CLUSTAL format seed alignment for MF_00302

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CLPS_ACIAC       ---------------MVRMATKPPSMTPTPPTGAPPRDDGGSVVLERRTQRTQPPQMYQV
CLPS_VEREI       ---------------MNFMATRAPTL---PPATRPAPDDGGAVVLERRPEKTPPPQMYQV
CLPS_BURP0       ----------------------MAII--------PDKQDS--SVLERKEQKLKPPSMYKV
CLPS_BURP1       ----------------------MAII--------PDKQDS--SVLERKEQKLKPPSMYKV
CLPS_BURMA       ----------------------MAII--------PDKQDS--SVLERKEQKLKPPSMYKV
CLPS_BURPS       ----------------------MAII--------PDKQDS--SVLERKEQKLKPPSMYKV
CLPS_CUPMC       ------------------MATRLANT--------PQRETG--TVIERKEQQLKPPAMYKV
CLPS_RALSO       ------------------MAIRQATT--------PQHDAG--TVLERKEQALKPPAMYKV
CLPS_BORBR       ------------------MSSTL--------------DTQHDVVVEKQPARTAPPPMYQV
CLPS_BORPA       ------------------MSSTL--------------DTQHDVVVEKQPARTAPPPMYQV
CLPS_BORPE       ------------------MSSTL--------------DTQHDVVVEKQPARTAPPPMYQV
CLPS_AROAE       ------------------MATQK--------------QDE--FLLETEQTRTKPPPLYKV
CLPS_CHRVO       --------------MKVDMSTSV--------------KDD--AQLEASRVRENPPPMYKV
CLPS_AERHH       ------------------MSKQKELFAN------------E-EIAEAEKTKLQPPPMYKV
CLPS_AERS4       ------------------MSKQKELFAN------------E-EIAQAEKTKLQPPPMYKV
CLPS_PHOPR       ------------------MSKLYEWIIP------------ESDVLDKEEVQVKPPAMYKV
CLPS_ALIF1       ------------------MSKLYEWISP------------DSDVLEQEKTELRPPSMYKV
CLPS_VIBVU       ------------------MSKNFEWITP------------DSDLLEKEITQIQPPKKYNV
CLPS_VIBVY       ------------------MSKNFEWITP------------DSDLLEKEITQIQPPKKYNV
CLPS_VIBPA       ------------------MSKNFEWVTP------------DSDLLERESTKVQPPKLYNV
CLPS_VIBCH       ------------------MSKNFEWISP------------DFDLLEKEKTAVKPPSMYHV
CLPS_ECOLI       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_SHIFL       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_ECO57       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_ECOL6       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_SHIBS       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_SHIDS       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_SHIF8       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_SHISS       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_ECOK1       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_ECOL5       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_ECOUT       ------------------MGKTNDWLDF------------DQLAEEKVRDALKPPSMYKV
CLPS_SALCH       ------------------MGKTNDWLDF------------DQLVEDSVRDALKPPSMYKV
CLPS_SALPA       ------------------MGKTNDWLDF------------DQLVEDSVRDALKPPSMYKV
CLPS_SALTI       ------------------MGKTNDWLDF------------DQLVEDSVRDALKPPSMYKV
CLPS_SALTY       ------------------MGKTNDWLDF------------DQLVEDSVRDALKPPSMYKV
CLPS_YERPE       ------------------MGKNNDWLNF------------EHLVKDKQIEALQPPSMYKV
CLPS_YERPS       ------------------MGKNNDWLNF------------EHLVKDKQIEALQPPSMYKV
CLPS_YERPA       ------------------MGKNNDWLNF------------EHLVKDKQIEALQPPSMYKV
CLPS_YERPN       ------------------MGKNNDWLNF------------EHLVKDKQIEALQPPSMYKV
CLPS_YERPP       ------------------MGKNNDWLNF------------EHLVKDKQIEALQPPSMYKV
CLPS_YERE8       ------------------MGKNNDWLNF------------EHLVKDKQIEALKPPSMYKV
CLPS_SODGM       ------------------MGKTSDRLDE------------QHLAEEQVKDAVRPPSMYKV
