CLUSTAL format seed alignment for MF_00301

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KHSE_BRUA2      MAVYTDINEIELGAFLRHY-DIGTLTSYKGIAEGVENSNYLLHTSSG----SFILTLYEK
KHSE_BRUAB      MAVYTDINEIELGAFLRHY-DIGTLTSYKGIAEGVENSNYLLHTSSG----SFILTLYEK
KHSE_BRUME      MAVYTDINEIELGAFLRHY-DIGTLTSYKGIAEGVENSNYLLHTSSG----SFILTLYEK
KHSE_BRUSU      MAVYTDINEIELGAFLRHY-DIGTLTSYKGIAEGVENSNYLLHTSSG----SFILTLYEK
KHSE_CHESB      MAVYTDISEEELTAFLRHY-PVGKLLSYKGIAEGTENSNYLLHTTAG----AYILTLYER
KHSE_RHILO      MAVYTDVAEGELGAFLKHY-PVGDLLSYKGIAEGTENSNFLLHTSSG----SYILTLYEK
KHSE_RHIEC      MAVYTDIAEDDLKWFLTEY-DVGTLLSYKGIAEGVENSNFLLHTSKA----PLILTLYEK
KHSE_RHIL3      MAVYTDIAEDDLKWFLTEY-DAGTLLSYKGIAEGVENSNFLLHTSKD----PLILTLYEK
KHSE_AGRFC      MAVYTDITEDELRNFLTQY-DVGSLTSYKGIAEGVENSNFLLHTTKD----PLILTLYEK
KHSE_RHIME      MAVYTDITEDELIRFLAAY-EVGSLTSYKGIAEGVENSNFLLHTTKG----AYILTLYEK
KHSE_BRASB      MAVYTDVAADELADFLKTY-DIGELLSYKGIAEGVENSNFLLHTTKG----YFILTLYEK
KHSE_BRASO      MAVYTDVAADELADFLKTY-DIGELLSYKGIAEGVENSNFLLHTTKG----SYILTLYEK
KHSE_RHOP5      MAVYTDVAADDLAEFLLAY-DIGELLSYKGIAEGVENTNFLLHTSRG----SFILTLYEK
KHSE_RHOPB      MAVYTDVAAEELAEFLRGY-DIGELLSYKGIAEGVENSNYLLHTSKG----SFILTLYEK
KHSE_RHOP2      MAVYTDVAADDLADFLKSY-EIGDLLSYKGIAEGVENTNFLLHTTRG----SFILTLYEK
KHSE_RHOPS      MAVYTDVAADELADFLKAY-EIGDLLSYKGIAEGVENSNFLLHTTRG----HFILTLYEK
KHSE_BRADU      MAVYTDVAADELADFLSQY-DLGELLSYKGIAEGVENSNFLLHTTKG----SFILTLYEK
KHSE_RHOPA      MAVYTDVAADELADFLSRY-DIGDLLSYKGIAEGVENSNFLLHTSRG----YFILTLYEK
KHSE_NITHX      MAVYTDVAADELADFLKAY-DIGELLSYKGIAEGVENSNYLLHTTAG----SFFLTLYEK
KHSE_NITWN      MAVYTDVAAEELADFLKAY-DIGELLSYKGIAEGVENSNYLLHTTSG----SFFLTLYEK
KHSE_MAGSA      MAVYTEVSDDELEDFAAEY-DIGQVVSCKGIAEGVENTNYLLQTDQG----NYILTLYEK
KHSE_RHORT      MAVYTDVSDDDLTTFLEGY-DIGRLRACKGIAEGVENSNFLLVTDRG----PHILTLYEK
KHSE_GRABC      MAVYTEVTDEALAAFLAEY-DIGTAVAFRGIAEGVENSNYVLRTTGG----DYILTLYEK
KHSE_CAUVC      MAVYTDITDQELEAFLEGY-DLGAPLAFKGIAEGVENSNFLLETEKG----RYILTVYER
KHSE_ZYMMO      MAVYTSVSDEEVSSFLDLYPDSGRLLSIKGITEGVENSNYLITTDVR----SYILTLYEK
KHSE_BURCA      MAVFTAVSDSDLAQWMRHY-ELGDVLAFRGIPSGIENSNFFLTTTRG----EYVLTIFEK
KHSE_BURCH      MAVFTAVSDSDLAQWMRHY-ELGDVLAFRGIPSGIENSNFFLTTTRG----EYVLTIFEK
KHSE_BURL3      MAVFTAVSDSDLAQWMRHY-ELGDVLAFRGIPSGIENSNFFLTTTRG----EYVLTIFEK
KHSE_BURCM      MAVFTAVSDSDLAQWMRHY-ELGDVLAFRGIPSGIENSNFFLTTTRG----EYVLTIFEK
KHSE_BURP0      MAVFTAVSDADLALWMRHY-DLGDVVAFRGIPSGIENSNFFLTTTRG----EYVLTIFEN
KHSE_BURPS      MAVFTAVSDADLALWMRHY-DLGDVVAFRGIPSGIENSNFFLTTTRG----EYVLTIFEN
