CLUSTAL format seed alignment for MF_00303

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TIG_BACHD       ------------------------------------------------------------
TIG_BACSU       ------------------------------------------------------------
TIG_LISIN       ------------------------------------------------------------
TIG_LISMO       ------------------------------------------------------------
TIG_STAAM       ------------------------------------------------------------
TIG_STRPN       ------------------------------------------------------------
TIG_STRP1       ------------------------------------------------------------
TIG_LACLA       ------------------------------------------------------------
TIG_OENOE       ------------------------------------------------------------
TIG_CLOAB       ------------------------------------------------------------
TIG_CLOPE       ------------------------------------------------------------
TIG_CALS8       ------------------------------------------------------------
TIG_MYCGE       ------------------------------------------------------------
TIG_MYCPN       ------------------------------------------------------------
TIG_HELPY       ------------------------------------------------------------
TIG_HELPJ       ------------------------------------------------------------
TIG_CAMJE       ------------------------------------------------------------
TIG_ECOLI       ------------------------------------------------------------
TIG_SALTY       ------------------------------------------------------------
TIG_YERPE       ------------------------------------------------------------
TIG_VIBCH       ------------------------------------------------------------
TIG_HAEIN       ------------------------------------------------------------
TIG_PASMU       ------------------------------------------------------------
TIG_PSEAE       ------------------------------------------------------------
TIG_PSYCK       ------------------------------------------------------------
TIG_NEIMA       ------------------------------------------------------------
TIG_NEIMB       ------------------------------------------------------------
TIG_RALSO       ------------------------------------------------------------
TIG_BRUME       ------------------------------------------------------------
TIG_RHILO       ------------------------------------------------------------
TIG_RHIME       ------------------------------------------------------------
TIG_CAUVC       ------------------------------------------------------------
TIG_RHOCB       ------------------------------------------------------------
TIG_AZOBR       ------------------------------------------------------------
TIG_RICCN       ------------------------------------------------------------
TIG_RICPR       ------------------------------------------------------------
TIG_NOSS1       ------------------------------------------------------------
TIG_SYNY3       ------------------------------------------------------------
TIG_SYNR3       ------------------------------------------------------------
TIG_MYCLE       ------------------------------------------------------------
TIG_MYCTU       ------------------------------------------------------------
TIG_CHLPN       ------------------------------------------------------------
TIG_CHLAB       ------------------------------------------------------------
TIG_CHLMU       ------------------------------------------------------------
TIG_CHLTR       -----------------------------------------------------------M
TIG_THEMA       ------------------------------------------------------------
TIG_PSELT       ------------------------------------------------------------
TIG_XYLFA       ------------------------------------------------------------
TIG_UREPA       ------------------------------------------------------------
TIG_MYCPU       ------------------------------------------------------------
TIG_DESAG       ------------------------------------------------------------
TIG_AQUAE       ------------------------------------MAELADAPDLGSGARKGVRVRLPP
TIG_EHRRG       ------------------------------------------------------------
TIG_BORBU       ------------------------------------------------------------
TIG_TREPA       ------------------------------------------------------------
TIG_DEIRA       ------------------------------------------------------------
TIG_ARATH       <SRLFQSDSVLQFGGRLKKPISRPLDMSCVSRKIGFFGDFMSHGGNFRLFAAASPAVETS
TIG_PELPB       ------------------------------------------------------------
TIG_BUCAI       ------------------------------------------------------------
                                                                            

TIG_BACHD       ---------MTAKWEKLEGNEGVLTVDVESAKVDEALDKAFKKVVKK----VNVPGFRK-
TIG_BACSU       ---------MSVKWEKQEGNEGVLTVEVDAETFKTALDDAFKKVVKQ----VSIPGFRK-
TIG_LISIN       ---------MSVKWEKQEGNVGKLTFEIEQEKVKEGLDRAFVKVRKT----LNVPGFRK-
TIG_LISMO       ---------MSVKWEKQEGNVGKLTFEIEQEKVKEGLDRAFVKVRKT----LNVPGFRK-
TIG_STAAM       ---------MTATWEKKEGNEGLLTVTVPAEKVNKALDQAFKKVVKQ----INVPGFRK-
TIG_STRPN       ---------MSVSFENKETNRGVLTFTISQDQIKPELDRVFKSVKKS----LNVPGFRK-
TIG_STRP1       ---------MSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKD----LNAPGFRK-
TIG_LACLA       ---------MTVSFEKTSDTKGTLSFSIDQETIKTGLDKAFNKVKAN----ISVPGFRK-
TIG_OENOE       ---MVDIIKTNATFKAGKGNKGTLSFEIPAKQISSGIDQAFNKQKDK----INIPGFRK-
TIG_CLOAB       ---------MNSKMEKLEKNVIKFEITVDESKFNEAVIKSYNKNRRR----FNVPGFRK-
TIG_CLOPE       ---------MEAKMNKIDTNVVELEIKVDAKDFNEALKKSYNKNSKK----FNIPGFRK-
TIG_CALS8       ---------MEFKVEKKGTNKAVIEVEVEPEKFEEGLQKSYLKNAKY----FKIPGFRP-
TIG_MYCGE       ------MKLYKVLNSKTTDKSLCLEVEIDPNYWQATQKKLVGEMAKS----IKIKGFRP-
TIG_MYCPN       ------MKQYKLVNTTQKEKTLCLEIAIDTKLWKETQQKQTQDLTKN----MKIKGFRK-
TIG_HELPY       ---------MNLEVKKIDTANARLSAKLSIENLEKRYDKIAQKIAQK----VKIDGFRR-
TIG_HELPJ       ---------MNLEVKKIDTANARLSAKPSIEDLEKRYDKIAQKIAQK----VKIDGFRR-
TIG_CAMJE       ---------MEVKAKQLDSVNATASVKIPSGMIKSEVENLAKKASKS----VKMDGFRP-
TIG_ECOLI       ---------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKK----VRIDGFRK-
TIG_SALTY       ---------MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKK----VRIDGFRK-
