---------------------------
AROC_PYRAB      FDPSIVPRALPVVEGVMAFVLADHLLFRRVWELKSS------------------------
AROC_AERPE      HDPVIGPRAAPVVEAVTAIVLADLLLLREALLPEWVEDLRPWTRGEAGGD----------
AROC_THEVO      HDPCVAIRAVPVVECLTAFVLMDLMMMGGFIDRYGNVRGRSLL-----------------
AROC_ACESD      HDPCIVPRVVPVIESVAAFVILDMMLD----ESPEYIKSRWSL-----------------
AROC_ATOPD      HDVTAVLRAVPCVESAFALALLDTLYSW---PSEQNGYHND-------------------
AROC_CHIPD      HDLCIALRVPVVLEAVAAMALADFMLLE---QRSNRVFKN--------------------
AROC_HUNT2      NDPSICPRIYPVCEAMVRIALLDALYIAKGYRAISSNIDPRWDRL---------------
AROC_MYCTU      SDVCAVPAAGVVVETMVALVLARAALEKFGGDSLAETQRN------IAAYQRSVADREAP
AROC_CORJK      SDVCAVPAAGVVAETMVALVLARAVLKKFGGDSVEETKRN------VQSYLEYVDTRLDW
AROC_KOCRD      SDVCAVPAAGVVAEAMVALVLAEAALEKFGGDSVAELVRN------RDSYLAGIPESLRT
AROC_TROW8      SDICAVPAAAVVGESMVALTISCAILDKFGGDSLCEIKRN------FSGYLNSIPKNLMS
AROC_KORVE      SDVCVVPAAGIAAEAMVAITLAGCALEKFGGDSLVEFKRN------YEGYCQQLQSF---
AROC_MOOTA      SDVCAVPAAAVVAAAAVAWVLAGAILEQFGGDYLPVIQER------LAAYRQYLQEI---
AROC_THET2      SDTTAVPAASVILCALSAIVLAQAYLEKFGGDTMEEIQER------VERYRERVRAY---
AROC_SYMTH      SDVCAVPAAAVIAECVTAFELARFVAEKFGGDSLEEALRN------FRGYLEQIARR---
AROC_ANAD2      SDVCAVPAAAVVGEAVVAWELANALLEKFGGDAVEDVRRA------VEAYAARIR-----
AROC_CARHZ      SDITAVPAAGVVGEAVTALVLMESFLEKFGGDRIEETKRN------YQNYLQSIANY---
AROC_RUBXD      ADSCAVPAAAVIGEAMVAVVLAEAFLEKFGADALEDIRAS------YEHYMRRIGLPARR
AROC_ALKMQ      SDSCAVPAASIVGEMVAITVIAQEFLKKFGSDSLEEIRKT------WKSYTSI-------
AROC_ALKOO      SDNCAVPSAAVVAEGICAFAIAKEFLEKFRGDSIEEVEWN------YERYMNYLRSR---
AROC_GEOMG      SDVCAVPAAAVVAESVVAIEIASAFLEKFGGDSLAEIRRN------YDGYLDYLRSF---
AROC_THEP3      SDVTAVEAAACVLEAVCAWVIADECLKKFGGDSIEELKKN------YDAYLVYVKNF---
AROC_AQUAE      TDIVAVPAASVVGEAMLAIVLADALLEKLGGDFMEEVKKR------FEDYVNHVKSF---
AROC_CALBD      SDICAVPAGSIVMRAAIAYVLANALIERLGGDSAKTMLET------FKRIYNKG------
AROC_SYNWW      SDICAVPAAAIVGESMLAFAIARAFLEKFSGDSLDEIRKS------YTTYQAYLKRVWKW
AROC_UNCTG      SDVCAVPAVGIVAEAAIAVELAKALKEKFGGDSLKDMKKN------VNIYKERIKAL---
AROC_CHLP8      SDTCAVPAAGIVAEAVVAPSSPTPCWKSSAEIIWRRLRKGWRLIGKRYEYALQGKKLRRE
AROC_CHLT3      SDTCAVPACGVIAESVIAPVLANAILEKFGGDTINETKL------RLDNYTQKGK-----
AROC_SALRD      SDITSVPAASTVAEATVAYTVANAFLRKYGGDSVPAIRRH-----VEADRAAPNE-----
AROC_GLOVI      SDTCAVPAGGVVCEAMMAIVLAQELQRKLGGDSLGEMLRH-------AGRTHA-------
AROC_STRPN      SDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEA------VAKHRDYTKNY---
AROC_LACLM      SDPTALPAAGVVMENVVATVVAQEICDKFNSDTINELKKA------LVDYKKRLSEY---
AROC_LYSSC      SDSCAVPAASVVAEHVIAWEIATVILEQFHSDQLPQLKAQ------IDEHRQYTKGF---
AROC_EXISA      SDSCAVPAASLVVEAVIAFEIAKEMCETFGHDTMERIKHR------VDEYREELRVW---
AROC_LACPL      SDTTAIVPASIVVESVVAIELTRALTATFDGSNLARLQQT------VTAYREELRQY---
AROC_LEUCK      SDTTAVTAAAVIAEAMVAIELAKAVLDKFDADNIDRMKEQ------VAAYRQEVKAF---
AROC_DESHD      SDVCAVPAALVVLKHVAAWEILQAILEKFPADTWDELDKA------WQDYKRFVSEQ---
AROC_THEMA      SDVTAVPPASVVCEAALAVVISDALLEHLGDGNIDDLKRRFENE-NLPRWNDGFWKEHYR
AROC_THESQ      SDVTAVPPASVVCEAALAVVISDALLEHLGDGNIDDLKRRFGNE-NLPRWDDGFWKEYDR
AROC_CLOTE      SDVSAVVPASIVLENIVAFEILKEILNKFPSDEYYELKR------NISHYRGTIYLR---