KHSE_BURMA      MAVFTAVSDADLALWMRHY-DLGDVVAFRGIPSGIENSNFFLTTTRG----EYVLTIFEN
KHSE_BURTA      MAVFTAVSDADLALWMRHY-DLGDVVAFRGIPSGIENSNFFLTTTHG----EYVLTIFEN
KHSE_PARXL      MAVFTAVTEPQLAEWMRHY-DLGDVVEFRGISSGIENSNFFLTTTRG----EYVLTIFEK
KHSE_CUPNH      MAVFTTVSQDEIARWLLDF-NLGEVRELRGIASGIENSNFFLTTEHDGQTRQYVLTIFER
KHSE_CUPPJ      MAVFTTVSHDEIASWLLDY-DLGEVRELRGIASGIENSNFFLTTEQDGRTREYVLTIFER
KHSE_CUPMC      MAVFTTVSQDEIARWLLDY-DLGEVRALRGIASGIENSNFFLTMEQDGVTREYVLTIFER
KHSE_RALSO      MAVFTPVTNAEIALWLEQY-DVGTVRALRGIPSGIENTNFFLTTEKDGATHEYVVTLFER
KHSE_METFK      MSVFTTVSFEQMQQWLKGY-DLGELLDLQGIASGITNTNYFVTTDNG----RYVLTLFEE
KHSE_METGL      MSVFTAVSFEQMQQWLKGY-DLGELLDLQGIASGITNTNYFVATGTG----RYVLTLFEE
KHSE_NEIMA      MSVYTSVSDDEMRGFLSGY-DLGEFVSLQGIAQGITNSNYFLTTTSG----RYVLTVFEV
KHSE_NEIMB      MSVYTSVSDDEMRGFLSGY-DLGEFVSLQGIAQGITNSNYFLTTTSG----RYVLTVFEV
KHSE_PSEAB      MSVFTPLERSTLEAFLAPY-DLGRLRDFRGIAEGSENSNFFVSLEHG----EFVLTLVER
KHSE_PSEAE      MSVFTPLERSTLEAFLAPY-DLGRLRDFRGIAEGSENSNFFVSLEHG----EFVLTLVER
                *:*:* :    :  :   :   *     :**..*  *:*:.:           .:*: * 

KHSE_BRUA2      RTNREDLPFFLGLMQHLAKRGLECPQPVVRNDGAMIGQLAGRPAAIVTFLEGMWMRRPTV
KHSE_BRUAB      RTNREDLPFFLGLMQHLAKRGLECPQPVVRNDGAMIGQLAGRPAAIVTFLEGMWMRRPTV
KHSE_BRUME      RTNREDLPFFLGLMQHLAKRGLECPQPVVRNDGAMIGQLAGRPAAIVTFLEGMWMRRPTV
KHSE_BRUSU      RTNREDLPFFLGLMQHLAKRGLECPQPVVRNDGAMIGQLAGRPAAIVTFLEGMWMRRPTV
KHSE_CHESB      RVDRSDLPFFLGLMEHLARKGVSCPLPVKRLDDGLIGELAGRPAALITFLEGMWMRRPTA
KHSE_RHILO      RVEKADLPFFLGLMGHLANKGVSCPLPVTAHDGSVIGTLAGRPAVIITFLEGLSLRRPTA
KHSE_RHIEC      RVEKSDLPFFLGLMQHLSARGLSCPLPLPRRDGALLGSLSGRPAALISFLEGMWLRKPEA
KHSE_RHIL3      RVEKSDLPFFLGLMQHLSARGLSCPLPLPRRDGALLGSLSGRPAALISFLEGMWLRKPEA
KHSE_AGRFC      RVEKNDLPFFLGLMQHLAAKGLSCPLPLPRKDGELLGELSGRPAALISFLEGMWLRKPEA
KHSE_RHIME      RVNADDLPFFLGLMHHLAERGLSCPLPLPRADGKLLGTLSGRPAAVISFLEGMWLRKPEA
KHSE_BRASB      RVAVDDLPYFLGLMAHLAERGVSCPQPARNRDGAVYSTLSGRPAAIINFLEGLWPRKPNV
KHSE_BRASO      RVAVDDLPYFLGLMAHLAERGVNCPQPARNRDGAVYSSLAGRPAAIINFLEGMWPRKPAV
KHSE_RHOP5      RVAAEDLPYFLSLMAHLASRGVSCPQPEKNRDGEICGTLSGRPAVIINFLEGVWPRRPNV
KHSE_RHOPB      RVASEDLPYFLTLMSHLAERGIRCPQPEKNRGGAVFGTLMGRPAAIINFLEGVWPRRPNV
KHSE_RHOP2      RVASEDLPYFLALMAHLAARGVSCPQPEKTRDGEICGALSGRPAVIINFLEGVWPRRPNA
KHSE_RHOPS      RVAADDLPYFLSLMAHLAARGVSCPQPATNRAGEVCGTLSGRPAVIINFLEGVWPRRPNL
KHSE_BRADU      RVAKNDLPFFLALMTHLAEHGVNCPLPVKGRDGEALRELSGRPAAIITFLEGVWPRKPNA
KHSE_RHOPA      RVARDDLPFFLSLMTHLADSGINCPQPVADREGRTLATLAGRPAAIISFLDGVWPRKPSV
KHSE_NITHX      RVAVDDLPFFLGLMGHLATHGIVCPQPVKARNGEALGCLAGRPAAIIDFLEGVWPRKPNV