TIG_YERPE       ---------MQVSVETTQGLGRRVTITVAADSIEKAVKSELVKAAKN----VRIDGFRK-
TIG_VIBCH       ---------MQVTVETLEGLQRRLNITVPAANIEDAVAAELRNIAKN----RRFDGFRK-
TIG_HAEIN       ---------MSLNIETTQGLERRVAITVPTEIVSKAVREEFKRAAKN----VRVDGFRK-
TIG_PASMU       ---------MSFTIETTQGLERRVQITVPADTVEGAVREELKRVAKT----ARVDGFRK-
TIG_PSEAE       ---------MQVSVESTSALERRMTVGVPAERIETEVNKRLQQTARR----AKIPGFRP-
TIG_PSYCK       -----MATDLQVTTNKLSNKETQLTVKVPVEKIQNKVEGRIRQVAKT----AKIDGFRK-
TIG_NEIMA       --------MMSVTVETLENLERKVVLSLPWSEINAETDKKLKQTQRR----AKIDGFRP-
TIG_NEIMB       --------MMSVTVETLENLERKVVLSLPWSEINAETDKKLKQTQRR----AKIDGFRP-
TIG_RALSO       ---------MSTVIENLGKLDRKVTLAVPKAEVEQEKQSRLARLSKT----VKMSGFRP-
TIG_BRUME       ---------MQVTETLNEGLKREIKVVVPAGDLEAKLAERLETARGR----ARINGFRP-
TIG_RHILO       ---------MQVTETLNSGLKREIKITVPAGDMEAKLMARLSDARNK----VRINGFRP-
TIG_RHIME       ---------MQVIETLAQGLKRELKVVIPADEMQARMNERLVEVKDR----VRINGFRP-
TIG_CAUVC       ---------MQIVEKSGEGLSRVFGVTVPASELATRLEARIAEVAPQ----MNVKGFRP-
TIG_RHOCB       ---------MQVTQTLNEGLKRGYTITLTGAELDAKVTEKLIEVQPE----VEIKGFRK-
TIG_AZOBR       ---------MNITETSADGLKREYKVVISAQDIEQKVQGRLEELRRT----VQLPGFRP-
TIG_RICCN       ---------MGITILKNEGLDFHARISTPLSEIDDDIQKELLDLTKK----VKIAGFRA-
TIG_RICPR       ---------MGIIVLKNEGLNFHARISTPLSEIDDDIQKELLDLTKK----VKVAGFRA-
TIG_NOSS1       ---------MKVTQEKLPASQIGLEIEITPEITQKTYEQVIKNLSRT----VNIPGFRK-
TIG_SYNY3       ---------MKVTQEKLPDSQVGLEIEIPATASKKVYENVVKKLTRT----VNIPGFRR-
TIG_SYNR3       -----MTTALKVKTSSLPGSRLALEVGVPADRCKASYEAAVERLSRS----VRLPGFRK-
TIG_MYCLE       ---------MKSSVEQLNPTRVRINVEVPFTELEPDFQRAYKELARH----VQLPGFRP-
TIG_MYCTU       ---------MKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQ----VRLPGFRP-
TIG_CHLPN       MPRSLSNEQFSVDLEESPGCIVSALVKVSPEVLNKLNKQALKKIKKE----ITLPGFRK-
TIG_CHLAB       MSRNFSNEQFSVNLEEQPGCVVSAEVKTTPQLLDKLHKQAIKKIKKD----VILPGFRK-
TIG_CHLMU       --------MFSINIEETAGCVVSAKVQANPLVTQKCHKEALKTVKKN----VVLPGFRK-
TIG_CHLTR       SSRDFSNDLFSINIEENAGCVVSAKVQANPLVTQKCHKEALKTVKKN----VVLPGFRK-
TIG_THEMA       ---------MEVKELERDKNRVVLEYVFGAEEIAQAEDKAVRYLNQR----VEIPGFRK-
TIG_PSELT       ---------MERVVKTEDKNMVVCEYTFTKDEIEEAEEVALRQVVNR----VEIPGFRK-
TIG_XYLFA       ---------MPVLIESIGNLERRLTFSVPEDRLESHVDERLREIART----ARINGFRA-
TIG_UREPA       ---------MKLLNKIKNENAIEFQILIEKSEWEKKHKESFEKIAKKTASKLKIPGFRP-
TIG_MYCPU       ---------MSIKTYDKENSEIHVKTPVESTLWKQSQKKAFNKLKSK----INIPGFRKN
TIG_DESAG       ---------MEYNVEDLSPVKKKITITVPVEEVNAALAATIAVYQTS----VNLSGFRK-
TIG_AQUAE       PAPHKNGGKNESRGSGQGSLFKALTVEIQGDSVKEKIDEMYKQLQKT----VQIQGFRK-
TIG_EHRRG       ----MLSNYVVKEILNDNKLKREYEFTIDNKYFFSQLDAKLLEIAKN----VKIPGFRA-
TIG_BORBU       -------MILSKDIKLLPGSKVEVVIRVSKNVIQEKYNSLLQDYSSR----LKIQGFRI-
TIG_TREPA       -------MELQKKFTALAQSQVELEVVVAREDAQRHYQRFVEEYLER----ARLPGFRK-
TIG_DEIRA       ----------MAELISKEGNKVEFKVSVPAAEVNRAYDQVWAGLARD----VRVPGFRP-
TIG_ARATH       VKEDKLPADLKVTETVQANSSVKLSVEVPEIVCEDCYQRVLTEFMKL----SKVPGFRPK
TIG_PELPB       ---------MQKNIKNVSETEQELEIILSAEEFGTEYNQELEEAKRN----IQIKGFRK-
TIG_BUCAI       ---------MNFFMEKNKDAGHRVTIKIPKTTVNNSLLQEFIKIRKT----TKINGFRK-
                                                                       ***  

TIG_BACHD       GKVPRKIFERQF---GVEALYQDALDILLPEAYAAAIDETGIEPVD-----RPEIDIEQ-
TIG_BACSU       GKIPRGLFEQRF---GVEALYQDALDILLPVEYPKAVEEAGIEPVD-----RPEIDVEK-
TIG_LISIN       GKVPRQIFNQRF---GEEALYQDALDILLPEVYSQAIDEAGIDPVD-----TPQVNIES-
TIG_LISMO       GKVPRQIFNQRF---GEEALFQDALDILLPEVYSAAIDEAGIDPVD-----TPQVNIES-
TIG_STAAM       GKVPRPIFEQRF---GVEALYQDAIDILLPDAYGEAIDETDIKPVA-----QPEVSVTQ-
TIG_STRPN       GHLPRPIFDQKF---GEEALYQDAMNALLPNAYEAAVKEAGLEVVA-----QPKIDVTS-
TIG_STRP1       GHMPRPVFNQKF---GEEVLYEDALNIVLPEAYEAAVTELGLDVVA-----QPKIDVVS-
TIG_LACLA       GKISRQMFNKMY---GEEALFEEALNAVLPTAYDAAVKEAGIEPVA-----QPKIDVAK-
TIG_OENOE       GHVSKELFLARF---GEEALYEDALNAILPDIYDQAVNEADITVVG-----QPQIIPDD-
TIG_CLOAB       GKAPLNIIKNYY---GVGVLYEDAINFCIDDTYPEVIKENDIHPVA-----YPEIDIVT-
TIG_CLOPE       GKVPMNMVKKFY---GVEVLFDDAINACIDKTYGVALEENNVRPVD-----YPQIEVVE-
TIG_CALS8       GKAPRSLIERAY---GEEVFYDDAIDYVLNETYPKVIEESKLEVVS-----RPEVDIVQ-
TIG_MYCGE       GKIPPNLASQSI---NKAELMQKSAQNVMNSIYESVQQEEIVASNDNVIDDYPTIDFKT-
TIG_MYCPN       GKVPPTLAKDYL---DRAELLQRSAQAVIDAIFQPLQQEAVIADNENVIEDFPTIDFKT-
TIG_HELPY       GKVPLSLVKTRY---QAQ-IEQDAQEEMIQEVLKNAFKELGIENKD---LIGSPNLTKF-
TIG_HELPJ       GKVPLSLVKTRY---QAQ-IEQDAQEEMIQEVLKNALKELGVETKD---LIGSPNFTKF-
TIG_CAMJE       GKVPVSAVLKRY---ERE-LTQDAEQNLFKSAVNSALQELKKENKE---LVGEPYFEKF-
TIG_ECOLI       GKVPMNIVAQRY---GAS-VRQDVLGDLMSRNFIDAIIKEKINPAG-----APTYVPG--
TIG_SALTY       GKVPMNIVAQRY---GAS-VRQDVLGDLMSRNFVDAIIKEKINPAG-----APNYVPG--
TIG_YERPE       GHVPMNIVEQRY---GAS-VRQDVLGDLMQRNFVDAIIKEKINPAG-----APNYVPG--
TIG_VIBCH       GKVPMKMVAKMY---GKA-VRQDVLGEVMQRHFIEAIVKEKINPAG-----APTFAPV--
TIG_HAEIN       GHVPAHIIEQRF---GAS-IRQDVLNDLLPRHFFNAVIAEKINIAG-----RPTFAIE--
TIG_PASMU       GKVPPHIIEKRF---GAS-VRHDVLGDVLQSHFFNVVMEQKVNLAG-----RPAFAVE--
TIG_PSEAE       GKVPMSVIRQRY---EAS-ARQEAMGDLIQETFYEAVVEQKLNPAG-----SPSVEPK--
TIG_PSYCK       GNVPMSHIRSQY---GAG-IQQEVINDVIRDTVFEAIKSEDIRAVG-----MPNIDDV--
TIG_NEIMA       GKAPLKMIAQMY---GAS-AQNDVINELVQRRFHDVAVAQELKVAG-----FPRFEGVE-
TIG_NEIMB       GKAPLKMIAQMY---GAS-AQNDVINELVQRRFYDVAVAQELKVAG-----FPRFEGVE-
TIG_RALSO       GKVPMKMVEKQY---GQQ-VEMEVRFDKAARQFFDITNEQGVKVAG-----QPRFELKS-
TIG_BRUME       GKVPTAHLRKMY---GKS-FMAEIVNEILNDSSRSILAERNEKSAT-----QPEVIMSED
TIG_RHILO       GKVPVQHLRKVY---GKS-FMAEVVNEILNDSTRSIITGRGEKAAM-----QPEVIMTED
TIG_RHIME       GKVPVAHLKKVY---GKS-IMADLVNEIVREKPTEILTSRGEKSAT-----QPEIAMTED
TIG_CAUVC       GKVPTAHVRRLY---GKA-LMGEVIEQALNETTTKVLEDNKLRPAG-----QPELNPSSD
TIG_RHOCB       GKVPMAMLRKNF---GDR-VLGDVLNESVDGAIKDLLDQSGDRPAL-----QPKVEMEN-
TIG_AZOBR       GKVPVAVIKQRY---GGS-VLAEALEDAIADSSRQALNERGLRIAM-----QPKINVEK-
TIG_RICCN       GKVPVSIVKKKY---GTS-VRNDIIERRINNSVNHVIKEHNLNIIG-----RPKIEELQN
TIG_RICPR       GKVPVSIVKKKY---GTS-VRHDIIEKRINNLVNHIIKEYNLNIIG-----RPKIEELQN
TIG_NOSS1       GKVPRQVLLQRL---GKTHIKAAALEELLQDGIEQAIKQESIAAIG-------QPRLRSS
TIG_SYNY3       GKVPRAIVIQRL---GQSYIKATAIEELIDDSIKAAVKQEELPIIG-------NFSLRSD
TIG_SYNR3       GRVPKPVLLQQI---GPLRVKASALEDLVDSVLRDAVEQEKVEVLG-------QPSLSGN
TIG_MYCLE       GKVPARLLEARFGR-ETL--LDQVVNEAMPSRYGQALAESEVQPIG-----QPEIEVIR-