CLPS_PECAS       ------------------MGNNRTWSQS------------ESLTADQQKEKLQPPSMYNV
CLPS_PHOLL       ------------------MNEYHNSLKS------------KESVKDERQQKLQPPSMYQV
CLPS_PSEA6       ------------------MSKDNTINIE------------REKQLDTVKQKLAPPPMYKV
CLPS_IDILO       ------------------MSQFDHQHLS------------DTEE----KQELKPPSMYKV
CLPS_ALKEH       ------------------MTDKAGDWQE------------HGPQVEEAPPQVKRPPLFKV
CLPS_HALHL       ------------------MTDEPNQDDP------------QGPEVEAAKPSLKQPPMYKV
CLPS_XANC8       ------------------MPRKTSHEHD------------HGLVVETSKPEVAPPPRYQV
CLPS_XANCP       ------------------MPRKTSHEHD------------HGLVVETSKPEVAPPPRYQV
CLPS_XANOM       ------------------MPRNTSHEHD------------HGLMVEASKPEVAPPPRYQV
CLPS_XANOR       ------------------MPRNTSHEHD------------HGLMVEASKPEVAPPPRYQV
CLPS_XANAC       ------------------MPRNTSHEHD------------HGLMVEASKPEVAPPPRYQV
CLPS_XYLFA       ------------------MSQKTVHDQD------------NALLLETGNTKVAPPPRYQV
CLPS_XYLFT       ------------------MSQKTVHDQD------------NALLLETGNTKVAPPPRYQV
CLPS_METCA       ------------------MSQESDHGSG------------DGLALQEAQPKVKRPPLYKV
CLPS_MARHV       --------MRTIENSLLVFNQGEDEQPG----------RHEGVSVAPEKPALKRPARYRV
CLPS_ACIAD       ------------------MGDSQSDEPE----------GDIAVQTAP--PELKRPPLYAV
CLPS_PSE14       --------MHAFSKIRLTFNQDSPQSHE---------DDAAGIAVQDAKPTLQAPPMYKV
CLPS_PSEU2       --------MHAFSKIRLTFNQDDPQSHE---------DDSAGIAVQDAKPTLQAPPMYKV
CLPS_PSESM       --------MHAFSKIRLTFNQDGPQSHE---------DDSAGIAVQDAKPTLQAPPMYKV
CLPS_PSEF5       --------MHAISQIRLTFNQDRPDLHD---------DDSAGLAVQEAKPALQAPPMYKV
CLPS_PSEPK       --------MHAPSEIRLTFNQDRPQSNE---------DDGSGLAVQEAKPILQAPPMYKV
CLPS_PSEAB       --------MHAPSQIRLTFNQDHPEPHEH-------EDEGAGLAVQESKPVLQPPPLYKV
CLPS_PSEAE       --------MHAPSQIRLTFNQDHPEPHEH-------EDEGAGLAVQESKPVLQPPPLYKV
CLPS_LEGPA       ------------------MSKQNLEEIIQ-------TGIADTELSTEISTAIKRPRKYKV
CLPS_LEGPH       ------------------MSKQNLEEIIQ-------TGIADTELSTEISTAIKRPRKYKV
CLPS_LEGPL       ------------------MSRQNLEEIIQ-------TGIADTELSTEISTAIKRPRKYKV
CLPS_SHEDO       -------------------MGKTGSVEH---------------TKQRIESELMPPSMYKV
CLPS_SHEON       -------------------MGKTGNIEH---------------VEERVESELMPPSMYKV
CLPS_NITEU       ------------------MAADYRNPES---------------IIEKGRARLNPPPLYKV
CLPS_GLUOX       ---------MGPESPDSIPPHGPGNGDGD--------QDLDIGVVVRPRTRTRKPSMYKV
CLPS_ZYMMO       ---------MS------------GDKDFD--------KDSDVTVITRTTPQTKKPQPYKV
CLPS_MAGSA       ---------MQPRSKHTGMSENGNDKRDG--------DDGQTGVVIKTRPKTKKPSMYKV
CLPS_MARMM       ------------------MTERKHDDTG---------VEEGTGLATKTRPATKKPSLYRV
CLPS_CAUVC       --------MICPPGENKSMAERKQGGQG---------NGVGSSVVTEVKPKTQKPSLYRV
CLPS1_AGRFC      -----------MIAKPIYMQGEGDGEDGG--------TNRGTSVITRVKPKTKRPNLYRV
CLPS1_RHIME      -----------MIAMPVRMQQGSEGDGGG--------PSRGTSVITRTKPKTKKPSLYRV
CLPS1_RHILO      ------------------MQNGG-GDGNE--------AGRGTAVITRTKTKTKKPSLYRV
CLPS_BRUME       -----------MRRFNTIMQGKTNGGNG---------PESGTVVVTRTQPKTRKPSLYRV
CLPS_BRUSU       -----------MRRINTIMQGKTNGGNG---------PESGTVVVTRTQPKTRKPSLYRV
CLPS2_BRADU      ------------------MSNDENRSGSP--------TGPNTSVITKVKPKTKRPNLYRV
CLPS2_RHOPA      ------------------MAGDGGRSG-P--------STPSTSVITKTKPRTKRPNLYRV
CLPS_ROSDO       ----------------MHRDLHMMSDRSE--------DDGDTSILTATKPKTKRPPLYKV