KHSE_NITWN      RVAIDDLPFFLGLMGHLATHGIVCPQPVRTRNGETLGSLAGRPAAIIDFLEGVWPRKPNV
KHSE_MAGSA      RVNPEELPFFLGLMEHLAAHGLACPTPIHGRDGKALRTLCGRPAAIVSFLKGMWSRRITL
KHSE_RHORT      RVNPDDLPFFLGLLRHLAARDIPCPQPVAGRDGAVLHTLCDRPAAIVTFLDGVWPKRPEV
KHSE_GRABC      RVDPNDLPWFLGLMEHLAARGITCPQPVRGRDGQALRMLCGRHAAITGFLPGVWPRKVQV
KHSE_CAUVC      RVKAEDLPYFLNMLTWLADRGYPSARPIPTRSGATLSSLRGKPAAIVEFLPGLSVRKPTA
KHSE_ZYMMO      RVNPEELPFFMALTDHLAAENLPVPKAWKSRDGKQIQTLAGRPACLIEFLQGRWTPTPNA
KHSE_BURCA      LTA-QQLPFYLDLMRHLAAHGVPVPDPIPRDDGALFGELHGKPAAIVTKLDGAAELAPGV
KHSE_BURCH      LTA-QQLPFYLDLMRHLAAHGVPVPDPIPRDDGALFGELHGKPAAIVTKLDGAAELAPGV
KHSE_BURL3      LTA-EQLPFYLDLMSHLAGHGVPVPDPIPRDDGALFGMLHGKPAAIVTKLDGSAELAPGV
KHSE_BURCM      LTA-EQLPFYLDLMRHLASHGVPVPDPIPRDDGALFGLLHGKPAAIVTKLDGAAELAPGI
KHSE_BURP0      LTA-GQLPFYVDLMSHLAKHGVPVPAPVARDDGTLFGELHGKPAAIVTKLEGAAQLAPGV
KHSE_BURPS      LTA-GQLPFYVDLMSHLAKHGVPVPAPVARDDGTLFGELHGKPAAIVTKLEGAAQLAPGV
KHSE_BURMA      LTA-GQLPFYVDLMSHLAKHGVPVPAPVARDDGTLFGELHGKPAAIVTKLEGAAQLAPGV
KHSE_BURTA      LTA-GQLPFYIDLMSHLAKHGVPVPAPVARDDGTLFGELHGKPAAIVTKLEGAAELAPGI
KHSE_PARXL      LTA-EQLPFYLDLMRHLAAHRVPVPDPMPREDGALFGLLQGKPAAIVTRLEGAPELAPGV
KHSE_CUPNH      LTF-AQLPYYLHLMAHLAERGIRVPAPIPARDGEILRPLKGKPATIVTRLPGASQLAPDA
KHSE_CUPPJ      LTF-DQLPYYLHLMAHLATRGITVPAPIPARDGEILRALKGKPATIVTRLPGASQLAPDA
KHSE_CUPMC      LQF-DQLPYYLHLMDHLARHGICVPAPMPARDGEILRELKGKPATIVTRLPGASQLAPQP
KHSE_RALSO      LTS-EQLPFYLYLMQHLAQHGICVPAPIPGRDGAILRPLKGKPATIVTRLPGRSNLAPTT
KHSE_METFK      HSA-EELPNFLDLMTHLAERGIPCPHPVKNNAGRALGELNGKPAALVSCLAGRSLDNPMP
KHSE_METGL      HSA-EELPNFLDLMTHLAERGIPCPYPVKNIAGQALGELNGKPAALVSCLAGKSLDNPSP
KHSE_NEIMA      LKQ-EELPFFLELNRHLSMKGVAVAAPVARKDGRLDSVLAGKPACLVACLKGSDTALPTA
KHSE_NEIMB      LKQ-EELPFFLELNRHLSMKGVAVAAPVARKDGRLDSVLAGKPACLVACLKGSDTALPTA
KHSE_PSEAB      GPV-QDLPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNA
KHSE_PSEAE      GPV-QDLPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNA
                     :** :: :   *       . .     .     * .: * :   * *        

KHSE_BRUA2      AHCEAVGEGLAHMHLAGADFPMRRRNGLTLPDWRPLWNLSR-KCADTVERGLVAETEADL
KHSE_BRUAB      AHCEAVGEGLAHMHLAGADFPMRRRNGLTLPDWRPLWNLSR-KCADTVERGLVAETEADL
KHSE_BRUME      AHCEAVGEGLAHMHLAGADFPMRRRNGLTLPDWRPLWNLSR-KCADTVERGLVAETEADL
KHSE_BRUSU      AHCEAVGEGLAHMHLAGADFPMRRRNGLTLPDWRPLWNLSR-KCADTVERGLVAETEADL
KHSE_CHESB      LHCGQVGKALADLHQAAEDFPLKRPNALGPEGWRRLWEGAK-ARADEVEPGLAREVDAEF
KHSE_RHILO      THCAEVGKALAALHLAGADFPMTRPNALAIDGWRKLWNAAR-DRADEVEPGLAAEVDADF