TIG_MYCTU       GKAPAKLLEARIGR-EAM--LDQIVNDALPSRYGQAVAESDVQPLG-----RPNIEVTK-
TIG_CHLPN       GKAPDDVIASRYPT-NVRKELGELVTQDAYHALSTVGDRRPLSPKA-----VRSNSITQ-
TIG_CHLAB       GKAPDGIIVSRYPS-QVTKELNQLLIQSAYQALASVGDRRPLSPQA-----IKSTSVTK-
TIG_CHLMU       GKAPDNIIEARYAT-QVEQELRRFLLRASFEALSQMCDRKPLSPKA-----VRSSTVDS-
TIG_CHLTR       GKAPDNIVESRYST-QMEQELRRLFLRASFEALSQMCDRKPLSPKA-----VRSSAIDT-
TIG_THEMA       GRIPKNVLKMKLGE-EFQEYTLDFLMDLIPDTLKDRK-LILSPIVT-------ERELKD-
TIG_PSELT       GRAPKQIVRSRYPE-TVKSEMIDFFWQKIVKQIDEQENMLLPPILV-------DFELSN-
TIG_XYLFA       GKVPAKVIEQRF----GEKVRAEVLDSLLRETLDSAIRAHSLRLAG-----AARIDHAN-
TIG_UREPA       GKVPVEEAKKHV---NEIEVFETTTNDLIPQVLTFLEQDESFINDDSETVDTPSVDILD-
TIG_MYCPU       SSSPQFDKIARAKI-SKNDIWAKAIDETLNSTFEIARKELDKEDLE------RILGRAN-
TIG_DESAG       GKVPASIIEGRF----RKEVYNEATQDLVNVHINEVVGSLDTQPAS-----RIDFDGGQ-
TIG_AQUAE       GKAPLWIVRAKY----KDYVEEEVGKKIADETLQKALEEANLKPVADVFLEKVEVDEKE-
TIG_EHRRG       GKASIDLIKKEYLN-NAVNTLIRKIVEDTSSEFIKNGKFGEIISSNVSVISCPDYGMGVS
TIG_BORBU       GKVPINVIENKY----SEGLKATVLEEVINNSFKEFFKEESKIPLS---YATPTVKEKN-
TIG_TREPA       GKVPLAVLERKYGSAIRQDAAAALMEKALEEGFAQASQDSQPLPIS-----RPSLKKKP-
TIG_DEIRA       GKAPRKVIENRV---GKGYVESQVRDRLLETHYSQGLRELGLNLVD------ATVDPQD-
TIG_ARATH       TRVPENIIVGFV---GRQYVLRATVESILKRTLPHAMESVTGRALK------DSIQIVSS
TIG_PELPB       GHAPASLIKKLA----GPSIEATVAEKMASKYFGEIADAEKIKPAS-----RAQIIDVA-
TIG_BUCAI       GKTPIRVIQEKY----GSAIYYDIFKKLMQKFFHEFIKTEKIKIIG-----SPKFYIHQD
                   .                                                        

TIG_BACHD       -------MEQGNNLIFKATVTVKPEVQLG---DYKGLEFEEK--DTTVSDEDVEQELKSL
TIG_BACSU       -------IEKGESLIFTAKVTVKPEVKLG---EYKGLGIEKD--DTTVTDEDVQNELKAL
TIG_LISIN       -------MEKGETWVLTADVTVKPEVKLG---DYKGLEVEKR--ETELTTEELEAELKQL
TIG_LISMO       -------MEKGETWVLTAEVTVKPEVKLG---DYKGLEVEKR--ETELTTEELEAELKQL
TIG_STAAM       -------IEKGKDFIFEATVTVEPEVKLG---DYKGLEIEKQ--ETELSDDELQEAIDHS
TIG_STRPN       -------MEKGQDWVITAEVVTKPEVKLG---DYKNLEVSVDV-EKEVTDADVEERIERE
TIG_STRP1       -------MEKGKEWTLSAEVVTKPEVKLG---DYKNLVVEVDA-SKEVSDEDVDAKIERE
TIG_LACLA       -------MEKGSDWELTAEVVVKPTVSLG---DYKDLTVEVEA-TKEVSDEEVETRLTNS
TIG_OENOE       -------LKHGGPSKIHAEVTLAPTVELG---DYKGVEVEKE--SDEVSDKELNAELERL
TIG_CLOAB       -------LEEGKDFVYTAKVTVKPEVELG---EYKGVEVTKV--EYPVTDEDVENELKGM
TIG_CLOPE       -------VGEGKDLVYKAKVTTYPEVTLG---DYKGLEVEEV--SYEVKEEDIEKQLADM
TIG_CALS8       -------VGKGKSFIYKAEVYIKPEFGLG---EYKGVEIKKI--EYPVAEEEVEHELEHL
TIG_MYCGE       -------ITE-QNCVLLFYFDLIPNFQLP---DYKKIKDLTP--LTKLTEAEFNNEIEKL
TIG_MYCPN       -------INE-NDCVILFDFDLVPQFEPP---DYKHIKDLSP--IVPLKDEEFNKELHNI
TIG_HELPY       -------EKKDTHFEIEADIGLKPTIVLD---KIKECVPSVG--VEVPNEEKIDERLKQL
TIG_HELPJ       -------EKKDTHFEIEADIGLKPTIVLD---KIQECVPSVG--VEVPNEEKVNERLKQL
TIG_CAMJE       -------DRKDGEIIAELILSFKPEIKLE---GYEKLIPEYQ--TPKVSKKEIDEKKDEL
TIG_ECOLI       ------EYKLGEDFTYSVEFEVYPEVELQ---GLEAIEVEKP--IVEVTDADVDGMLDTL
TIG_SALTY       ------EYKVGEDFTYSVEFEVYPEVELT---GLESIEVEKP--VVEVTDADVDVMLDTL
TIG_YERPE       ------EYKQGEDFTYSVEFEVYPEVELK---DLESIEVEKP--VVEVNDADVDTMLETL
TIG_VIBCH       ------EIGEGKDLVFTATFEVYPEVELK---GLENIAVEKP--AAEVTDADVAEMLETL
TIG_HAEIN       ------TFEEGKDLVFTATFEVYPEVKLQ---GLENIKVEKP--TVEITEADIDKMIDVL
TIG_PASMU       ------QFEAGKDLVFTATFEVYPEVALQ---GLDQIKVEKP--VVEISEADIDKMIDVL
TIG_PSEAE       ------SFEKGKDLEYIATFEVFPEFTVS---GLEDIKVERL--QAEVSDADVDNMLDVL
TIG_PSYCK       ------KLED-DFLVYQATVEIFPEVDVQ---GINEIEVERH--TAKVDEADVDTMIENL
TIG_NEIMA       ------EQDDKESFKVAAIFEVFPEVVIG---DLSAQEVEKV--TASVGDAEVDQTVEIL
TIG_NEIMB       ------EQDDKESFKVAAIFEVFPEVVIG---DLSAQEVEKV--TASVGDAEVDQTVEIL
TIG_RALSO       ------EGVADDQFAFDATFEVYPEVKIG---DLAGAELTRT--KTEITDAEIDKTIDIL
TIG_BRUME       EKEAEKVLDGKADFVFSLNYEVLPAIEVK---DFSKIAVTRE--VVDISDEEVDEQVKRI
TIG_RHILO       EKEAEKILAGGTDFEFRLNYEVIPAIEIK---DFSDIKVTRQ--VFDVPDAEIDDQVKRV
TIG_RHIME       EAEADKILNAQADFEFTVAYEIIPPIELK---DASGIKVTRE--VVDVSEDEVNEQIQRI
TIG_CAUVC       ---MDKVIAGGEDLSFDLAVEVMPEFEPI---DPTSIELVKP--VYKVSDEEVQEALDEL
TIG_RHOCB       ----GKDWKPGTDAIFTVSYEALPPIPAF---DRATVTLERL--VVKADEASVTEALENL
TIG_AZOBR       -------YEDGGDLSYTMGVELLPDIEPG---DLSGLELEKP--VATVEDSAVDEALTRL
TIG_RICCN       --------ESDKALEFTVKIELLPKITIP---DLKKISLDRP--KLEVNSKDVEEQLEKL
TIG_RICPR       --------EPDKDLEFTVKIELLPKITIP---DLKKISLDRP--KLAVNSQDVEIQLEKL
TIG_NOSS1       FDDLINSYEPGQPLTFTAAVDVEPEINLV---QYTGLEAKAE--EIKYDPARVDEVLEKE
TIG_SYNY3       MENLIQIFDPEAPLTIKVAADVFPEAEYEPE-SYKKITAQAE--EIEYSADAVDQWLKGE
TIG_SYNR3       FEELLEKFDPAKELVVTLEMDVAPTPTLK---STKGLSAEAE--SVAYDPARVDELLDQS
TIG_MYCLE       -------KEYGQDLAFTVEVEVRPKIALP---DFSTLKVVVDP--VEVSTDDVEAELRSL
TIG_MYCTU       -------KEYGQDLQFTAEVDIRPKISPP---DLSALTVSVDP--IEIGEDDVDAELQSL
TIG_CHLPN       -------FDLQEGAKVEFSYEAFPAISDL---PWENLSLPQEEAASEISDSDIEKGLTNI
TIG_CHLAB       -------ADINEGGQVNFTYEAFPTISDI---PWDKLSLSEEPAVKDITDEEMEKGLQNI
TIG_CHLMU       -------CNAADGGVVSFLYEAFPVIPSL---PWEQLNLSDPEPVKEISDEDLENGLKNV
TIG_CHLTR       -------CNPVNGGSVSFLYEAFPVIPSL---PWEQLSLPDPEPVKEISEEDLENGLKNV
TIG_THEMA       -----------VTARVVVEVHEEPEVRIG---DISKIEVEKVD-EEKVLEKYVERRIEDL
TIG_PSELT       -----------NRARMTIEVHRLPDVEIK---PFEDFELKKVD-KPSVMKDYIERKLKEL
TIG_XYLFA       ----------EGRLNFVATFEVVPDFGEI---DVSKFSVVRR--TARVTDVDIDQMIENL
TIG_UREPA       --------FKDGELSLKVVYDLYPVATIE---SYNDLILTPI--VNEAFEHEVNAEIEHA
TIG_MYCPU       -------YRVSKITEDEAEIEFFWPVRPEIE-DFKYKNLNVKFKEVKVTKKDIDQRIQSL
TIG_DESAG       -------LERDKEFVYTISFEVMPVFEMP---DYDGMEVEQE--KPEVDENEVNAVLERI
TIG_AQUAE       -----------GKVKYVVSFEVAPEFELK---DVENLEVEVP--KIEFKEDYVKEELERL
TIG_EHRRG       STS---GDPAGDNLVYKLSFEVMPEAPLI---ALDDIVLSDI--EADIQDSDISEFIENL
TIG_BORBU       -----LKLNLDKDFEFTFTYETYPEFKIP---SFDEIDIKVEIPEVFIDDSDIDDEIKNL
TIG_TREPA       ------VFDPDEDFSFAVIYDVFPSVELR---NTSGFSLSVP--TVSVTEEDVSRELTRI
TIG_DEIRA       -------VQSGQAFEFTVKGETYPEVKLG---DWQGLKVSAQ--APEITDEVLEQTLSDL
TIG_ARATH       FPDMEKAYSKLKTLSYEVVVDVVPELKWNPEDGYKNMKVVVELGDEIDAKKACERQLRQK
TIG_PELPB       --------FAPEELKITLAYEIHPEFEVK---DFSGYTFTQN--RYVITDEDITREINLI
TIG_BUCAI       ------EDKKKEYFEYSVIYELYPQFQIK---DIKQIKVNKI--NVEITEEDIKKNIETN
                                                                            

TIG_BACHD       QERQAELVVV---------EEEAIQEGDTAVLDFEGFVDG----------EAFEGGKAEN
