CLUSTAL format seed alignment for MF_00311

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

VATE_DICT6       --------------MSLERIVERLETE----KRTKIEEIKNKKEKEFQEFVAKKEKELEE
VATE_DICTD       --------------MALEKIIEKLENE----KKVKIEELRKKREKEYEDFVAKKEKELEE
VATE_PICTO       --------------MSLADIIKDIDKS----REEQISKINDEYSKRIEELKKSCDSRIQS
VATE_THEVO       --------------MSLEQVIKEIEQS----QEIKKKEILENTKNILDKMEAEKKAKIDE
VATE_THEAC       --------------MSLEEVLKDIERD----KEEKKKEIADAASRETAKIEKEREEKIQI
VATE_HALOH       ----------MDVSKKISVIKKEIINE----ALDKKEQIISREKDKWEKEYEDFKQKLDN
VATE2_CLOTE      ---------MVTIEDKINLFSKIIYGE----VDDKINSELDELENVEKDTIEKEEREVKK
VATE_TREDE       ------------MEVQLQELVDKIKKDGVAAADEKAAEIIRAAEEKAKNIIEKAEAEAQE
VATE_BORBP       ------------MQFEVKDLINKIKKDGLEEAERISNDIIFKAKKEAEEIVARAEEAVGA
VATE_BORBU       ------------MQFEVKDLINKIKKDGLEEAERASNDIILKAKREAEEIVARAEEAARV
VATE_BORAP       ------------MQFEVKDLINKIKKDGLEEAERVSNDIILKAKREAEEIVARAEESARA
VATE_BORRA       ------------MQFEVKDLINKIKKDGLDEAERLASEIILNAKQEAEAIILKAESEAKE
VATE_BORDL       ------------MQFEVKDLINKIKKDGLDEAERLSSEIILNAKQEAEAIILKAESEAKE
VATE_BORT9       ------------MQFEVKDLINKIKKDGLEEAEKLANEIILNAKRDAEAIVLKAESDAKD
VATE_BORHD       ------------MQFEVKDLINKIKKDGLEEAEKLASEIILNAKRDAEAIILKAESDAKE
VATE_HYPBU       ------MTSSVRIVGDPSRFAEQLVSS----IAEHVESRVREALEAARKIVERAYEESAS
VATE_CHLPN       -------MANLNADGKLKQICDALRLDTLKPAEDEAAALLHNAKEQAKRIIQEAQEEARK
VATE_CHLCV       -------MADLGAEDKLKQICDALRIETLKPAEDEAEAIVRNAKEQAKRIIDEAQERASQ
VATE_CHLAB       -------MADLGAEDKLKQICDALRIETLKPAEDEADAIVRNAKEQAKRIIDEAQEEASR
VATE_CHLFF       -------MADLGAEDKLKQICDALRIETLKPAEDEADAIVRNAKEQAKRIIDEAQERAAQ
VATE_CHLMU       -------MADLSAQDKLKQICDTLREETLKPAEEEAGSIVHNAREQAKRIVEEAKEEAQR
VATE_CHLTA       -------MADLSAQDKLKQICDALREETLKPAEEEAGSIVHNAREQAKRIVEEAKEEAQR
VATE_CHLTR       -------MADLSAQDKLKQICDALREETLKPAEEEAGSIVHNAREQAKRIVEEAKEEAQR
VATE_CHLT2       -------MADLSAQDKLKQICDALREETLKPAEEEAGSIVHNAREQAKRIVEEAKEEAQR
VATE_CHLTB       -------MADLSAQDKLKQICDALREETLKPAEEEAGSIVHNAREQAKRIVEEAKEEAQR
VATE_METS5       -------------MVSVEELMGQVIDS----EMEVISKELSKALEEALNLVKQKRDSVER
VATE_SACS2       --------------MDFEQLLDKSLNK----VREEIKTELSKSLDEAIKLLNEGHNKIVQ
VATE_SULIN       --------------MDFEQLLDKSLNK----VREEIKTELSKSLDEAIKLLNEGHTKIIQ
VATE_SULIA       --------------MDFEQLLDKSLNK----VREEIKTELSKSLDEAIKLLNEGHTKIIQ
VATE_SULIK       --------------MDFEQLLDKSLNK----VREEIKTELSKSLDEAIKLLNEGHTKIIQ
VATE_SULIL       --------------MDFEQLLDKSLNK----VREEIKTELSKSLDEAIKLLNEGHTKIIQ
VATE_SULIM       --------------MDFEQLLDKSLNK----VREEIKTELSKSLDEAIKLLNEGHTKIIQ
VATE_SULIY       --------------MDFEQLLDKSLNK----VREEIKTELSKSLDEAIKLLNEGHTKIIQ