KHSE_RHIEC      KHCREVGRALAEMHVAGEGFELKRPNALSLDGWRGLWEKSE-ARADEVESGLQGEIRNEL
KHSE_RHIL3      KHCREVGRALAEMHVAGDGFALKRPNALSIDGWRGLWEKSE-ARAGEVEPGLRDEIRSEL
KHSE_AGRFC      KHCREVGKALAAMHLASEGFEIKRPNALSVDGWKVLWDKSE-ERADEVEKGLREEIRPEI
KHSE_RHIME      QHCREVGRALASMHQAGEGFPLKRPNALSVEGWRPLWRNSE-ARADEVQAGLKDEIATEL
KHSE_BRASB      AHCAGVGTALARMHLAGRDFPLVRKNPLSVSGWMSLFAQAA-DRADTVQAGLSALLSAEL
KHSE_BRASO      VHCAGVGEALARMHLAGRDFPLVRKNPLSVSGWQSLFAQAA-DRADTVQAGLSALLSTEL
KHSE_RHOP5      AQCAGVGEALAKMHLAGRDFPLVRKNPLSVKGWWALFEQAA-SGADPLQHGLRALLHAEL
KHSE_RHOPB      AQCAAVGEGLARLHLAGQDFPLRRANPLSVGGWRALFEQSA-AGADPLQHGLHALLHAEL
KHSE_RHOP2      VHCAGVGEALAKMHLAGLDFPQHRANPLSVSGWRPLFDLAA-ARADEIQPGLRDFIAAEL
KHSE_RHOPS      AHCAGVGEAMAKMHRAGLDYPSYRSNPLSVTGWRPLFNIAA-SRADEIQPGLRDFIAAEL
KHSE_BRADU      AHCAGVGEGLARMHLAGANFAIRRANALSVAGWRPLFDAAA-SRADEVQPGLRAFLAAEL
KHSE_RHOPA      VHCAGVGQALAKMHLAGRDFAMKRANALSVAGWRPLFAAAE-ARADEVQPGLRDFLAAEL
KHSE_NITHX      THCAAVGAALAKLHLAGRDFPMRRANALSVSSWRPLFEQAT-PCIDTVQHGLHDFLKAEL
KHSE_NITWN      AHCAAVGAALAKLHLAGRDFSMRRANALSVWSWRPLFEQAG-ACADTVQPGLHDFLKAEL
KHSE_MAGSA      GHCAELGPAMATMHLAGADFPLTRANNLSVAGWRPLFESIR-PRAAEIKSDLAQSIEDEL
KHSE_RHORT      RHCAQLGEALARLHLAGGDYAPTRRNSLSVDGWRPLFDAAA-ERADSVKPGLRAELETEL
KHSE_GRABC      AHCHPVGEVLAKLHEAGADYAPTRLNALGPEGWPPLLAICR-SRADEISPGLGEELQKAL
KHSE_CAUVC      AHCREAGEGLAWLHLAGEGYPGRRANDLGQAAWSPLFSKHR-KAAEDLKPGLSATIDNDL
KHSE_ZYMMO      EQTRATGEMLGKMHKSLTHFSENRKNSLDLENWHILAEKCGFEAMNQIEAHMGDEVKKEL
KHSE_BURCA      EHCIEVGQMLARLHLAGRDYPRNQPNLRSLP-WWQENVPAIVPFITDAQRALLEGELAHQ
KHSE_BURCH      EHCIEVGQMLARLHLAGRDYPRNQPNLRSLP-WWQENVPAIVPFITDAQRALLEGELAHQ
KHSE_BURL3      EHCIEVGQMLARLHLAGRDYPRNQPNLRSLP-WWQENVPAIVPFITDEQRALLEGELVHQ
KHSE_BURCM      EHCIEVGQMLARLHLAGRDYARYQPNLRSLP-WWRENVPAIVPFVSDAQRTLLEGELAHQ
KHSE_BURP0      EHCVEVGQMLARMHLAGRDYPRHQPNLRSLP-WWRDTVPAIAPFVTGEQRALLEGELAHQ
KHSE_BURPS      EHCVEVGQMLARMHLAGRDYPRHQPNLRSLP-WWRDTVPAIAPFVTGEQRALLEGELAHQ
KHSE_BURMA      EHCVEVGQMLARMHLAGRDYPRHQPNLRSLP-WWRDTVPAIAPFVTGEQRALLEGELAHQ
KHSE_BURTA      EHCVEVGQMLARMHLAGRDYPQHQPNLRSLP-WWRDAVPAIVPFITGEQRALLEGELAHQ
KHSE_PARXL      EHCIEVGQMLARMHLAGRDYPAYQPNLRSLP-WWKETVPTILPFLEGGQRELLSSELAYQ
KHSE_CUPNH      QHCAEVGDMLARMHLAGQDYPRQQPNLRSLP-WWRQTEPEILPFLDAGQRALLQQEIAHQ
KHSE_CUPPJ      EHCAEVGDMLARMHLAGQDYPRQQPNLRSLP-WWQQTEAEIVPFLDAQQRTLLQQEIAHQ
KHSE_CUPMC      DHCAEVGAMLARMHIAGQDYPRKQPNLRSLA-WWQQTTPEITPFLDAAQRKLLTEEIAHQ
KHSE_RALSO      SECAIVGDMLARMHLAGRDYPRHQPNLRSLP-WWNEVVPDIQPFVQGATRELLVAELAHQ
KHSE_METFK      QHCAAIGEVLARMHIAGASFKAGMSNLRGQE-WRIATAAKVAPFLDEENHRMLDAQLEFE