CLPS_RUEPO       ----------------MTAQLHMMSDKHD--------QDNDASVLLQTRPRTKRPPLYKV
CLPS_RUEST       ----------------MLMQPLMMSDNPD--------DESDLGLLTKTRPRTQRPPRYKV
CLPS_BARHE       ------------------MHNEKGKNGDE--------YRHDAFIMPKMRSKLQKPKLYRV
CLPS_BARQU       ------------------MQNEKGKNWDE--------SRHDAVIIPKMRSKLQKPKLYRV
CLPS_BDEBA       ------------------MGNNKKDSNSN-----YPFASPEGEAGVQLVPKLDTPKMYKV
CLPS_DESAG       ------------------MSDRKLSTRE--------------DADVLLEEELKEPRRFRV
CLPS_DESVH       ------------------MSNGPLAPGY--------------DSDILVEDDVRLPRMYRV
CLPS_DESPS       ------------------MTEDKQQS----------------DSATIDDIETREPPMYRV
CLPS_DEIRA       ------------------MTRPTIPPGPP---------GAEGRTQTLERTETKKPRLWRV
CLPS_HELPJ       --------------------------MKM---------------HQIPT-----PTMSQV
CLPS_HELPY       --------------------------MKM---------------YNIPT-----PTMAQV
CLPS_CLOAB       ---------------MSLKTSFDENIKQK---------------HKIEK-----PKMYKV
CLPS_CAMJE       ------------------MPKT--QTLEQ---------------TKLSE-----PKMYKV
CLPS_CAMJR       ------------------MPKT--QTLEQ---------------TKLSE-----PKMYKV
CLPS_HELHP       ------------------MAHTAFETSLD---------------TLLEE-----PKMYRV
CLPS_NEIG1       ---------------------MTAQHQSD---------------TLLHRLNTLPPKRYGV
CLPS_NEIMB       ---------------------MTAQHQSD---------------TLLHRLNTLPPKRYGV
CLPS_NEIMA       ------------------MNHPNTDHQSD---------------TLLSDINTQPPKRYGV
CLPS_WOLSU       ------------------MVAKG-SDFET---------------EIKEEIIVAEPRRFKV
CLPS_TREDE       -------------------MELKKQAQKG---------------TIISEKFIE-PENYRV
CLPS_LEPBJ       ------------------MSDIFRFDTEE-------------QTLTKEKVKLKRPSKYRV
CLPS_LEPBL       ------------------MSDIFRFDTEE-------------QTLTKEKVKLKRPSKYRV
CLPS_LEPIC       ------------------MSDIFRFDTEE-------------QTLTKEKIKLKKPSKYRV
CLPS_LEPIN       ------------------MSDIFRFDTEE-------------QTLTKEKIKLKKPSKYRV
CLPS2_AGRFC      ------------------MSDSPVDLKPK--------------PKVKPK--LERPKLYKV
CLPS2_RHIME      ------------------MSDN--DVAAK--------------RLTKPK--LERPKLYKV
CLPS1_BRADU      ------------------MNDA--VTKPK--------------TRTKTK--VERPKLHKV
CLPS1_RHOPA      ------------------MSNI--DLKPK--------------TKAKAKIKVERPKLHKV
CLPS2_RHILO      ------------------MPEI--TTKPR--------------TKVKPQ--TERPKLYKV
CLPS_NOSS1       ------------------MSTAPTVTP-----------------ERSNQTVRKTYPNYKV
CLPS_SYNY3       -----------------MISNAATSTP-----------------DRLTSTVRKTYPNFKV
CLPS_THEEB       ---------------------MPSVVP-----------------QERQQVTRKHYPNYKV
CLPS_GLOVI       ---------------------MSTETL-----------------ER-KSVQRKPMPLYKV
CLPS_CORGB       -------------MSSPSAPLATPDVEL----------------DVHTLSSE--NLPWLC
CLPS_CORGL       -------------MSSPSAPLATPDVEL----------------DVHTLSSE--NLPWLC
CLPS_COREF       ------------MCSSPSAPTAEPDVEM----------------DVHTVSSE--NLPWLC
CLPS_CORDI       MYGATNDVNALGVVLSSSMATPSLDEEM----------------AVEVASSE--NLPWMC
CLPS_CORJK       -------------MTSPAAPAATPVADK----------------LPETLTEP--NLPWMC
CLPS_RHOJR       --MAHCSTTAPFVDAMPASPQVTPAESE----------------VVEIDEAN--DRPWVT
CLPS_NOCFA       --MGLCNTNLTL-----SAAQATPEAVE----------------YTEILEAE--DRPWVT
CLPS_MYCA1       ----------MVVMSAPTEPKSRPGTTG----------------QRESAPEDVTASPWVT
CLPS_MYCPA       ----------MVVMSAPTEPKSRPGTTG----------------QRESAPEDVTASPWVT