TIG_BACSU       QERQAELVVK---------EEGAVEEGNTVVLDFEGFVDG----------EAFEGGKAEN
TIG_LISIN       QERQAELVVK---------EDAPAENGDTVILDFEGFKDG----------VAFEGGQAEN
TIG_LISMO       QERQAELVVK---------EDAPAENGDTVILDFEGFKDG----------VAFEGGQAEN
TIG_STAAM       LGHLAEMVVK---------EDGVVENGDTVNIDFSGSVDG----------EEFEGGQAEG
TIG_STRPN       RNNLAELVIK----------EAAAENGDTVVIDFVGSIDG----------VEFDGGKGEN
TIG_STRP1       RQNLAELIIK----------DGEAAQGDTVVIDFVGSVDG----------VEFDGGKGDN
TIG_LACLA       QNNLAELVVK----------ETAAENGDTVVIDFVGSVDG----------VEFEGGKGSN
TIG_OENOE       QKGEAELVPAK--------EDQVSEKGDTVVIDFDGSVDG----------KQFDGGKAQN
TIG_CLOAB       QEKNARIELKE--------DGEAVEKGDIAVIDFKGYVDD----------VAFEGGEGKD
TIG_CLOPE       QARNARVETKE--------EG-TVENGNIAVIDFKGFIDD----------VAFEGGEGKD
TIG_CALS8       REENARFISVD--------RE--VQNGDIVTIDFEGFVDG----------ESIENGSAQD
TIG_MYCGE       AKTKSTMVDV---------SDKKLANGDIAIIDFTGIVDN----------KKLASASAQN
TIG_MYCPN       EKNKGKLVDV---------SDKALANNDIAVIDFVGKVDG----------KVLESATAKQ
TIG_HELPY       AKDYAKFVDTN--------TQRKAQNDDKLTIDFEGFIDN----------APFEGGKAEN
TIG_HELPJ       AKDYAKFVDTD--------SQRKAQNDDKLTIDFEGFIDN----------APFEGGKAEN
TIG_CAMJE       LKRFATPEAIK--------TKRALKEGDFAKFDFEGFVDD----------KAFEGGKAEN
TIG_ECOLI       RKQQATWKEK----------DGAVEAEDRVTIDFTGSVDG----------EEFEGGKASD
TIG_SALTY       RKQQATWKEK----------DGAADAEDRVTIDFTGSVDG----------EEFEGGKATD
TIG_YERPE       RKQQATWKET----------DAAATAEDRATLDFTGSIDG----------EEFEGGKATD
TIG_VIBCH       RKQQATWKEV----------DEAAENGKRVSIDFVGSIDG----------VEFEGGKAEN
TIG_HAEIN       RKQQATWAES----------QDVVKADDRVTIDFVGSVDG----------EEFEGGKATD
TIG_PASMU       RKQQATWAET----------AEAASAEDRVVIDFVGSVDG----------EVFEGGKAED
TIG_PSEAE       RKQNTRFEVV----------ERAAQNDDQLNIDFVGKIDG----------EAFAGGSAKG
TIG_PSYCK       QKQREEFVEK----------KGKADKGNQVTFDFEGSIDG----------EKFEGGSAED
TIG_NEIMA       RKQRTRFNHV----------EREARNGDRVIIDFEGKIDG----------EPFAGGASKN
TIG_NEIMB       RKQRTRFNHV----------EREARNGDRVIIDFEGKIDG----------EPFAGGASKN
TIG_RALSO       RKQRVHYHPRGEAGDHGDGGEAVAQNGDRVTVDFVGTIDG----------VEFAGGKAEG
TIG_BRUME       ASSTRTFETKK----------GKAENEDRVTIDYLGKLDG----------EPFEGGADND
TIG_RHILO       AESARSYEPKT----------GKAAEGDRVSIDYVGKIDG----------EAFAGGAGTD
TIG_RHIME       AESARTYESKK----------GKAANGDRVTVDYLGKVDG----------EAFDGGKDED
TIG_CAUVC       AKQARTYEPRTG-------KSLKAKDGDQLLIDFVGTIDG----------VEFAGGKAEG
TIG_RHOCB       AKSAQAFEDRK--------KGTKAKDGDQVVIDFEGFLGD----------EPFEGGKGEE
TIG_AZOBR       ASAHSVQAPVT--------EDRAAEKGDIAVIDSPVRSTG----------EALPGMDGKD
TIG_RICCN       AALTKNYTKES---------KAKIKDGDQVTIDAIGYIKE----------KAFEDGKLND
TIG_RICPR       AALTKCYTKES---------KTKIKDGDQVTIDAIGYIKD----------RAFDGGKLND
TIG_NOSS1       RQELATLIPVE---------GRSAQIGDVAVVDFKGVIAKAEGDDENAEPEPIPGGDASD
TIG_SYNY3       QEKRATLVPVE---------DRPAALGDLAIVDYAAFQVAEDGQ----AGEAIAEVKGSD
TIG_SYNR3       RRQLATLVPVS---------DRAAAMGDVAVVSFSGVFSD--------DKSAIEGGSANG
TIG_MYCLE       RARFGTLIGVD----------RPVALGDFVSIDLSATINGEK----------VPNADAEG
TIG_MYCTU       RTRFGTLTAVD----------RPVAVGDVVSIDLSATVDGED----------IPNAAAEG
TIG_CHLPN       GMFFATKTPVE----------RPSQEGDFISISLHVSKSNDEN--------ASSAAIFEN
TIG_CHLAB       SYFFATKTPVT----------RTSQEGDFISLSLHVSKQNEE---------GVPTPIFEN
TIG_CHLMU       AYFFATKTPVT----------RPSQEGDFISLSLHVSKKGDLN--------SNPVAIFEN
TIG_CHLTR       AYFFATKTPVT----------RPSQEGDFISLSLYVSKRGDEN--------STPVAIFEN
TIG_THEMA       RESHALLEPKE----------GPAEAGDLVRVNMEVYNEE----------GKKLTSREYE
TIG_PSELT       QQTHAILEPKE----------GPAEYDDMVRVKMTITTDG----------KVIMNQKVSE
TIG_XYLFA       RLQRRTWRVAE----------HGAQVGHLVALETWSQAGD----------ERLPIEGVEA
TIG_UREPA       LNSKSQRRVKD--------DNEFIEKGDEVRFDFKGMIDS----------VPFEGGSAKD
TIG_MYCPU       MEMGAPIEESN----------EPAELENEMVFDFKGFIDG----------EEFEGGSAEE
TIG_DESAG       RTNLADVVTVA--------EHRPAKDGEIAVLDFAAYENG----------EPIAGVAADN
TIG_AQUAE       REANAVWEPKD--------ENEPAQEGDMLVVEYEVEEIG-----------GEGEKVKQE
TIG_EHRRG       KKQCSEFVEVSD-------SEYRVKMGDKVVVDYQNRIKG----------KMLKGGDTKD
TIG_BORBU       QIENSIIIEDE---------EGVVKEDSIVKVDFVELDDLS---------NEIVSTKRQG
TIG_TREPA       QERNALVTDKG--------ADSCAEVGDIATVDYHEVDDSG---------AVRPGTERAG
TIG_DEIRA       RERNASFEKAE----------RPIEAADQVTIQELG-----------------EGDSEEG
TIG_ARATH       YKSLGALKIVT---------ERGLQVGDLAVVDISATTIDEDGS----TGQAIPDAESKG
TIG_PELPB       LKGHGTLNTVD----------EAALSTDTVIGDVYKLNEAG---------ETDDDQKTDN
TIG_BUCAI       KNKKNIWNPVN----------KAVKSYDRVTINYCIYEKN----------KKIKKFDKDN
                                                .                           

TIG_BACHD       YSLEI-GSGQFIPGFEDQLVGLKAGEEKDVEVTFPEEYHAEELAGKPATFKVKIHDVKRK
TIG_BACSU       YSLEV-GSGSFIPGFEDQLVGLEAGAEKDVEVTFPEEYHAEDLAGKPAVFKVKIHEIKAK
TIG_LISIN       HSLEL-GSGQFIPGFEEKLVGLKAGDEADIELTFPEEYHAEDLAGQPVVFKVKLHEIKTK
TIG_LISMO       HSLEL-GSGQFIPGFEEKLVGLKAGDEADIELTFPEEYHAEDLAGQPVVFKVKLHEIKTK
TIG_STAAM       YDLEI-GSGSFIPGFEEQLEGMKVDEEKDVVVTFPEEYHAEELAGKEATFKTKVNEIKFK
TIG_STRPN       FSLGL-GSGQFIPGFEDQLVGHSAGETVDVIVTFPEDYQAEDLAGKEAKFVTTIHEVKAK
TIG_STRP1       FSLEL-GSGQFIPGFEDQLVGAKAGDEVEVNVTFPESYQAEDLAGKAAKFMTTIHEVKTK
TIG_LACLA       HSLEL-GSGQFIPGFEEQLVGTKAGETVEVKVTFPENYQAEDLAGKEALFVTTVNEVKAK
TIG_OENOE       FSLSL-GSGQFIPGFEDQLVGHKAGDDVDVKVTFPKDYQAKNLAGKEAVFAVTIHELKKL
TIG_CLOAB       YSLEI-GSGTFIDNFEDQLVGLKKDESKDVNVKFPEEYGKEELNGKPAKFEVTIKEIKRK
TIG_CLOPE       YPLEI-GSGSFIDNFEEQLVGLKVGESKDVNVTFPEAYGKEDLNGKPAKFEVTVKEIKVK
TIG_CALS8       YELTI-GSGRFIPGFEEQLIGIKKGEEKEIEVVFPEDYQSQELAGKKATFKVKVKEIKVK
TIG_MYCGE       YELTI-GSNSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIKKL
TIG_MYCPN       YELTI-GSNSFIDGFESGLIGMKVGDKRQLKLKFPKDYHAEELKGKPVEFDIELKAIKQL
TIG_HELPY       FNLIL-GSKQMLEDFEKALLGMQAGEEKEFPLTFPSKYHAEHLAGKEAFFKVKLHQIQAR
TIG_HELPJ       FSLIL-GSKQMLEDFEKALLGMQASEEKEFPLTFPSGYHAEHLAGKEALFKVKLRQIQVR
TIG_CAMJE       YVLEI-GSKQFIPGFEDGMVGMKIGEEKDIKVTFPKEYGAAHLAGKDAVFKVKLHEIQEL
TIG_ECOLI       FVLAM-GQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEER
TIG_SALTY       FVLAM-GQGRMIPGFEDGVKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFVINLKKVEER
TIG_YERPE       FVLAM-GQGRMIPGFEEGVIGHKAGEEFTIDVNFPEDYHAENLKGKSAKFAIVLKKVEVR
TIG_VIBCH       FPLEM-GAGRMIPGFEDGIVGKTKGMEFVIDVTFPEDYHAENLKGKAAKFAIKVNKVEAR