KHSE_METGL      QHCAAIGEVLARMHLAGASFEVSIINLRCQR-WRIARLPRWAPFLDAENXRMLDAQLEFE
KHSE_NEIMA      EQCFHTGAMLAKMHLAAADFPLEMENPRYDA-WWTEACARLLPVLSQDDAALLRAEIDAL
KHSE_NEIMB      EQCFHTGAMLAKMHLAAADFPLEMENPRYNA-WWTEACARLLPVLSQDDAALLCSEIDAL
KHSE_PSEAB      HHCQEVGDLLGHLHAATRGRILERPSDRGLP-WMLEQGANLAPRLPEQARALLAPALAEI
KHSE_PSEAE      HHCQEVGDLLGHLHAATRGRILERPSDRGLP-WMLEQGANLAPRLPEQARALLAPALAEI
                 .    *  :. :* :         .      *                  :        

KHSE_BRUA2      DFLE-KNWPADLPQGVIHADLFPDNAFFLGDR--------LSGFIDFYFACTDILAYDVA
KHSE_BRUAB      DFLE-KNWPADLPQGVIHADLFPDNAFFLGDR--------LSGFIDFYFACTDILAYDVA
KHSE_BRUME      DFLE-KNWPADLPQGVIHADLFPDNAFFLGDR--------LSGFIDFYFACTDILAYDVA
KHSE_BRUSU      DFLE-KNWPADLPQGVIHADLFPDNAFFLGDR--------LSGFIDFYFACTDILAYDVA
KHSE_CHESB      ALLE-RDWPKDLPSGVIHADLFPDNVFFLGGE--------LSGLIDFYFACNDLLAYDLA
KHSE_RHILO      ADFE-RNWPRGLPAGIIHADLFPDNVFFLGEK--------LSGLIDFYFACDDLYAYDVA
KHSE_RHIEC      DFLA-AAWPKSLPSGVIHADLFPDNVFFLGDE--------LSGLIDFYFACNDLLAYDVS
KHSE_RHIL3      DFLS-AAWPSGLPAGVIHADLFPDNVFFLGDQ--------LSGLIDFYFACNDLLAYDVS
KHSE_AGRFC      DYLA-AHWPKDLPAGVIHADLFQDNVFFLGDE--------LSGLIDFYFACNDLLAYDVS
KHSE_RHIME      AFIE-EHWPKDLPEGVIHADLFPDNVFFLGDR--------LSGLIDFYFACNDFLAYDVA
KHSE_BRASB      DVLA-RSWPTDLPEGVIHADLFPDNVFFLGDQ--------LSGLIDFPFSCNDILAYDVA
KHSE_BRASO      DYLA-RAWPTDLPEGVIHADLFPDNVFFLGDH--------LSGLIDFPFSCNDILAYDVA
KHSE_RHOP5      DHLD-HAWPKHLPEGVIHADLFPDNVFFIGDK--------LSGLIDFPFACNDILAYDVA
KHSE_RHOPB      DYLE-HAWPKQLPDGVIHADLFPDNAFFLGDT--------LSGIIDFPFACNDILAYDVA
KHSE_RHOP2      DHLE-GRWPRHLPTGVIHADLFPDNVFFIGDT--------LSGLIDFPFSCNDILAYDVA
KHSE_RHOPS      DYLE-GNWPDQLPTGVIHADLFPDNVFFIGDK--------LSGLIDFPFSCNDILAYDVA
KHSE_BRADU      DYLASGVWPTNLPEGVIHADLFNDNVFFLGDK--------LSGIIDFTFACNDMLAYDVA
KHSE_RHOPA      SYLESGVWPSDLPQGLIHADLFPDNVFFIGDE--------VSGIIDFTFACNDLLAYDVA
KHSE_NITHX      DHLE-RHWPQNLPAGVIHADLFPDNVLFLGDR--------LSGLIDFYFACNDFFAYDVA
KHSE_NITWN      DHLE-ARWPQELPGGVIHADLFPDNVLFLGDR--------LSGLIDFYFACHDFFAYDVA
KHSE_MAGSA      DYLE-AHWPRTLPVGLIHADLFPDNVFFLADKAAG--VDRMSGFIDFYFACTDVLAYDIA
KHSE_RHORT      DALE-ALWPHDLPTGIIHADLFPDNVFFVDDT--------LSGLIDFYFACDDFLAYDLA
KHSE_GRABC      DRVL-TAWPSDLPAGHIHADLFPDNVFFLDDR--------LSGVIDFYFAATDALAYDIA
KHSE_CAUVC      AQLS-LMWPRNLPTGTIHADYFPDNVFFQSNG-------KFAAAIDFYFACDDAYAYDVA
KHSE_ZYMMO      DYLD-KFWPKDLPRSVIHADLFPDNVLFEGDS--------LKGVIDFYFACTEVRAWDLA
KHSE_BURCA      AGFFASDDYAALPAGPCHCDLFRDNVLFAHAAPGTGHDVRLGGFFDFYFAGCDKWLFDVA
KHSE_BURCH      AGFFASDDYAALPAGPCHCDLFRDNVLFAHAAPGTGHDVRLGGFFDFYFAGCDKWLFDVA