CLPS_MYCLE       -------MWVMVVTLAPIEPKVRPNTTW----------------QHESAPVDITAARWVT
CLPS_MYCBP       ----------MAVVSAPA----KPGTTW----------------QRESAPVDVTDRAWVT
CLPS_MYCTA       ----------MAVVSAPA----KPGTTW----------------QRESAPVDVTDRAWVT
CLPS_MYCTU       ----------MAVVSAPA----KPGTTW----------------QRESAPVDVTDRAWVT
CLPS_MYCBO       ----------MAVVSAPA----KPGTTW----------------QRESAPVDVTDRAWVT
CLPS_STRAW       -----------MGRVTAPAPLEIEKTES----------------AEEVFAVPEPDVPWVT
CLPS_STRCO       --------------------MEIEKTES----------------AEEVFAVPEPDVPWVT
                                                                             

CLPS_ACIAC       VMLNDDYTPMEFVIVVLQEFFG-KDREAATQIMLKIHLDGKGVCGVYSRDVAATKVEQVR
CLPS_VEREI       VMLNDDYTPMEFVIVVLQEFFS-KDRETATRIMLKIHLDGKGICGVYSHDVAATKVDQVL
CLPS_BURP0       VLLNDDFTPMEFVVMVVQEYFK-KDRETATQIMLKVHREGRGVCGVYTRDIASTKVEQVV
CLPS_BURP1       VLLNDDFTPMEFVVMVVQEYFK-KDRETATQIMLKVHREGRGVCGVYTRDIASTKVEQVV
CLPS_BURMA       VLLNDDFTPMEFVVMVVQEYFK-KDRETATQIMLKVHREGRGVCGVYTRDIASTKVEQVV
CLPS_BURPS       VLLNDDFTPMEFVVMVVQEYFK-KDRETATQIMLKVHREGRGVCGVYTRDIASTKVEQVV
CLPS_CUPMC       VLLNDDYTPMEFVVMILQQYFS-RDRETATQIMLTVHREGKGVCGIYTRDIAATKVELVS
CLPS_RALSO       LLLNDDYTPMEFVVMILQQYFS-KDRETATQIMLTVHREGRGVCGIYTRDIAATKVELVS
CLPS_BORBR       VLLNDDYTPMEFVVKVLQKFFG-KNSEDATRIMLQVHHEGRAVCGVYPRDLAATRIAQVS
CLPS_BORPA       VLLNDDYTPMEFVVKVLQKFFG-KNSEDATRIMLQVHHEGRAVCGVYPRDLAATRIAQVS
CLPS_BORPE       VLLNDDYTPMEFVVKVLQKFFG-KNSEDATRIMLQVHHEGRAVCGVYPRDLAATRIAQVS
CLPS_AROAE       LLLNDDFTPMDFVIVVLQKFFG-MDRERATRVMLQVHREGMGVCGVFPKDVAATKVEQVV
CLPS_CHRVO       LLLNDDFTPMDFVVQVLQQFFH-MNREKATHIMLQVHTQGHGVCGVYTKDVAATKVEQVL
CLPS_AERHH       VLNNDDYTPMEFVVEVLQKFFG-MDLDKATQVMLSVHYSGKGVCGTFTAEIAETKVVQVN
CLPS_AERS4       VLNNDDYTPMEFVVEVLQKFFG-MDLDKATQVMLSVHYSGKGVCGTFTAEIAETKVVQVN
CLPS_PHOPR       VLNNDDYTPMDFVIEVLQKFFS-MDMEKATQLMLNVHYEGKAICGTFTAEVAETKVAQVM
CLPS_ALIF1       VLNNDDYTPMEFVVEVLDKFFS-MDLEKATQLMLTVHYEGKAVCGTFTAEVAETKVAQVN
CLPS_VIBVU       VLNNDDYTPMDFVIDVLERFFS-HDLDKATQIMLKVHYEGKAICGTYSAEIAETKVAQVT
CLPS_VIBVY       VLNNDDYTPMDFVIDVLERFFS-HDLDKATQIMLKVHYEGKAICGTYSAEIAETKVAQVT
CLPS_VIBPA       VLNNDDYTPMDFVIEVLERFFS-HDIDKATQIMLKVHYEGKAVCGTYSAEIAETKVAQVT
CLPS_VIBCH       VLNNDDYTPMDFVIEILERFFS-MDIERATQVMLKVHYEGKAICGTFTAEVAETKVAQVT
CLPS_ECOLI       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_SHIFL       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_ECO57       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_ECOL6       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_SHIBS       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_SHIDS       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_SHIF8       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_SHISS       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_ECOK1       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_ECOL5       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_ECOUT       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_SALCH       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_SALPA       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_SALTI       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_SALTY       ILVNDDYTPMEFVIDVLQKFFS-YDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVN
CLPS_YERPE       ILNNDDYTPMEFVIDVLQKFFS-YDIERATQLMLNVHYQGKAICGVFTAEVAETKVAHVN