TIG_HAEIN       FVLFM-GQGRMIPGFEEGIVGHKAGEQFDIDVTFPAEYHAENLKGKAAKFAITLKKIENM
TIG_PASMU       FTLFM-GQGRMIPGFEEGIVGHKAGEQFDIDVTFPEEYHAENLKGKAAKFAITLKKVEVM
TIG_PSEAE       TLLVL-GSGRMIAGFEEGLVGAKAGEERVLNLTFPEDYQNLDLANKAAEFTVTVNSVAEP
TIG_PSYCK       FKLVI-GSNQMIPGFEAGIKGMKAGEEKTIDVTFPEDYQAENLAGKEAQFKINVKLVEKS
TIG_NEIMA       YAFVL-GASQMLPEFEAGVVGMKAGESKDVTVNFPEDYHGKDVAGKTAVFTITLNNVSEA
TIG_NEIMB       YAFVL-GASQMLPEFEAGVVGMKAGESKDVTVNFPEDYHGKDVAGKTAVFTITLNNVSEA
TIG_RALSO       FGFVL-GEGRMLPEFEQATLGLKQGESKVFPLAFPADYHGKDVAGKTAEFTVTLKQVEWA
TIG_BRUME       AQLVL-GSGQFIPGFEEQLIGLKAGDEKVITVTFPAEYGAAHLAGKEATFDIKVKEVAKP
TIG_RHILO       QLLVL-GSKEFIPGFEDQLIGTKAGDEKQVTVTFPENYQAAHLAGKEATFDVTVKEVSKP
TIG_RHIME       AELVL-GSNRFIPGFEEQLVGVKAGDEKTITVTFPADYPAANLAGKEATFDITVKDVAAA
TIG_CAUVC       AELVL-GSGQFIPGFEDQLVGAKPGDDVVVKVKFPEEYQAKDLAGKDAEFATKVQEVRAP
TIG_RHOCB       YPLVL-GSNSFIPGFEDQLVGAKAGEDVEVKVTFPAEYGAAHLAGKEATFKCHVHAVKAP
TIG_AZOBR       YPLEL-GANQFVPGFEDQLVGAKAGEHRTVKVTFPADYPHDRLKGADTVFEVDVKELRKN
TIG_RICCN       FKVII-GSNALIPGFEKQLIGSKTGSKVDVNVTFPENYHAKDLAGKDARFVVQIKAVHTA
TIG_RICPR       FKVVI-GSNTLIQGFEQQLIGSKTGNEVDVNVTFPENYHDKNLSGKDAHFVVQIKAVHTA
TIG_NOSS1       FQVEL-QEDRFIPGFVTGIVGMNPGDTKEVSAQFPDPYVNQELAGKPAIFTVTLKEIKEK
TIG_SYNY3       FEVTL-EDGRFVAGIVDGIVGMAVDETKLIPVTFPEDYPLEAVAGEDVLFEIKLKEIKFR
TIG_SYNR3       LDVEL-EEGRMISGFVEGVVGMKPGDKKDVDCQFPDDYPEETCRGRKALFSISLDELKGR
TIG_MYCLE       LSHEV-GYGRLIAGLDDALVGLSAGES----RVFTTQLATSKHAGQDAEVIVTVKSVKER
TIG_MYCTU       LSHEV-GSGRLIAGLDDAVVGLSADES----RVFTAKLAAGEHAGQEAQVTVTVRSVKER
TIG_CHLPN       KYFKL-SEEEMTDAFKEKFLGISTGHR----VVETITSPEIQSFLRGDTLTFTVNAVIEV
TIG_CHLAB       KYFKL-CEEEMTDAFKTKFLGISAGHR----VTEIIASPEIQSFLNGDVLTFTVNAVIEV
TIG_CHLMU       KYFKI-SEEDMTDAFKARFLNVSTGHR----VEEEIASEDIQSFLNGDLLTFTVNAVIEI
TIG_CHLTR       KYFKI-SEEDMTDSFKARFLNVSTGHR----VEEEIGSEDIQSFLNGDLLTFTVNAVIEI
TIG_THEMA       YVISE-DED---RPFVKDLVGKKKGDVVEIEREY---------EGKKYTYKLEVEEVYKR
TIG_PSELT       YVLYK-EDD---RPVVSEIVGKKSGDVVEFDRDFG--------EGKVYHYKIEIEQVNKR
TIG_XYLFA       GSTIL-GSGVMFEQIERGLEGLSKGDEKVLDVTFPDDWRVTQLAGKAVQVHVKVIEVSEP
TIG_UREPA       HLLTI-GSNQFIPGFEDQMIGLKKDERKNINVKFPDDYHATDLAGKAAVFEVFIKEITNV
TIG_MYCPU       FKLKL-GSKSFIPGFEDQLVGLKAGDEKEIKVTFPADYYVEEYAGKESVFKILVHKVFKP
TIG_DESAG       FELNL-GGNQALVDFEELVKRAVPGEATEGDVTFPEDFINPEFAGKTVTMKVTVHAVKER
TIG_AQUAE       TSVIL-GQGMLRPEVEEALKGKKVGEE--VELKELPLYDQEGKEVGKVNIKIKIKEIKKK
TIG_EHRRG       LAVIV-GRGLVLKDFEDQLIGMKIGESKSFPIQFPDNYGVAYLVGKSADVSVTVKNIFMM
TIG_BORBU       FVFTV-GKSETYYDFDKDVIGMRINEERVIEKSYIADYKFEELAGSSRKLKIKIKSIKKR
TIG_TREPA       VVFTL-GVEEGPFALGQDILGMKLGQRCLF------AKRAGMLKDEAAQVRVTLKALKQR
TIG_DEIRA       GSYPI-YLDMAEEHVRNALLGKSAGDVVDITVP---AHQHGDHEHAEHTVRVKVVEVSSK
TIG_ARATH       FHFDTEEGNRLLPGFLDAIIGIRAGESKSFTLVFPESWKQESLRGQRAQFTVDCKELFYR
TIG_PELPB       HHFTL-EYLPEENPFRKALTGKKAGESVDIE-------NDEKESAQPSRFRVVISEIKRL
TIG_BUCAI       ISFIV-SKNTLIPQLNYKIINHFVNDIIFFKIKFHAFHPEKELQNKDITFKIKIIKIEKK
                              .         .                               :   

TIG_BACHD       ELPELDD----EFAKDVD---EEVESLDELKKKLREKLE-KDRAHEADHEKRDTLIQKAS
TIG_BACSU       ELPELDD----EFAKDID---EEVETLAELTEKTKKRLE-EAKENEADAKLREELVLKAS
TIG_LISIN       EVPALDD----ELAKDID---EEVETLDELKEKISKRLQ-EAKEDSVAQAKQEEVIAKAV
TIG_LISMO       EVPALDD----ELAKDID---EEVETLDELKEKISKRLQ-EAKEESVAQAKQEEVIAKAV
TIG_STAAM       EVPELTD----EIANELD---AEANTVDEYKENLRKRLA-EQKATDAENVEKEEAITKAT
TIG_STRPN       EVPALDD----ELAKDID---EEVETLADLKEKYSKELA-AAKEEAYKDAVEGAAIDTAV
TIG_STRP1       EVPELDD----ELAKDID---EDVDTLEDLKVKYRKELE-AAQETAYDDAVEGAAIELAV
TIG_LACLA       ELPELDD----ELAKDID---EEVETLDELKAKFRKELE-ESKAEAYNDAVETAAIEAAV
TIG_OENOE       ETPALDN----EFAKDVD---DSVLVLEELKAKTKEKLA-KDKAEKNKDAFEDAAIQKVV
TIG_CLOAB       ELPALDD----EFAKEV----SEFDTLDEVKADIRSKME-KANEEKAKIEFEDKVVDAAV
TIG_CLOPE       ELPALDD----EFAKEV----SEFDTLEELKADLKEKAV-KANELRAKREMEEKVINAVV
TIG_CALS8       ELPELDD----EFAKDV----SEYETLEELKASIRNRIK-EKNDKRAKDEMIDAILEKIA
TIG_MYCGE       EFTPMDETNFKSFLPEQF---QSFTSLKAFKSYFHKLME-NKKQETILQENNQKIRQFLL
TIG_MYCPN       EITPMDETNFKEYLPAQY---QGFNSLKEFKTYFHKLVS-AKKLEITLQENSVKIRQFFL
TIG_HELPY       EMLEIND----ELAKIVLA-NEENATLKLLKERVEGQLFLENKARLYNEELKEKLIENLD
TIG_HELPJ       EALEIND----ELAKIVLA-NEENATLELLKERVKGQLFLENKARLYNEELKEKLIENLD
TIG_CAMJE       KIPELDD----EMLKKLLP-GEEKASVEVLDEKLKEQIKNEKLFKLVNDELKGKFADALI
TIG_ECOLI       ELPELTA----EFIKRFG---VEDGSVEGLRAEVRKNME-RELKSAIRNRVKSQAIEGLV
TIG_SALTY       ELPELTE----EFIKRFG---VEDGSVAGLRAEVRKNME-RELKGAVRNRVKSQAIEGLV
TIG_YERPE       ELPELTE----EFIKRFG---VADGSLAGLRAEVRKNME-RELKGAVRNRVKTQAIDGLV
TIG_VIBCH       ELPELND----EFVARFG---VAEGGVDALKAEVRKNME-RELKQAIKARIKEQAIEGLV
TIG_HAEIN       VLPELTD----EFVAKFG---PNTKSVADLRAEIRKNME-RELKNALVSRVKQQVINGLI
TIG_PASMU       VLPELTD----EFVAKFG---PNTKTVDDLRNEIRKNMQ-RELKNALTAKVKGQVIDGLL
TIG_PSEAE       KLPELNE----EFFALFG---VKETGLDGFRAEVQKNME-RELRQAIKSKVKNQVMEGLL
TIG_PSYCK       KLPEIDD----AFLELFG---VKEGGVEKLKDDVRKNME-REIKNAARSQVKQATFDALL
TIG_NEIMA       TLPEVDA----DFAKALG---IADGDVAKMREEVKKNVS-REVERRVNEQTKESVMNALL
TIG_NEIMB       TLPEVDA----DFAKALG---IADGDVAKMREEVQKNVS-REVERRVNEQTKESVMNALL
TIG_RALSO       HLPEING----AFAQSLG---IADGSLDKMRADIRENLE-REVKRRTHALLKDQVMDALL
TIG_BRUME       NELVLDD----ETAKKLG---IES--LERLRQVVREQIE-SQYGQITRQKVKRQILDALD
TIG_RHILO       GELEIND----ETAKNLG---LES--LERLREIVRGQIE-NQFGSMTRQKVKRQLLDQLD
TIG_RHIME       APIEIND----ELATKLG---LES--VDKLKEIVRGQIE-SQFGSITRQKVKRQLLDQLD
TIG_CAUVC       VDGKADD----ELAKRLG---LSD--LAALTELLKSNLA-GRYDNSSRFKLKRALLDVLD
TIG_RHOCB       KPAEIDD----ELAKKFG---AAD--LEALKGQVASRLE-AEYKGASRAILKRALLDILD
TIG_AZOBR       VPAEVND----DLAKEFG---MES--LEKLREAVGRPHQ-GRIRQRVALRVKRQLLDKLA
TIG_RICCN       EPTVIDD----EFAKKFQ---SNS--LEELRTHFTKQIE-NESEEAINTIMKMNLFDKLE
TIG_RICPR       EPTIIDE----EFAKKFQ---SNS--LEELRTHFAKQIE-NESEEAINTIMKMNLFDKLE
TIG_NOSS1       ELPELND----DFAQEVS----DFDTLEALRASLAERYQ-KEAEDKTKNNQQEALLGELV
TIG_SYNY3       ELPELDD----DFAEDVS----EFETMAELKADLEKQFQ-EQAKQRTDDNIKAAIKKKLG
TIG_SYNR3       ELPELDD----AFAQQAS----DKKTLSELREDLENRLK-QDAEQRQKNNRHEALLKALV
TIG_MYCLE       ELPEPDD----EFAQLVSEF----DTMAELRANLGDQVR-KAKYAQQAEKIRDAAVDALL
TIG_MYCTU       ELPEPDD----EFAQLASEF----DSIDELRASLSDQVR-QAKRAQQAEQIRNATIDALL
TIG_CHLPN       SIPEIDD----EKARQLQA-----ESLDDLKAKLRIQLE-KQAKDKQLQKRFSEAEDALA
TIG_CHLAB       VAPELDD----DKARQLQA-----ESLEDLKKKLRIQLE-NQAKDRQHQQCFAEAENALA