KHSE_BURL3      AGFFASDDYAALPAGPCHCDLFRDNVLFAHAAPDTGHDVRLGGFFDFYFAGCDKWLFDVA
KHSE_BURCM      AAFFASDDYAALPSGPCHCDLFRDNVLFAHAAPGTGHDVRLGGFFDFYFAGCDKWLFDVA
KHSE_BURP0      AAFFASDDYAALPEGPCHCDLFRDNALFAHAEPDTGHSVRLGGFFDFYFAGCDKWLFDVA
KHSE_BURPS      AAFFASDDYAALPEGPCHCDLFRDNALFAHAEPDTGHSVRLGGFFDFYFAGCDKWLFDVA
KHSE_BURMA      AAFFASDDYAALPEGPCHCDLFRDNALFAHAEPDTGHSVRLGGFFDFYFAGCDKWLFDVA
KHSE_BURTA      AAFFASDDYAALPEGPCHCDLFRDNALFAHAAPDTGHSVRLGGFFDFYFAGCDKWLFDVA
KHSE_PARXL      EAFFASADYAALPEGPCHADLFRDNAMFAHAEPGTGHEVRLGGFFDFYFAGCDKWLFDVA
KHSE_CUPNH      AAFFASTDYAGLGSGPCHCDLFRDNALFE---EDGSGRHRLGGFFDFYFAGNDKWLFDVA
KHSE_CUPPJ      AAFFGSADYAALPGGPCHCDLFRDNALFE---EVG-GHHRLGGFFDFYFAGNDKWLFDLA
KHSE_CUPMC      TAFFGSGDYAALQGGPCHCDLFRDNALFD---TDSAGNHRLGGFFDFYFAGDDKWLFDLA
KHSE_RALSO      QRFFGSADYAALPEGPCHCDLFRDNVLFEP--ATDSQPERLGGFFDFYFAGVDKWLFDVA
KHSE_METFK      RTFDTR----RLPRGVIHADLFRDNVLMD--------GDKVGGVIDFYYACHDALLYDIA
KHSE_METGL      QAFDTS----ALSRGVIHADLFRDNVLMD--------GDKVGGVLDFYYAWNDVLFYDIA
KHSE_NEIMA      KDNLGN----HLPSGIIHADLFKDNVLLD--------GGQVSGFIDFYYACRGNFMYDLA
KHSE_NEIMB      KDNLGN----HLPSGIIHADLFKDNVLLD--------GGQVSGFIDFYYACRGNFMYDLA
KHSE_PSEAB      AALDAER--PALPRANLHADLFRDNVLFD--------GPHLAGLIDFYNACSGWMLYDLA
KHSE_PSEAE      AALDAER--PALPRANLHADLFRDNVLFD--------GPHLAGLIDFYNACSGWMLYDLA
                           *  .  *.* * **.::            . . :**  :      :*::

KHSE_BRUA2      VCLNAWCFE-KDFSYNRTKGAALLRGYTSVRPLSEAEADALLVLARGAAVRFMLTRLYDW
KHSE_BRUAB      VCLNAWCFE-KDFSYNRTKGAALLRGYTSVRPLSEAEADALLVLARGAAVRFMLTRLYDW
KHSE_BRUME      VCLNAWCFE-KDFSYNRTKGAALLRGYTSVRPLSEAEANALLVLARGAAVRFMLTRLYDW
KHSE_BRUSU      VCLNAWCFE-KDFSYNRTKGAALLRGYTSVRPLSEAEADALPVLARGAAVRFMLTRLYDW
KHSE_CHESB      TCLNAWCFE-KDISYNLTKGAALLAGYQAVRPLTREEIEMLPLLARGSALRFMLTRLYDW
KHSE_RHILO      TCLNAWCFE-KDFSFNLTKGKALLAGYQSVRPLSGEEKAALPMLSRGSALRFMLTRLYDW
KHSE_RHIEC      ICLNAWCFE-KDGAYNITKGMAMLEGYQSVRPLSGEEIAALPLLARGSALRFFLTRLYDW
KHSE_RHIL3      ICLNAWCFE-KDGAYNITKGTAMLEGYQSVRPLSDAEISALPVLSRGSALRFFLTRLYDW
KHSE_AGRFC      ICLNAWCFE-KDGAYNVTKGKALLEGYQSVRPLSEAELEALPLLSRGSALRFFLTRLYDW
KHSE_RHIME      ICLNSWCFE-KDGSYNITKGMALLSGYESVRRLTAEEIEALPLLARGSALRFFLTRLYDW
KHSE_BRASB      ICLNAWCFE-ADHSLNVTKARAFFHAYGRERPLSQAELAALPLLARGAAIRFLLTRLVDW
KHSE_BRASO      ICLNAWCFE-ADHSLNVTKARAFFNAYGRARPLSDAELEALPLLARGAAIRFLLTRLVDW
KHSE_RHOP5      ICLNAWCFE-PDHSFNVTKARAFLNGYNRGRPLEAAEQDALPLLARGAALRFLLTRLVDS
KHSE_RHOPB      ICLNAWCFE-PDHSFNVTKARAFLGGYGRERPLTTSEEDALPLLARGAALRFLLTRLVDS