CLPS_YERPS       ILNNDDYTPMEFVIDVLQKFFS-YDIERATQLMLNVHYQGKAICGVFTAEVAETKVAHVN
CLPS_YERPA       ILNNDDYTPMEFVIDVLQKFFS-YDIERATQLMLNVHYQGKAICGVFTAEVAETKVAHVN
CLPS_YERPN       ILNNDDYTPMEFVIDVLQKFFS-YDIERATQLMLNVHYQGKAICGVFTAEVAETKVAHVN
CLPS_YERPP       ILNNDDYTPMEFVIDVLQKFFS-YDIERATQLMLNVHYQGKAICGVFTAEVAETKVAHVN
CLPS_YERE8       ILNNDDYTPMEFVIDVLQKFFS-YDIERATQLMLNVHYQGKAICGVFTAEVAETKVAHVN
CLPS_SODGM       ILINDDYTPMEFVIDVLQKFFS-YDVERATQLMLRVHYQGKAVCGIYTAEVAETKAVHVN
CLPS_PECAS       VLNNDDYTPMEFVIDVLQKFFS-YDIERATQLMLTVHYQGKAICGVFSAEVAETKVVQVN
CLPS_PHOLL       ILNNDDYTPMEFVVDVLRKFFS-YDIERATQLMLDVHYQGKAVCGVYTAEVAETKAAQVN
CLPS_PSEA6       LLNNDDYTPMDFVIEVLVRFFN-LDSEKAHQIMLTVHYRGRAVCGVYTAEIAETKVMQVT
CLPS_IDILO       IINNDDYTPMDFVIEVLMRFFK-MDQERATDTMLQVHYKGKAVCGVYSAEIAETKVVQVN
CLPS_ALKEH       IILNDDYTPMDFVVEVLQKFFH-MDRARATQVMLHVHTRGEGVCGVFSRDVAETKVNQVN
CLPS_HALHL       VLLNDDYTPMDFVVEVLQRFFN-KDRSQATQIMLHVHTRGKGVCGVYSRDVAETKVSQVN
CLPS_XANC8       LLLNDDYTPMDFVVTVLQQFFN-LELERATQVMLHVHTRGRGVCGVYSREVAESKVAQVN
CLPS_XANCP       LLLNDDYTPMDFVVTVLQQFFN-LELERATQVMLHVHTRGRGVCGVYSREVAESKVAQVN
CLPS_XANOM       LLLNDDYTPMDFVVTVLEQFFN-LNLEQATQIMLHVHTRGRGVCGVYSREVAESKVAQVN
CLPS_XANOR       LLLNDDYTPMDFVVTVLEQFFN-LNLEQATQIMLHVHTRGRGVCGVYSREVAESKVAQVN
CLPS_XANAC       LLLNDDYTPMDFVVTVLEQFFN-LNLEQATQIMLHVHTRGRGVCGVYSREVAESKVAQVN
CLPS_XYLFA       LLLNDDYTPMDFVIVVLQQFFA-MDLKKATQVMLHVHTRGCGVCGFYTREVAESKVAQVN
CLPS_XYLFT       LLLNDDYTPMDFVIVVLQQFFA-MDLKKATQVMLHVHTRGRGVCGFYTREVAESKVAQVN
CLPS_METCA       MLLNDDFTPMEFVVHVLMLFFG-MNEEKATQVMLHVHTRGVGVCGVFSKDVAETKVQQVN
CLPS_MARHV       VLLNDDYTPMDFVVDVLMKFFA-MNEEKATQVMLLVHTQGKAVCGVYTRDIAETKAAQVN
CLPS_ACIAD       VLLNDDYTPMDFVIEILQQYFA-LNLDQATQVMLTVHYEGKGVAGVYPRDIAETKANQVN
CLPS_PSE14       VLFNDDYTPMDFVVEVLEVFFN-LNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVN
CLPS_PSEU2       VLFNDDYTPMDFVVEVLEVFFN-LNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVN
CLPS_PSESM       VLFNDDYTPMDFVVEVLEVFFN-LNRELATKVMLAVHTEGRAVCGLFTRDIAETKAAQVN
CLPS_PSEF5       VLFNDDYTPMDFVVEVLEMFFN-LNRELATKVMLAVHTEGRAVCGLFTRDIAETKAMQVN
CLPS_PSEPK       VLFNDDYTPMDFVVEVLETFFS-LNRELATKIMLTVHTEGRAVCGLFTRDIAETKAMQVN
CLPS_PSEAB       VLFNDDYTPMDFVVEVLEVFFN-MDREKATKIMLTVHTQGKAVCGLFTRDVAETKAMQVN
CLPS_PSEAE       VLFNDDYTPMDFVVEVLEVFFN-MDREKATKIMLTVHTQGKAVCGLFTRDVAETKAMQVN
CLPS_LEGPA       LLLNDDYTPMDFVVEVLKHFFH-LNEEVAIQVMLQVHFQGKGVCGVFTRDIAETKVALVN
CLPS_LEGPH       LLLNDDYTPMDFVVEVLKHFFH-LNEEVAIQVMLQVHFQGKGVCGVFTRDIAETKVALVN
CLPS_LEGPL       LLLNDDYTPMDFVVEVLKHFFH-LNEEVAIQVMLQVHFQGKGVCGVFTRDIAETKVALVN
CLPS_SHEDO       ILNNDDYTPMDFVIEVLARFFD-KHEPQATDIMLTIHHQGKGICGVYPFGIAETKVLQVN
CLPS_SHEON       ILNNDDYTPMDFVIEVLQIFFR-KNEQEATDIMLTIHHQGKGICGIFPFGIAETKVIQVN
CLPS_NITEU       ILINDDFTPMDFVVKVLRHFFL-MNEEMATKVMLKIHIEGAGICGIYPSDIAVTKVQQVN
CLPS_GLUOX       LMLNDDYTPMEFVVHVLERFFA-KTRDEATSIMLQVHQRGVGICGVFTYEVAESKVTQVM
CLPS_ZYMMO       LMLNDDYTPMEFVVLCLQRFFR-MGIEDATKVMLQVHQRGVGICGVFTYEVAETKVNQVV
CLPS_MAGSA       LMLNDDYTPMEFVVHVLERFFN-KSREDATRVMLHVHTRGVGICGVYTYEVAETKVTQVM
CLPS_MARMM       LLLNDDYTPMEFVVEVLARIFR-KSPEDAARIMLHVHQNGVGMCGVYTYEVAETKVAQVM
CLPS_CAUVC       LILNDDYTPMEFVVYVLERFFN-KSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVI
CLPS1_AGRFC      LLLNDDYTPMEFVIHILERFFQ-KDREAATRIMLHVHQHGVGECGVFTYEVAETKVSQVM