TIG_CHLMU       SSPEMDD----EKARQLQA-----ESLEDLKKKLRIQLE-NQAKEEHHQKRFSAAEDALA
TIG_CHLTR       SSPEMDD----EKARQLQA-----ESLEDLKKKLRIQLE-NQAKEAQHQKRFSDAEDALA
TIG_THEMA       TLPEIGD----ELAKSVN---NEFETLEQLKESLKKEGK-EIYDVEMKESMREQLLEKLP
TIG_PSELT       RLIDISD----ELAKTVS---AEYETLEQLKDAIEREGN-ELYEKEMDEFLKTQALDSLV
TIG_XYLFA       VLLEVNE----EFIKSFG---VKSGKLEDFRADIRANLE-RELKGALVSHLRREVGEQLI
TIG_UREPA       KPQELND----EFAKSFNL--PNVNTVQELKDYIHNQIVLAKQEKNSERAWLEIAQQLLA
TIG_MYCPU       KAKEIND----ETIKELGF--KGVSNLEQLKEYLRPSIE-HKLLEDSLTEFKNEAFNKIK
TIG_DESAG       KLPELDD----ELAKKAG----GFESFDKMRETVEQSYL-ESRTQLCKAQAQKTMVDSLL
TIG_AQUAE       VLPELND----EFAKELG-----YASLKDLEEKIREDIK-QKLEKLKEQVIEERVADKLV
TIG_EHRRG       KAIEENE----NVIKYYQ-----FKDEQALKDFARNKIK-QQFDKISFAIVKKELFDYLD
TIG_BORBU       DLPLIDD----EFAQDIS---DKYNTLDDLKNFIRSSLL-NIVEEKKETLKLNKFFSTIS
TIG_TREPA       QLPSLDD----ELAQDVS---DAFRTLDDLTRSVRQNLA-EALEAALHEYKRRQLLRILV
TIG_DEIRA       KLQDLND----EFATSLN-----YESMDKLRTDLREELE-RRAQQEGDNLRREELVGHLV
TIG_ARATH       DLPTLDD----SLADKLL---PGCTTLKEVEETLAKRCQ-EMEQEAKEQATDNAILEQIR
TIG_PELPB       ELPELTD----ELVKEITG--GRFESVTDFTADVRIQLE-QHFLLKSDEELLESLSAKLI
TIG_BUCAI       QELESEK----SNKKNIT----EKKTIQTDYQTIKNNLH-SQINIITDKYLENQIIQKIV
                                                                            

TIG_BACHD       ENATI---DIPEAMINTELDRMTQEFEQRLQMQGMNLEMYFQFSGQ--TQEQLREQMKED
TIG_BACSU       ENAEI---DVPQAMVDTELDRMLKEFEQRLQMQGMNLELYTQFSGQ--DEAALKEQMKED
TIG_LISIN       ENAEV---DIPHAMVHHEADHLMNHFAQDLQAQGLTPELYYQFTGQ--TEEAMHAQMEKD
TIG_LISMO       ENAEV---DIPHAMVHHEADHLMNHFAQDLQAQGLTPELYYQFTGQ--TEEAMHAQMEKD
TIG_STAAM       DNTTI---DIPEAMVNTELDRMVSEFAQRIQQQGLDLQTYFQISGQ--DETQLREQMKDD
TIG_STRPN       ENAEI--VELPEEMIHEEVHRSVNEFLGNLQRQGINPDMYFQITGT--TQEDLHNQYQAE
TIG_STRP1       ANAEI--VDLPEEMIHEEVNRSVNEFMGNMQRQGISPEMYFQLTGT--TQEDLHNQYSAE
TIG_LACLA       ANAEI--KEIPEEMIHEEVHRAMNEFLGGMQQQGISPEMYFQITGT--SEDDLHKQYEAD
TIG_OENOE       DGAKINPEKLPEEMINDDVSRQMQTFFNNLAGQGVKPEMYFQIPNQ--P-GAVKATNDRR
TIG_CLOAB       ENAKI---EIPEVMVKNETDQMLKELESRLRYQGLDLKSYYEYTNS--SEEKVRDYMKET
TIG_CLOPE       DNAKV---EIPEAMINREVENMVRDLEMRLGQQGLSLEQYYEFTGS--TEDKMKSYMKEN
TIG_CALS8       QATEI---DIPEPMIENQINYYVEDVVRNLQYFGMTYEKYLEAIGK--TDKEFREQFRER
TIG_MYCGE       TNTKL--PFLPEALIKLEANRLLKLQQSQAEQYKIPFEKLLSASNI--TLTELQDRNIKE
TIG_MYCPN       ANTTL--PYIPDSLIKLESDRLLRAQKDQAEQYKIPFERLLAASKL--SLEQLQQRNIKE
TIG_HELPY       EKIVF---DLPKTIIEQEMDLLFRNALYSMQAE---EVKSLQESQE--KAKEKRESFRND
TIG_HELPJ       EKILF---DLPKTIIEQEMDLLFRNALYSMQAE---EVKSLQDSQE--KAKEKRESFRND
TIG_CAMJE       EKYNF---DLPKGIVEQETDMQMRAAFNTFSEK---EIEELKASKE--KYQEKRDSFKEE
TIG_ECOLI       KANDI---DVPAALIDSEIDVLRRQAAQRFG----------GNEKQ--ALELPRELFEEQ
TIG_SALTY       KANDI---DVPSALIDSEIDVLRRQAAQRFG----------GNEKQ--ALELPRELFEEQ
TIG_YERPE       SANNI---DVPTALVDGEIDVLRRQAAQRFG----------GNEKQ--AAELPRELFEEQ
TIG_VIBCH       KENEI---QVPSALIDQEINVLRQQAAQRFG----------GNVEA--AAQLPRELFEEQ
TIG_HAEIN       EQNPI---DVPVSAVEEEINVLRNQAAQRFG----------GNAQQ--TAQLPRELFEAE
TIG_PASMU       AQNAI---DVPASAVEQEIEVLRGQAAQRFG----------GNKEQ--AAQLPRELFEEQ
TIG_PSEAE       QANPI---EVPKALIGNEVNRLRVQAVQQFG----------GNIK---PDQLPAELFEEQ
TIG_PSYCK       EKNEF---DVPNAMLEQEIERQRNMMMQRFSQQF----GANADSFD--KDMLPNELFEEQ
TIG_NEIMA       KAVEL---KAPVALVNEEAARLANEMKQNFVNQ-------GMADAA--NLDLPLDMFKEQ
TIG_NEIMB       KAVEL---KAPVALVNEEAARLANEMKQNFVNQ-------GMADAA--NLDLPLDMFKEQ
TIG_RALSO       KVAEL---DVPKSLIEQDQERLVEMARRDLEAR-------GMPNVK--NMPIPAEMFAQQ
TIG_BRUME       GDYQF---ETPQKLVDAEFNNIWQQINFDLQQAG----RTFEDEET--TEEAAREEYRKL
TIG_RHILO       AAYSF---EAPSKLIDAEFNNIWAQVTRDLEAAG----RTFADEET--TEEEARAEYLRL
TIG_RHIME       ELYQF---DTPERLVDAEFENIWRQINTDLQQAG----KTFADEDT--TEEEARAEYRKL
TIG_CAUVC       TKHDF---PLPPRMVDAEFAGIWQQVEADKARGG----LPPEDAEK--TEDQLKDEYKKI
TIG_RHOCB       AQVKF---DLPPSLVEAEAGQIAHQLWHEENPD-------HHGHDH--GAVEPTEEHKTL
TIG_AZOBR       EAHSF---EVPPGMVDVEFEGIWQRLQQELQNG-----TAGEDAGK--PEEELKTEYRGI
TIG_RICCN       KLLDF---DVPESLLEQEKNILKSGTDKNEQDE-------SLLKDK--SSKEITAYYNKL
TIG_RICPR       KLLDF---DVPESLLEQEKNILKSETDKNKHDG-------SLLNGK--SSKEITEYYNKL
TIG_NOSS1       KHIEV---DLPETLIEKEVDAMLTQTAMRLSQQGLDVKKLFTQ--D--IIPQLRERSRPE
TIG_SYNY3       ELFTG---DLPETMIKQECDRLVAQTAMELERMGLDVSQLFRQGDD--MLQTLKDNSRPE
TIG_SYNR3       DQLEV---ELPESLIKEEINSLLQETAAQMAQQGMDVKKLFTP--E--TVQNLAQASRGE
TIG_MYCLE       ERVDV---PLPEGIVQAQFNNALHDALSGLGHDEAKFAEVLAERGS--SREEFEAEARSA
TIG_MYCTU       EQVDV---PLPESYVQAQFDSVLHSALSGLNHDEARFNELLVEQGS--SRAAFDAEARTA
TIG_CHLPN       MLVDF---ELPTSLLEERISLITREKLLNARLIQYCSDEELEKR-----KSELIKEAEED
TIG_CHLAB       SIIDF---DLPTSMLEDRLAMLTRAKLLNARLIQYCSDEELENK-----KSDLLKEAELE
TIG_CHLMU       QLIDF---DLPQSLLQEREEILSREKLLNARLVKYCSDSELEEQ-----KQTLLEEAKAD
TIG_CHLTR       QLIDF---DLPESLLQEREELLSREKLLNARLVKYCSDSELEEQ-----KQALLEEAKAD
TIG_THEMA       EIVEI-------EISDRTLEILVNEAINRLKREGR-YEQIVSSYES--E-EKFREELKER
TIG_PSELT       KTSQL-------LVSERTLSQLVETVFDKIRRDREEYEKLLKDHDN--NPEKLREALKNY
TIG_XYLFA       AAYAH--VEMPPRLVEKEARLMLAKQIEQIRLSG-------RDPTG--IPDDAHIGFMDA
TIG_UREPA       KAKIT---PIPQSLIDREVSTLRQQVLSQLSQYKIELKQYLEFSKK--SEAQFQEDLIRQ
TIG_MYCPU       ELNDI---KIPRGLLLEEMTAINEKFNETLKAQGLKRREYLEMTKL--SEEKVAEQVKKE
TIG_DESAG       KTLDF---PVPESMLEMYMDSLLAEKKDRLERQG----KSLESLGK--SPEELRDEVRPE
TIG_AQUAE       EIHDI---PVPQTLLRRELSFLVDRRLRELQALG------IDTRYV--DIKKIVEEVQPI
TIG_EHRRG       KTYSI---DVPECVVTKEIDKINQEIQ------------------D--SAGTVQVDVKAE
TIG_BORBU       EKLEI---DIPHSMIEAEIEIAFKDAKRQNKNN-MSLEEFKSIFYS--SGYIGGDNLKDE
TIG_TREPA       RENPF---SLPESLVVGEMESRWALVMRQFGVS-------LSGTPQ--NKLQFFQQWRPE
TIG_DEIRA       EGMTV---EIPQALIDRRREGMMSEIQDDLRRQGVQWKEYEAFMQEQGKLDEFEADLTKN
TIG_ARATH       KMVEV---EIPQSLFEEQGRQFYGARLLEIQGNMKLNEDQLASLSSQKAVNEFLETQRES
TIG_PELPB       EENPV---PAPNSMIASFSKMLLENAKRQMGGS-------FPKGFD---DEQFRLAMKPN
TIG_BUCAI       EKNIL---LLPPLLFQKEIKNLYKQYTKQYQEE-----------NSNILEKKYHMSLDSE
                                                                            

TIG_BACHD       AEKRVRVNLTLEAIANQENLEASDEDVEKELEKMAEMYQR--SVDE-----------IKS
TIG_BACSU       AEKRVKSNLTLEAIAKAENLEVSDEEVDAELTKMAEAYNM--PVEN-----------IKQ
TIG_LISIN       AEKRVKMNLVLEAIAEAENIEPTEEAIDEEISTLAEKYGM--EKDA-----------VRA
TIG_LISMO       AEKRVKMNLVLEAIAEAENIEPTEEAIDEEISTLAEKYGM--EKDA-----------VRA