                 *                                                          

AROC_ECOLI      ---------------------
AROC_BLOFL      ---------------------
AROC_NITMU      PKVEFADDPEPDEA-------
AROC_DICNV      ---------------------
AROC_RHOCS      ---------------------
AROC_DESAL      ---------------------
AROC_SYNAS      ---------------------
AROC_DESDA      ---------------------
AROC_DESAD      ---------------------
AROC_HERA2      ---------------------
AROC_METTH      ---------------------
AROC_METST      ---------------------
AROC_METJA      ---------------------
AROC_METKA      ---------------------
AROC_METAR      ---------------------
AROC_METTP      ---------------------
AROC_HALMA      THAKTIDDD------------
AROC_HALMD      THATTVDED------------
AROC_BACFR      ---------------------
AROC_SULMW      ---------------------
AROC_CYTH3      ---------------------
AROC_PORGI      ---------------------
AROC_DESPS      ---------------------
AROC_SYNJB      ---------------------
AROC_LEPBJ      ---------------------
AROC_LACP7      ---------------------
AROC_BDEBA      ---------------------
AROC_TREDE      ---------------------
AROC_CHLPN      ---------------------
AROC_PARUW      ---------------------
AROC_CAMHC      ---------------------
AROC_HELAH      ---------------------
AROC_CAMLR      ---------------------
AROC_WOLSU      ---------------------
AROC_ZINIC      ---------------------
AROC_CARRP      ---------------------
AROC_RHOBA      ---------------------
AROC_DEHM1      ---------------------
AROC_PYRAE      ---------------------
AROC_IGNH4      ---------------------
AROC_SULAC      SQ-------------------
AROC_KORCO      ---------------------
AROC_PYRAB      ---------------------
AROC_AERPE      ---------------------
AROC_THEVO      ---------------------
AROC_ACESD      ---------------------
AROC_ATOPD      ---------------------
AROC_CHIPD      ---------------------
AROC_HUNT2      ---------------------
AROC_MYCTU      AARVSG---------------
AROC_CORJK      SAEANDVADGEVADGEIR---
AROC_KOCRD      SPELADPAALAALDEVRGDLS
AROC_TROW8      VIER-----------------
AROC_KORVE      ---------------------
AROC_MOOTA      ---------------------
AROC_THET2      ---------------------
AROC_SYMTH      ---------------------
AROC_ANAD2      ---------------------
AROC_CARHZ      ---------------------
AROC_RUBXD      ADA------------------
AROC_ALKMQ      ---------------------
AROC_ALKOO      ---------------------
AROC_GEOMG      ---------------------
AROC_THEP3      ---------------------
AROC_AQUAE      ---------------------
AROC_CALBD      ---------------------
AROC_SYNWW      EKI------------------
AROC_UNCTG      ---------------------
AROC_CHLP8      PEVFAID--------------
AROC_CHLT3      ---------------------
AROC_SALRD      ---------------------
AROC_GLOVI      ---------------------
AROC_STRPN      ---------------------
AROC_LACLM      ---------------------
AROC_LYSSC      ---------------------
AROC_EXISA      ---------------------
AROC_LACPL      ---------------------
AROC_LEUCK      ---------------------
AROC_DESHD      ---------------------
AROC_THEMA      ---------------------
AROC_THESQ      ---------------------
AROC_CLOTE      ---------------------