KHSE_RHOP2      ICLNAWCFE-PDHAFNVTKARALLNAYQRGRALSEAEQTALPLLARGAAMRFLLTRLVDV
KHSE_RHOPS      ICLNAWCFE-PDLSFNVTKARALLNAYQRERALSEAEQAALPLLARGAAMRFLLTRLVDF
KHSE_BRADU      ICLNAWCFE-PDHSFNVTKARAFLNAYGRVRKLSEAEEAALPLLARGAAIRFLLTRLVDW
KHSE_RHOPA      ICLNAWCFE-ADHAFNVTKARALLSAYTRERPLDAAEQAALPLLARGAALRFLLTRLVDW
KHSE_NITHX      ICLNAWCFE-PDHSFNVTKARALLGAYNRERALSEAEQAALPLLARGAALRFLLTRLVDF
KHSE_NITWN      ICLNAWCFE-PDHAFNVTKARALLGAYHRERALSEAEQAALPLLARGAALRFLLTRLVDF
KHSE_MAGSA      ICLNAWCFE-EDGAFNATKARLMLNGYRRVRPLSADELDALPLLARGAAMRFLLTRSYDW
KHSE_RHORT      VCLNAWCFE-GEREFNVTKARHMLTRYEKVRPLSDAEFAALPLLARGAAMRFLLTRLYDW
KHSE_GRABC      IALNAWCFE-SDHAYNITKGSALLRGYNAIRTLTEAEKAALPVLCQGAALRFALTRLFDW
KHSE_CAUVC      VTLNAWCFE-ADGSFNITAAKALLNGYERRRPLSPIEKEALPILARGAAMRFFLTRLADW
KHSE_ZYMMO      ITYSAWCFD-QEDHFLADHAKALIKGYHQSFALTEEERAAFIVLLRGAALRFLLTRAWDW
KHSE_BURCA      VTVNDWCVDLATGVLDVARADALLRAYQTVRPFTAEERRHWSDMLRAGAYRFWVSRLYDF
KHSE_BURCH      VTVNDWCVDLATGVLDVARADALLRAYQTVRPFTAEERRHWSDMLRAGAYRFWVSRLYDF
KHSE_BURL3      VTVNDWCVDLATGVLDVARADALLRAYQTVRPFTAEERRHWSDMLRAGAYRFWVSRLYDF
KHSE_BURCM      VTVNDWCVDLATGVLDVARADALLRAYQTVRPFTAPERRHWSDMLRAGAYRFWVSRLYDF
KHSE_BURP0      VTVNDWCVDLPTGALDAARADALLRAYQTVRPFTAGERRHWGDMLRAGAYRFWVSRLYDF
KHSE_BURPS      VTVNDWCVDLPTGALDAARADALLRAYQTVRPFTAGERRHWGDMLRAGAYRFWVSRLYDF
KHSE_BURMA      VTVNDWCVDLPTGALDAARADALLRAYQTVRPFTAGERRRWGDMLRAGAYRFWVSRLYDF
KHSE_BURTA      VTVNDWCVDLSTGALDAGRADALLRAYQTVRPFTTGERRHWGDMLRAGAYRFWVSRLYDF
KHSE_PARXL      VTVNDWCVDLATGKLDAARTEAMLRAYQTVRPFTAEENRHWGDMLRAGAYRFWVSRLYDF
KHSE_CUPNH      VTVNDWCIDLASGELDPARTQALLRAYHAVRPLTATEAAHWQDMLRAGALRFWVSRLWDF
KHSE_CUPPJ      VTVNDWCIDLASGELDNARAHAMVQAYHAVRPLSATEAAHWRDMLRAGALRFWVSRLWDF
KHSE_CUPMC      VTVNDWCIDLATGTIDMERAQAMLRAYHAVRPLTAVEAAHWQDMLRAGALRFWVSRLWDF
KHSE_RALSO      VTVNDWCVDLATGALDAERMRAMLRAYHAVRPFTDAEARHWRDMLRAAAYRFWVSRLWDF
KHSE_METFK      IAVNDWCVN-ADCTLDAVRVRAFLDAYHAIRPLTGEEHAAWPGMLRVAAMRFWLSRLNDL
KHSE_METGL      IAVXDWCVN-ADGTRDVGRVRAFLDAYHAVRPLTEEEHAAWPGMLRVAGIRFWLSRLNDL
KHSE_NEIMA      IAVNDWART-ADNKLDEALKKAFIGGYEGVRPLSAEEKAYFPTAQRAGCIRFWVSRLLDF
KHSE_NEIMB      IAVNDWART-ADNKLDEALKKAFIGGYEGVRPLSAEEKAYFPTAQRAGCIRFWVSRLLDF
KHSE_PSEAB      ITLNDWCSN-ADGSLDPARARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAA
KHSE_PSEAE      ITLNDWCSN-TDGSLDPARARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAA
                     *.               :.  *     :   *        : .  ** ::*    

KHSE_BRUA2      LTVPAGSFVVKKDPMEYVRRMRFHRQIESAAEYGLEMQGVAA
KHSE_BRUAB      LTVPAGSFVVKKDPMEYVRRMRFHRQIESAAEYGLEMQGVAA