CLPS1_RHIME      LLLNDDYTPMEFVIHILERFFQ-KNREEATVIMLHVHNHGVGECGVFTYEVAETKVTQVM
CLPS1_RHILO      LILNDDYTPMEFVVHVLERFFQ-KDREAATRIMLHVHNHGVGECGVYTFEVAETKVSQVM
CLPS_BRUME       LLLNDDYTPMEFVVHVLQRFFQ-KNLDDATRIMLHVHNHGVGECGVFTYEVAETKVSQVM
CLPS_BRUSU       LLLNDDYTPMEFVVHVLQRFFQ-KNLDDATRIMLHVHNHGVGECGVFTYEVAETKVSQVM
CLPS2_BRADU      LILNDDYTPMEFVVHVLEKFFQ-KDVEAATKIMLHVHHHGIGECGVFTYEIAETKVTQVM
CLPS2_RHOPA      LILNDDYTPMEFVVHVLEKFFQ-MDVEAATKVMLHVHHHGIGECGVFTYEIAETKVTQVM
CLPS_ROSDO       LLLNDDFTPMEFVVHVLERFFG-LNHAQAFEIMLTVHKKGVAVVGVFSHEIAETKVAQVM
CLPS_RUEPO       LLLNDDYTPMEFVVHVLERFFG-MNHAQAFEIMLTVHKKGVAVVGVFSHEIAETKVSLVM
CLPS_RUEST       LLLNDDYTPMEFVVIVLERFFG-LNHAQAFEIMLTVHKKGLAVVGVFSHEVAETKVAQVM
CLPS_BARHE       LLLDDDYTPMDFVIFVLKSFFK-KNFEEAMHIMLSVHQNGVGECGIYNYEVAEMKIIQVR
CLPS_BARQU       FLFNDDYTPMDFVVFVLKNFFK-KSFEEATHIMLNVHQNGVGECGIYSYEVAEMKVIQVR
CLPS_BDEBA       ILLNDDYTPMDFVVLVLRRFFA-KTEEQATEIMLDVHKKGAGVAGVFSLEIAEMKVMQVN
CLPS_DESAG       LLHNDDYTSMDFVVAVLIDIFR-KSREQAMSIMLSVHEKGIGVCGVYTAEVAETKVAMVH
CLPS_DESVH       LLHNDDYTTMEFVVSILVEVFR-KTAEQATAIMLAVHRDGVGECGVYTFEVAETKAAIVH
CLPS_DESPS       LIHNDDYTSMDFVVAILMQIFS-KTEAVAEEIMLTVHSSEVGVAGLYTHEIAETKVAIVH
CLPS_DEIRA       LLLNDDYTPMDYVVQVLEQFFR-KTEQEAELIMLAVHHKGQGVAGVYTRDVAETKVAQVT
CLPS_HELPJ       IMLNDSITTAEFMVSALRDFFD-KPLEEAQKLMLSIHRDGDGVCGVYPYEIAIYKAVCVR
CLPS_HELPY       IMVDDPITTTEFVISALRDFFD-KSLEEAKALTSSIHRDGEGVCGVYPYDIARHRAAWVR
CLPS_CLOAB       ILHNDDYTTMEFVIEILINVFN-KVPANAVKITFDVHKNGIGIAGVYPYDIAATKINEVK
CLPS_CAMJE       ILLNDDVTTMDFVIEILMNIFH-QNLEKASQTMLEIHHNGSGICGIYTQEIALSKQKKVM
CLPS_CAMJR       ILLNDDVTTMDFVIEILMNIFH-QNLEKASQTMLEIHHNGSGICGIYTQEIALSKQKKVM
CLPS_HELHP       LLLNDDWTAMDFVARILMEVFD-KTSDEATAITLKIHNDGKGVCGIYTYDIAELKMQIVS
CLPS_NEIG1       FLLNDDYTTMEFVVEILTEIFM-LGQEQAVAVMLSVHHEGKGLCGTYTRDIAQTKQQQVM
CLPS_NEIMB       FLLNDDYTTMEFVVEILTEIFM-LGQEQAVAVMLLVHHEGKGLCGTYTRDIAQTKQQQVM
CLPS_NEIMA       FLLNDDYTTMEFVVEILTEVFM-LAQEQAVAVMLLVHHEGKGLCGTYTRDIAQTKQHQVM
CLPS_WOLSU       ILLNDDYSTMDFVVEVLMVIFN-KNFDEALGVMLKVHNEGRGVCGIYPYDVAETKVSQVK
CLPS_TREDE       ILLNDDFTPMDFVVAVLISIFN-KSQEEAETLMFKVHKTGQASVGIYVYDIATTKCFQVL
CLPS_LEPBJ       IILNDDFTPMEFVVWILQFVFH-RSRAQSQQIMLKAHITGKALCGVYSHDVARTKVIQVQ
CLPS_LEPBL       IILNDDFTPMEFVVWILQFVFH-RSRAQSQQIMLKAHITGKALCGVYSHDVARTKVIQVQ
CLPS_LEPIC       IILNDDFTPMEFVVWILQMVFH-RSRAESQQIMLKAHITGKALCGVYSHDVARTKVAQVQ
CLPS_LEPIN       IILNDDFTPMEFVVWILQMVFH-RSRAESQQIMLKAHITGKALCGVYSHDVARTKVAQVQ
CLPS2_AGRFC      MLLNDDYTPREFVTVVLKAVFR-MSEDTGRRVMMTAHRFGSAVVVVCERDIAETKAKEAT
CLPS2_RHIME      LLVNDDFTPREFVVMVLKAVFR-MSEEAGYRVMMTAHKMGISVVVVCAKDVAETKAKEAT
CLPS1_BRADU      ILINDDYTPREFVTMILKAEFR-MTEDQAYKVMITAHKLGACVVAVFTRDVAETKATRAT
CLPS1_RHOPA      ILVNDDYTPREFVVSVLKGEFR-MTEDQATKVMLTAHQRGVCVVGVFTKDVAETKATRAT
CLPS2_RHILO      ILINDDFTPREFVVTVLKGEFK-LSEDQAHRIMITAHRRGVCVVAVFTKDVAETKATRAT
CLPS_NOSS1       IVLNDDFNTFQHVAECLVKYIPGMTGDLAWDLTNQVHYEGQAIVWVGPQEPAELYHQQLR
CLPS_SYNY3       IVLNDDFNTFQHVSDCLLKYIPGMTGDRAWELTNQVHFDGLAIVWVGPQEQAELYHQQLR
CLPS_THEEB       IVLNDDFNTFQHVAACLMKYIPNMTSDRAWELTNQVHYEGQAIVWVGPQEQAELYHEQLL
CLPS_GLOVI       LLHNDDHTPMNYVIEVLMKTIPKMQPSKARKIMLEAHNGGVAVVIVCALEHAEFYSESLN
CLPS_CORGB       IVWDDPVNLMSYVTYVFQTVLG-FSKKRATELMMQVHTEGKAVVSSGEKDKVEGDVKKLH
CLPS_CORGL       IVWDDPVNLMSYVTYVFQTVLG-FSKKRATELMMQVHTEGKAVVSSGEKDKVEGDVKKLH
CLPS_COREF       IVWDDPVNLMSYVTYVFQTVLG-YSRKRANELMMQVHTEGKAVVSSGEKDKVEGDVKKLH