TIG_STAAM       AEQRVKTNLTLTAIAEAEKIEATDEDIDKELEKMSKQFNI--SVED-----------IKN
TIG_STRPN       AESRTKTNLVIEAVAKAEGFDASEEEIQKEVEQLAADYNM--EVAQ-----------VQN
TIG_STRP1       ADKRVKTNLVIEAIAKAEGFEATDSEIEQEINDLATEYNM--PADQ-----------VRS
TIG_LACLA       ADKRVRTNLVIEAIAAAENFTTSDEEVKAEIEDLAGQYNM--PVEQ-----------VEK
TIG_OENOE       RTNRVKTNLVLEEIARVEKINPSNEEIDKEIKSLASEYNI--KESE-----------VEK
TIG_CLOAB       ADKRVRTKLVMEKISEVEKVEATEEELKEKAKEMAQQYTN-KDLDK-----------MAE
TIG_CLOPE       AERKVKTDLVMSAVTEAEAIEATEEELKAKAEEVAKMYSNGAETEK-----------MVD
TIG_CALS8       ATKAIRNNLILEKIAKVENIQATDEELEKELERLAKMYNL--EVEK-----------LKE
TIG_MYCGE       AKENVTFALVMKKIADIEKIKVDNNKIKAEIENVIAVEYPFASDEM-----------KKQ
TIG_MYCPN       ARDNVTFALVMKRIADVEKIKVDNKKIHSEIESIIDVEYPFVNAEL-----------KKQ
TIG_HELPY       ATKSVKITFIIDALAKEEKIGVHDNEVFQTLYYEAMMTGQ--NPEN-----------LIE
TIG_HELPJ       ATKSVKITFVIDALAKEEKIGVHDNEVFQTLYYEAMMTGQ--NPEN-----------LIE
TIG_CAMJE       AQKSVKLTFIIDELAKLRKIEVNDQELIQAIYFEAYRYGM--NPKE-----------HLE
TIG_ECOLI       AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYED--PKEV-----------IEF
TIG_SALTY       AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYED--PKEV-----------IEF
TIG_YERPE       AKRRVVVGLLLGEVISQHELKADEDRVKALIEEMASAYED--PQEV-----------IEF
TIG_VIBCH       AKRRVVVGLLLGEVIRTHELKADEEKVKALITEMATAYED--PSEV-----------VSY
TIG_HAEIN       ATRRVQVGLLFSEVIKSNELKADEERAKAMIADIASAYEQ--PAEV-----------VEY
TIG_PASMU       AKRRVQVGLLLAEVIASHELKVDEARAKTMIEEIASAYEQ--PAEV-----------VEY
TIG_PSEAE       AKRRVVLGLIVAEVVKQHELKADEGRVREMIEEMASAYQE--PEQV-----------VAW
TIG_PSYCK       ALRAARLGIIVARVIDTKGLEVDQARVETFIKEAAENYED--PSEV-----------IEY
TIG_NEIMA       AERRVSLGLILAKLVDENKLEPTEEQIKAVVANFAESYED--PQEV-----------IDW
TIG_NEIMB       AERRVSLGLILAKLVDENKLEPTEEQIKAVVANFAESYED--PQEV-----------IDW
TIG_RALSO       AERRVKLGLVLAEVVKVNALEAKPEQIKAEIEEFAKSYED--PKEV-----------IRW
TIG_BRUME       AERRVRLGLVLSEIGEKAGVEVTEEELQRAVYDQVRRYPG-QEKEI-----------YDF
TIG_RHILO       AERRVRLGLVLAEIGEKAGVTVSDEELQRGLFEQVRRFPANQQQEA-----------FEF
TIG_RHIME       AERRVRLGLVLSEIGEKAGVQVSDDEMQRSLFEQLRQFPG-QEKEI-----------LEY
TIG_CAUVC       AERRVRLGLVLAEIGRKNDVVVTDQELTDAIMREARQYGA-QAQQV-----------FDM
TIG_RHOCB       AERRVRLGLLLAELGRNEKIEVTDAEMTQAVLAAARQYPG-HEREF-----------FEF
TIG_AZOBR       AERRVRLGLLLSEIGRRNDIQVTQDEINRALIAEARRFPG-QERQV-----------FEF
TIG_RICCN       ALRRVRIGLLLAEYAKSKNLQLEPDDLRKVIMQQARNFPG-QENMI-----------FDF
TIG_RICPR       ALRRVRIGLLLAEYAKFKNLQLEPDDFKKIIMQQARNFPG-QENMI-----------FDF
TIG_NOSS1       AVERLKRSLGLQEVAKRESITVTPEEIQARVTELVQQYPD-EDIDAE-R--------LQT
TIG_SYNY3       AIANLKTDLMIGAIAKEEKIQPTEAEVKERCDELRQEFKG-EKIDES-R--------LVN
TIG_SYNR3       ATERLQRSLALKALAKAEGISVADKDLEAKIKEVSAGFSDTNKIDPQ-R--------LRD
TIG_MYCLE       AERDVTRQLLLDVVADDQKIQVGQDDLNERLLATSQQ-YGVDAQQLFGF--------LRE
TIG_MYCTU       SEKDVKRQLLLDALADELQVQVGQDDLTERLVTTSRQ-YGIEPQQLFGY--------LQE
TIG_CHLPN       ATKALKLLFLTHKIFSDEKLTISREELQYMMDVCSRERFGQQPP----K--------DIS
TIG_CHLAB       AKKTLKLFFLANKIFNDEKLVISREELQYMMDVCSRERYGMQPP----R--------DIS
TIG_CHLMU       ARKAVKLLFLTQKVFSEKELSISREELQRMMDVCSRERFGAHPP----K--------DIS
TIG_CHLTR       ARKAVKLLFLTQKVFSEKGLSISREELQYMMDVCSRERFGGYPP----K--------DIS
TIG_THEMA       ILDDIKRDRVIEVLAQEKGISVNDEELEKEAEELAPFWGISPDRAK------------SL
TIG_PSELT       YITDMKETYSIRKVARENNLDVSEDEVQNEAENLAIAWGISVERAK------------SI
TIG_XYLFA       ACKRVLVGLLVGEIAGRNRLRLDPMRVTETLHLIASTYEE--PEEV-----------FEM
TIG_UREPA       AKETITLALLVDDIAETQNIVVSDEEVKERVAEMAKLYQG--EEQ-------------AV
TIG_MYCPU       AITKINEYLIFEQIKKAENVTISDDIIEDHYNIMAKNYNIEVDKIK--------------
TIG_DESAG       AEHIARTQIFLVKAAQKEGVTVSEQEVDRQLQQIAMRSGQ--DFQT-----------MKE
TIG_AQUAE       AEANIKLRFILDKYAQEKGIEPTGEDIEAQYKELAEQYGTTVDEIKKYF--------KEN
TIG_EHRRG       AMKRVKLGILLVKMSRHHNISINKDDVFSFINTYYSDYGISLNDVL------------RM
TIG_BORBU       ILGNLKSKLIMQKMVDLDPIKVTESDVEDEMARQSKNLGVSYEEIK-------------K
TIG_TREPA       VEEHLKQRVIVELLLKQEQVSVSAEEIETEYVRIASKTGS--KEER-----------VRE
TIG_DEIRA       AETRVRRDLALEQLATDLNAQVNEAEFNQTLMNLAQANGMNVQQLVQQLGQDGVQSYYIS
TIG_ARATH       ITNIIKQNIAVGDIFKRENLEFSTDELVKEVENSISEFKKHKQEFD--------------
TIG_PELPB       AEKHAQWLMISQKIAEDATLSVSDDDIKAYADKEAEKSESMDAEEI------------LK
TIG_BUCAI       VKKRLYFQIIIEQIILNNKLFADENNIQKLIKKISSNYKNPMEIIK-------------L
                                                                            

TIG_BACHD       IFATQGGTDGIKADLKIQKAVDFLVEHS----------KAVS------------------
TIG_BACSU       AI---GSTDAMKEDLKVRKAIDFLVENR--------------------------------
TIG_LISIN       AL---GDMSELKSDLKIRKAIDVLLDSA----------VEK-------------------
TIG_LISMO       AL---GDMSELKSDLKIRKAIDVLLDSA----------VEK-------------------
TIG_STAAM       TL---GNTDIIKNDVRIQKVIDLLRDNA----------KFVEGTKED-------------
TIG_STRPN       LL----SADMLKHDITIKKAVELITSTA----------TVK-------------------
TIG_STRP1       LL----SADMLKHDIAMKKAVEVITSTA----------SVK-------------------
TIG_LACLA       LL----PVDMLKHDIAMKKAVEVIATTA----------KVK-------------------
TIG_OENOE       SV----SAGMLSHDLKVQQAVELIVNSA----------QAVEKK----------------
TIG_CLOAB       LVL-NSQRSMIEQDVINGKVIDLLVENA----------KVVE------------------
TIG_CLOPE       LLL-NAQRAALELDVKREKTLKMLFESL----------K---------------------
TIG_CALS8       RLS-EDDIEYIKEGIILNKAIDFIYENA----------KIISEETQSESQPE--------
TIG_MYCGE       LFFNMEQQKEFVESIIINRLTTTKIVSY----------STH-------------------
TIG_MYCPN       MFHNMEQQKDFVESIILNRLTTTKIIEY----------STH-------------------
TIG_HELPY       QYRKNNMLAAVKMAMIEDRVLAYLLDKN----------LPKEQQEILEKMRPNAQKIQAG
TIG_HELPJ       QYRKNNMLAAVKMAMIEDRVLAYLLDKN----------LPKEQQEILEKMRPNAQKTQVG
TIG_CAMJE       NYKKQGALPAVKMALIEEKLFNDIFIPK----------TEKS-----EKVSKKEKEDK--
TIG_ECOLI       YSKNKELMDNMRNVALEEQAVEAVLAKA----------KVT-EKETTFNELMNQQA----
TIG_SALTY       YSKNKELMDNMRNVALEEQAVEAVLAKA----------KVS-EKATSFNELMNQQA----
TIG_YERPE       YSKNKELMNNMRNVALEEQAVETLLAKA----------KVT-EKPTTFSELMNQTTAA--
TIG_VIBCH       YEQNQQLMNNMRNVALEEQAVDAIIAKA----------KVT-EKAISFSELMNPVAA---
TIG_HAEIN       YSKNEELMNNIRNVVLEEQAVDAVLAKA----------QVT-EKVSSFDEIMNPQA----
TIG_PASMU       YSKNKELMNNIRNVVLEEQAVDAVLAKA----------QVT-EKAASFDDVMNPQA----
TIG_PSEAE       YFKNEPQLNEVRSVVLEEQVVDTVLQKA----------TVT-DKQVSYEEAVKPAEAPQA