KHSE_BRUME      LTVPAGSFVVKKDPMEYVRRMRFHRQIESGAEYGLEMQGVAA
KHSE_BRUSU      LTVPAGSFVVKKDPMEYVRRMRFHRQIESAAEYGLEMQGVAA
KHSE_CHESB      LTIPDGALVKKRDPLEYLRRLRFHRQVRTASEYGIELA----
KHSE_RHILO      LTVSDGGLVMKRDPTEYIRRMRFHRAIKSASEYGLA------
KHSE_RHIEC      LMTPEGAMVTKKDPLEYLHKLRFHRQIGSAAEYGLSL-----
KHSE_RHIL3      LTTPEGAMVTKKDPLEYLRKLRFHRQIKSPAEYGLSL-----
KHSE_AGRFC      LTTPAGALVVKKDPLEYLRKLRFHRTIANVAEYGLAGE----
KHSE_RHIME      LMTPPGALVVKKDPLEYLTKIRFHRAIVSSAEYGLRREEAPA
KHSE_BRASB      LNVPAGALVKPKDPLEYVRKLRFHQAVTSVRDYGLDGSGATA
KHSE_BRASO      LNVPAGALVKPKDPLEYVRKLRFHQAVTSARDYGIGASA---
KHSE_RHOP5      LNVPAGALVRPKDPLEYARKLRFHQSVNSIRDYGVETSGLVA
KHSE_RHOPB      LNVPAGALVRPKDPLEYARKLRFHQSVDSIRDYGVTASGVVA
KHSE_RHOP2      LDVPEGALVKPKDPLEYFRKLRFQQNVASIRDYGVEAAGAVA
KHSE_RHOPS      LDVPAGALVRPKDPLEYVRKLRFQQNVAGIRDYGVEAAGAVA
KHSE_BRADU      LNVPPGALVRPKDPLEYVRKLRFHQSVSSVRDYGLMPSGLVA
KHSE_RHOPA      LNVPEGALVKPKDPMEYVRKLRFQQNVAGIRDYGVEIAGAVA
KHSE_NITHX      LNVPAGALVKPKDPLEYVRKLRFQQSVGNIREYGVAASGLVA
KHSE_NITWN      LNVPAGALVKPKDPLEYVRKLRFQQRVGGVRDYGVAILGPVA
KHSE_MAGSA      LHTPPGAMVKRKDPMEYYRKLRFHQGVTGPGQYGIE------
KHSE_RHORT      LNTPPGAMVRPKDPMEYYHKLAFHRAVSGPGAYGLSR-----
KHSE_GRABC      LNTPPGAMVTRKDPMDYVHRLRFHLSAPNAGAYGL-------
KHSE_CAUVC      GSTPAGALVRPKDPLEYERKLAVHREGLVLFA----------
KHSE_ZYMMO      VNTPPDALVVPKDPRDFFKRLRFYREA-SLESLGF-------
KHSE_BURCA      YLPRAAEMLKPHDPGHFERILRERIAHTPALPEIQTACN---
KHSE_BURCH      YLPRAAEMLKPHDPGHFERILRERIAHTPALPEIQTACN---
KHSE_BURL3      YLPRAAEMLKPHDPGHFERILRERIAHTPALPEIQTACN---
KHSE_BURCM      YLPRAAEMLKPHDPGHFERILRERIANTPALPETHTACN---
KHSE_BURP0      HLPRAAQMLKPHDPGHFERILRERIAHAGALPETH-ACN---
KHSE_BURPS      HLPRAAQMLKPHDPGHFERILRERIAHAGALPETH-ACN---
KHSE_BURMA      HLPRAAQMLKPHDPGHFERILRERIAHAGALPETH-ACN---
KHSE_BURTA      HLPRAAQMLKPHDPGHFERILRERIAHAGALPETH-ACN---
KHSE_PARXL      HLPRAAELLKPHDPGHFERILRERLSGV-ALPGIHTSCN---
KHSE_CUPNH      YLPREADMLQPHDPTHFERILRRRIGADPASAPLPWI-----
KHSE_CUPPJ      YLPREADMLQPHDPTHFERILRRRLAMTADAAALAWI-----
KHSE_CUPMC      YLPREADMLQPHDPTHFERILRRRID---DAAALPWI-----
KHSE_RALSO      HLPRDAELLQPHDPTHFERVLRERVRAEGLTLDIPEPCN---
KHSE_METFK      YFPQAGELTHAKDPAYFERILKHSIAAREQILAVWVNAH---
KHSE_METGL      HFPQAGELIHAKDPAYFERILRKAIAAREQLLTMWVDS----
KHSE_NEIMA      HFPQAGEMTFIKDPN----------AFRNLLLSLG-------
KHSE_NEIMB      HFPQAGEMTFIKDPN----------AFRNLLLSLG-------
KHSE_PSEAB      E-AFAGQDVLIHDPAEFEMRLAQRQNVEIHLPFAL-------
KHSE_PSEAE      E-AFAGQDVLIHDPAEFEIRLAQRQNVEIHLPFAL-------
                           :**