CLPS_CORDI       IVWDDPVNLMSYVTYVFQTILG-YSKKRATELMMQVHTEGKAVVSSGERDKVEADVKKLH
CLPS_CORJK       ICWDDPVNLMSYVTYVFQTVLG-YSRKRATELMMQVHTEGKAVVSSGERDKVEGDVKKLQ
CLPS_RHOJR       VVWDDPVNLMHYVTYIFQKLFG-YSKAKATELMMQVHSEGKAVVSSGSRDKVENDVRKLH
CLPS_NOCFA       VVWDDPVNLMHYVTYIFQKLFG-YSKAKATELMLQVHNEGKAVVSSGSRDKMEHDVRRLH
CLPS_MYCA1       IVWDDPVNLMTYVTYVFQKLFG-YSEPHATKLMLQVHNEGKAVVSAGSREAMEVDVSKLH
CLPS_MYCPA       IVWDDPVNLMTYVTYVFQKLFG-YSEPHATKLMLQVHNEGKAVVSAGSREAMEVDVSKLH
CLPS_MYCLE       IVWDDPVNLMAYVTYVFQKLFG-YSEPHATKLMLQVHNEGKAVVSMGSRESMEVDVSKLH
CLPS_MYCBP       IVWDDPVNLMSYVTYVFQKLFG-YSEPHATKLMLQVHNEGKAVVSAGSRESMEVDVSKLH
CLPS_MYCTA       IVWDDPVNLMSYVTYVFQKLFG-YSEPHATKLMLQVHNEGKAVVSAGSRESMEVDVSKLH
CLPS_MYCTU       IVWDDPVNLMSYVTYVFQKLFG-YSEPHATKLMLQVHNEGKAVVSAGSRESMEVDVSKLH
CLPS_MYCBO       IVWDDPVNLMSYVTYVFQKLFG-YSEPHATKLMLQVHNEGKAVVSAGSRESMEVDVSKLH
CLPS_STRAW       IVHNDPVNLMSYVTYVFQTYFG-YSKDKATKLMLDVHHKGRAVVSSGTREEMERDVQAMH
CLPS_STRCO       IVHNDPVNLMSYVTYVFQSYFG-YSKDKATKLMMDVHHKGRAVVSSGSREEMERDVQAMH
                 .  :*  .   .:   .   :       .       *                       

CLPS_ACIAC       EAAHKAGHPLQCLSEPVE-----
CLPS_VEREI       DAALKAGHPLQCVSEPVA-----
CLPS_BURP0       THARQAGHPLQCVMEEA------
CLPS_BURP1       THARQAGHPLQCVMEEA------
CLPS_BURMA       THARQAGHPLQCVMEEA------
CLPS_BURPS       THARQAGHPLQCVMEEA------
CLPS_CUPMC       THARQAGHPLQCVMEEA------
CLPS_RALSO       THARQAGHPLQCVMEEA------
CLPS_BORBR       QYARARQHPLQCIMEPA------
CLPS_BORPA       QYARARQHPLQCIMEPA------
CLPS_BORPE       QYARARQHPLQCIMEPT------
CLPS_AROAE       AFARQHQHPLACVMEEN------
CLPS_CHRVO       QYAKAHQHPLQCVMEEN------
CLPS_AERHH       TYARNNEHPLLCTMEKA------
CLPS_AERS4       TYSRNNEHPLLCTMEKA------
CLPS_PHOPR       MHARENEHPLLCTMEKA------
CLPS_ALIF1       TYSRDNEHPLLCTMEQA------
CLPS_VIBVU       MYSRENEHPLLCTMEQA------
CLPS_VIBVY       MYSRENEHPLLCTMEQA------
CLPS_VIBPA       MYARENEHPLLCTMEQA------
CLPS_VIBCH       MYSRENEHPLLCTMEQA------
CLPS_ECOLI       KYARENEHPLLCTLEKA------
CLPS_SHIFL       KYARENEHPLLCTLEKA------
CLPS_ECO57       KYARENEHPLLCTLEKA------
CLPS_ECOL6       KYARENEHPLLCTLEKA------
CLPS_SHIBS       KYARENEHPLLCTLEKA------
CLPS_SHIDS       KYARENEHPLLCTLEKA------
CLPS_SHIF8       KYARENEHPLLCTLEKA------
CLPS_SHISS       KYARENEHPLLCTLEKA------
CLPS_ECOK1       KYARENEHPLLCTLEKA------
CLPS_ECOL5       KYARENEHPLLCTLEKA------
CLPS_ECOUT       KYARENEHPLLCTLEKA------
CLPS_SALCH       KYARENEHPLLCTLEKA------
CLPS_SALPA       KYARENEHPLLCTLEKA------
CLPS_SALTI       KYARENEHPLLCTLEKA------
CLPS_SALTY       KYARENEHPLLCTLEKA------
CLPS_YERPE       QYARENEHPLLCTLEKA------
CLPS_YERPS       QYARENEHPLLCTLEKA------
CLPS_YERPA       QYARENEHPLLCTLEKA------
CLPS_YERPN       QYARENEHPLLCTLEKA------
CLPS_YERPP       QYARENEHPLLCTLEKA------
CLPS_YERE8       QYARENEHPLLCTLEKA------
CLPS_SODGM       RYARENEHPLLCTLEKA------
CLPS_PECAS       RYARENEQPLLCTLEKA------
CLPS_PHOLL       MYAKEYGHPLLCTLEKV------
CLPS_PSEA6       QYAKKHQHPLMCTMEQV------
CLPS_IDILO       QYARENQHPLLCTMEQE------
CLPS_ALKEH       DWSRQHEHPLMCTLKEA------
CLPS_HALHL       DYAREHEHPLLCTMEEA------
CLPS_XANC8       EFSRMNQHPLLCTMEQA------
CLPS_XANCP       EFSRMNQHPLLCTMEQA------
CLPS_XANOM       EFSRMNQHPLLCTMEQA------
CLPS_XANOR       EFSRMNQHPLLCTMEQA------