TIG_PSYCK       YTTDKQQRANIESVVLEDQVVDYLIEQG----------KVT-DKEVSYQDLLAAQQQQQQ
TIG_NEIMA       YYAEPSRLQAPTSLAIESNVVDFVLGKA----------KVN-EKALSFDEVMGAQA----
TIG_NEIMB       YYADPSRLQAPTSLAVESNVVDFVLGKA----------KVN-EKALSFDEVMGAQA----
TIG_RALSO       YYGDQQRLAEMEAYVLENNVVNFVCDKA----------KVA-DKAMSFEELTATQGAQG-
TIG_BRUME       LRRTPDAVANLRAPIFEEKVVDHLLANI----------NVT-DKKVSKEELTAEDE--DA
TIG_RHILO       YRSNPEALNALRAPMFEEKVVDHLLGQI----------SVT-DVKVSKEELMADDEDAET
TIG_RHIME       FRNTPGAAASLRAPLFEEKVVDHLLTEV----------SVT-DKKVSKEELTADDEGDEK
TIG_CAUVC       YRQRADLQAALRAPIYEDKVVDLIFGKA----------KIE-EKEVSKDELLEEDDLPEG
TIG_RHOCB       VKGNAQMQQQIRAPLYEEKVIDFIVAGA----------AVT-EKEVSKEELQKAIEALDE
TIG_AZOBR       FKQNREALENLRAPIFEDKVVDYILDQA----------KVS-EKPVSAEELMKDPDEEAE
TIG_RICCN       YKNNPRAIEGLKGPALEDKAVQYIFNHE----------IKLKEKKYTKEELEKYLEAEEQ
TIG_RICPR       YKNNPRAIEGLKGPALEDKTVQYIFNNE----------IQLKEKRYTKEELEKYLETEEQ
TIG_NOSS1       IVENELLSEKIIDWLLANSTVELVPEGS----------LASQEPEITAPETEAETIEVAA
TIG_SYNY3       FVESSLTESKVLDLLKEWADVELLPEGS----------LSQTEEDTPDDDAEEEAIVDVE
TIG_SYNR3       AVAEDLLRETLLSWLEENAKLTMVDPASEDKPAKASKAKSSKAKAEKEPAAEGQAKAKPA
TIG_MYCLE       NNRLSSLVTDARRRLAVAAVVEAATFTDSD--------GNTIDTSEFFGKHAQSDKADQK
TIG_MYCTU       RNQLPTMFADVRRELAIRAAVEAATVTDSD--------GNTIDTSEFFGKRVSAGEAEEA
TIG_CHLPN       NDTLQELVMSARDRLTYSKAIEHVLRKAEL--------LASTPSA---------------
TIG_CHLAB       KEALQELVMAARDRLTYHKAMEKVLAKAKE--------SATAPSA---------------
TIG_CHLMU       NEMLQELVLAARDRLTYHKAIEAISAEKKD--------LEVVPS----------------
TIG_CHLTR       NEMIQELVLVARDRLTYRKAIEAISSEKKD--------LEVVPS----------------
TIG_THEMA       VKARQDLREELRWAILKRKVLDLLLQEV----------KVKVVEP---KGEGDDSEGKED
TIG_PSELT       LKSRNDIFEDVRWELLKRKVAELIVQRA----------KIVDVKPEELQNEGKEAQKNED
TIG_XYLFA       YRNDPKLMEGVQSLVMEEQVIEWIADRA-----------KKTEQVLSFQEAIQQ------
TIG_UREPA       IEQLSKNPDAVKEFLLHKKVVNYLIDLN----------KNNQPKNTTLSSK---------
TIG_MYCPU       EFIPVDKLKEDPNLLNEQVILKLLEVND----------KSAFEKANALGKAKNPKSSKGK
TIG_DESAG       HYTRTNMIFNLRDRMLADKAMEAIYEKA-----------AIKEVPAKKEAAEAAE-----
TIG_AQUAE       NLEQVVYEDARRKKALKEIISKVKIKEVEQ--------KQEEEKKEEKEEVKNESQGNT-
TIG_EHRRG       LQSNKDFANYISGKVLEDKVINYIIRLVK-----------KDKKVMTTQELNLMLENM--
TIG_BORBU       FYEDQNLISYLKDDIKRERAKKKILENL----------KEVKGKKLNFRDFVNYKICE--
TIG_TREPA       YYAGEEKRRALCEGIRERKLCQKLLGRC----------VTECGPEQSLTDFLQEQSRA--
TIG_DEIRA       LLRERGLQRALAQLSGEGQSTEAASPKATGTEAAGTEQSEPAQTETAQNDAGQTETAQSE
TIG_ARATH       ---EERVKDQVQEILEGAKVLEWLKDRA----------EIQYITR---------------
TIG_PELPB       TYLSPEFRDYITDTILKEKIYNIIKSKV-----------TITEEEKSIPVRQE-------
TIG_BUCAI       YNKNKNLKNTMKNIELERQAMLLLKKSI-----------KIEKQNWNFERFLNYNWASHE
                                                                            

TIG_BACHD       ------------------------------------------
TIG_BACSU       ------------------------------------------
TIG_LISIN       ------------------------------------------
TIG_LISMO       ------------------------------------------
TIG_STAAM       ------------------------------------------
TIG_STRPN       ------------------------------------------
TIG_STRP1       ------------------------------------------
TIG_LACLA       ------------------------------------------
TIG_OENOE       ------------------------------------------
TIG_CLOAB       ------------------------------------------
TIG_CLOPE       ------------------------------------------
TIG_CALS8       ------------------------------------------
TIG_MYCGE       ------------------------------------------
TIG_MYCPN       ------------------------------------------
TIG_HELPY       ------------------------------------------
TIG_HELPJ       ------------------------------------------
TIG_CAMJE       ------------------------------------------
TIG_ECOLI       ------------------------------------------
TIG_SALTY       ------------------------------------------
TIG_YERPE       ------------------------------------------
TIG_VIBCH       ------------------------------------------
TIG_HAEIN       ------------------------------------------
TIG_PASMU       ------------------------------------------
TIG_PSEAE       A-----------------------------------------
TIG_PSYCK       AM----------------------------------------
TIG_NEIMA       ------------------------------------------
TIG_NEIMB       ------------------------------------------
TIG_RALSO       ------------------------------------------
TIG_BRUME       ASEAKPAKKAAAKKKAAPKKK--AEEGKSEEA----------
TIG_RHILO       TTKAKPAKKAAAKKAEAKANEDEAEEPKKKAAPKKKAAKDAE
TIG_RHIME       PAKKTASKKKAAAKAEAGEGEEAAAPKKKAPAKKKAADESAE
TIG_CAUVC       YGG---------------------------------------
TIG_RHOCB       L-----------------------------------------
TIG_AZOBR       AA----------------------------------------
TIG_RICCN       RITLI-------------------------------------
TIG_RICPR       RISLI-------------------------------------
TIG_NOSS1       ESTTGE------------------------------------
TIG_SYNY3       ATSDEE------------------------------------
TIG_SYNR3       AKTSKSKTKAAEKLITPID-----------------------
TIG_MYCLE       TEEADPNSDAIDEEVDEAAE----------------------
TIG_MYCTU       EPADEGAARAASDEATT-------------------------
TIG_CHLPN       ------------------------------------------
TIG_CHLAB       ------------------------------------------
TIG_CHLMU       ------------------------------------------
TIG_CHLTR       ------------------------------------------
TIG_THEMA       N-----------------------------------------
TIG_PSELT       N-----------------------------------------
TIG_XYLFA       ------------------------------------------
TIG_UREPA       ------------------------------------------
TIG_MYCPU       EKNNG-------------------------------------
TIG_DESAG       ------------------------------------------
TIG_AQUAE       ------------------------------------------
TIG_EHRRG       ------------------------------------------
TIG_BORBU       ------------------------------------------
TIG_TREPA       ------------------------------------------
TIG_DEIRA       GEQQSE------------------------------------
TIG_ARATH       ------------------------------------------
TIG_PELPB       ------------------------------------------
TIG_BUCAI       ELML--------------------------------------