CLPS_XANAC       EFSRMNQHPLLCTMEQA------
CLPS_XYLFA       EFSRIHQHPLLCTMKQA------
CLPS_XYLFT       EFSRIHQHPLLCTMKQA------
CLPS_METCA       AHARQNQHPLLCTMEEA------
CLPS_MARHV       QYSSECEHPLLCEIERAD-----
CLPS_ACIAD       NYARSQGHPLLCQIEPKD-----
CLPS_PSE14       QYARESQHPLLCEIEKDG-----
CLPS_PSEU2       QYARESQHPLLCEIEKDG-----
CLPS_PSESM       QYARESQHPLLCEIEKDG-----
CLPS_PSEF5       QYARESQHPLLCEIEKDG-----
CLPS_PSEPK       QYARESQHPLLCEIEKDG-----
CLPS_PSEAB       QYARESQHPLLCEIEKDS-----
CLPS_PSEAE       QYARESQHPLLCEIEKDS-----
CLPS_LEGPA       EYARMNQHPLLSSMEPE------
CLPS_LEGPH       EYARMNQHPLLSSMEPE------
CLPS_LEGPL       EYARMNQHPLLSSMEPE------
CLPS_SHEDO       QFARENQHPLLCTLEKA------
CLPS_SHEON       QFARQNQHPLLCSLEKA------
CLPS_NITEU       DFSRQNQHPLMCVMEKE------
CLPS_GLUOX       DLARQNQHPLQCTIEKD------
CLPS_ZYMMO       DFARQHQHPLQCTLEKA------
CLPS_MAGSA       DLARQNQHPLQCTIEKE------
CLPS_MARMM       DAARRAQHPLQCTMEKE------
CLPS_CAUVC       DSARRHQHPLQCTMEKD------
CLPS1_AGRFC      DFARQHQHPLQCVMEKK------
CLPS1_RHIME      DFARQHQHPLQCVMEKK------
CLPS1_RHILO      DFARQNQHPLQCVMEKK------
CLPS_BRUME       DFARQNQHPLQCVMEKK------
CLPS_BRUSU       DFARQNQHPLQCVMEKK------
CLPS2_BRADU      DFARKHQHPLQCVMEKK------
CLPS2_RHOPA      DFARKHQHPLQCVMEKK------
CLPS_ROSDO       DFARRHQHPLQCTMEKEE-----
CLPS_RUEPO       DFARRHQHPLQCTMEKED-----
CLPS_RUEST       DYARRHQHPLQCTMEKDD-----
CLPS_BARHE       ECARQNEHPLQCVMEWK------
CLPS_BARQU       ECAHQNEHPLQCVMEWK------
CLPS_BDEBA       QFAQLNQYPLKSTLEEEA-----
CLPS_DESAG       ARARAEGFPLRCSMEEV------
CLPS_DESVH       ARARREGYPLRCSTEEV------
CLPS_DESPS       QLAEQNEFPLRCSLEKE------
CLPS_DEIRA       AHAQREGHPLRVVAEPESEGE--
CLPS_HELPJ       DKARA-RFPLRLMVQEVK-----
CLPS_HELPY       DKAKALEFPLKLLVEEIK-----
CLPS_CLOAB       KLAYKNGYPLKLTMGEV------
CLPS_CAMJE       DAAKLANFPLQAKVEEE------
CLPS_CAMJR       DAAKLANFPLQAKVEEE------
CLPS_HELHP       QMAKQHGYPLRVITEEMP-----
CLPS_NEIG1       QRAKAEGHPLQCIVEEI------
CLPS_NEIMB       QRAKAEGHPLQCIVEEI------
CLPS_NEIMA       ERAKTEGHPLKCIVEEV------
CLPS_WOLSU       KKAEESGFPLRAILEEC------
CLPS_TREDE       TAAKNNNFPLQCKVEKV------
CLPS_LEPBJ       QLAEQHGYPLHCTMEVEE---ES
CLPS_LEPBL       QLAEQHGYPLHCTMEVEE---ES
CLPS_LEPIC       QLAEQHGYPLHCTMEVEEGEEES
CLPS_LEPIN       QLAEQHGYPLHCTMEVEEGEEES
CLPS2_AGRFC      DLGKEAGFPLMFTTEPEE-----
CLPS2_RHIME      DLGKEAGFPLLFTAEPEE-----
CLPS1_BRADU      DAGRAKGYPLLFTTEPEE-----
CLPS1_RHOPA      DAGRAKGYPLLFTTEPEE-----
CLPS2_RHILO      DAGKAKGYPLLFTTEPEE-----
CLPS_NOSS1       RAGLTMAPLEAA-----------
CLPS_SYNY3       REGLTMAPLEKA-----------
CLPS_THEEB       RAGLTMAPLEPE-----------
CLPS_GLOVI       RHNLTSTYEPDC-----------
CLPS_CORGB       TAGLWATMQQAG-----------
CLPS_CORGL       TAGLWATMQQAG-----------
CLPS_COREF       VAGLWATMQQAG-----------
CLPS_CORDI       TAGLWATMQQGG-----------
CLPS_CORJK       TAGLWATMQRADG----------
CLPS_RHOJR       AAGLWATMQHDGS----------
CLPS_NOCFA       AAGLWATMQRDD-----------
CLPS_MYCA1       AAGLWATMQQDR-----------
CLPS_MYCPA       AAGLWATMQQDR-----------
CLPS_MYCLE       AAGLWATMQQDR-----------
CLPS_MYCBP       AAGLWATMQQDR-----------
CLPS_MYCTA       AAGLWATMQQDR-----------
CLPS_MYCTU       AAGLWATMQQDR-----------
CLPS_MYCBO       AAGLWATMQQDR-----------
CLPS_STRAW       GYGLWATLQQDRK----------
CLPS_STRCO       GYGLWATLQQDRK----------