VATE_SULAC       -------------MVDFEELLSKTQEV----EKKKIDEELKKAFTEANLIVDEAYNEILS
VATE_SULTO       -------------MVSFEDLLNYSLNE----EKNKITEEFKKILSEMNQIIDEAYAEVYR
VATE_SPIOL       -------MNDTDVQKQIQQMVRFIRQE----AEEKANEISVAAEEEFNIEKLQLVEAEKK
VATE_GOSHI       -------MSDADVSKQIQQMVRFIRQE----AEEKANEISVSAEEEFNIEKLQLVEAEKK
VATE_CITLI       -------MNDADVSKQIQQMVRFIRQE----AEEKANEISVSAEEEFNIEKLQLVEAEKK
VATE_CITUN       -------MNDADVSKQIQQMVRFIRQE----AEEKANEISVSAEEEFNIEKLQLVEAEKK
VATE_HETSC       -----MGISDNDVQKQLRHMMAFIEQE----ANEKAEEIDAKAEEEFNIEKGKLVQLQRQ
VATE_MANSE       -----MALSDADVQKQIKHMMAFIEQE----ANEKAEEIDAKAEEEFNIEKGRLVQQQRL
VATE1_BOVIN      -----MALSDADVQKQIKHMMAFIEQE----ANEKAEEIDAKAEEEFNIEKGRLVQTQRL
VATE1_RAT        -----MALSDADVQKQIKHMMAFIEQE----ANEKAEEIDAKAEEEFNIEKGRLVQTQRL
VATE1_MOUSE      -----MALSDADVQKQIKHMMAFIEQE----ANEKAEEIDAKAEEEFNIEKGRLVQTQRL
VATE1_HUMAN      -----MALSDADVQKQIKHMMAFIEQE----ANEKAEEIDAKAEEEFNIEKGRLVQTQRL
VATE1_MACFA      -----MALSDADVQKQIKHMMAFIEQE----ANEKAEEIDAKAEEEFNIEKGRLVQTQRL
VATE2_MOUSE      -----MALTDIDVQKQIKHMMAFIEQE----ANEKAEEIDAKAEEEFNIEKGRLVQTQRL
VATE2_BOVIN      -----MALSDVDVQKQIKHMMAFIEQE----ANEKAEEIDAKAEEEFNIEKGRLVQTQRL
VATE_SCHPO       -----MSLSDEQVQAEMHKMVSFIKQE----ALEKAKEIHTLSEEEFQVEKAKIVREQCD
VATE_CANAX       -----MALSDEQVKSELSKMQAFIEKE----AKEKAKEIKLKADEEYEIEKASIVRSETA
VATE_YEAST       MSSAITALTPNQVNDELNKMQAFIRKE----AEEKAKEIQLKADQEYEIEKTNIVRNETN
VATE_THEPD       ------MRGVAEEKTLLEVIIQELRRA----AEEESRRIVKEAEQEAQKIVEEAIQKAEA
VATE_PYRCJ       -------------MSLFEDLINAKIKE--------LEDLKKNLLIDVETKIRKEAEAVVN
VATE_PYRIL       -------------MSLFEDLINSKIRE--------LEELKSNLLIDIETRIRKEATAVLN
VATE_PYRNV       -------------MSLFEDLINSKIRE--------LEDLKRNLLVNIETNIRREADAALS
NTPE_ENTHA       --------------MPIDKIITQINET----AQLERASFEEMKRKEIDQKFEVKKWQIEA
VATE3_METHJ      --------------MSVETIINRIREE----AEAEIRTIRAEEACDVGAIRAQAEQKAEN
VATE_METLZ       --------------MGLEVVVDEIKAK----GDREAAAIKAAAEAQAKEIVNEANLRANE
VATE1_METHJ      --------------MGLDAVIAEIKEK----GRHEAETIVNEGSARKDEIMNAAKQEVEK
VATE_METB6       --------------MGLEAVLEEIREK----GRKEADAIRAESKMDSDRILAEADQKVAG
VATE_METPE       --------------MGLEAVIDEITEK----GRKEAEAIRKESETEVAQVLAAANVKSDQ
VATE_METMJ       --------------MGLEAVVNEIREK----GRKEVETIRAETRTDVEEILVDAQTRAAG
VATE_METTP       --------------MALDAVVEDILAT----SKSKVAEINAETEQEVARILSEARERAAE
VATE_ARCFU       --------------MPLDKVLQEIQQK----GEEEVRRIREETEKEVEKILAEAKAEAEE
VATE_HALWD       --------------MSLDTVVEDIRDE----AQARASEIQADADERAEKIIEEAEADAED
VATE_HALLT       --------------MSLDTVVEDVRDE----ARARAEDIREAAESEADEIVAEAEADAER
VATE_NATPD       --------------MSLDTVVEDIRDE----ARARADEIRSEGEERAEEIIDEAEREADD
VATE_HALS3       --------------MSLETVVEDIRDE----ARERAKEIRADADERADEIVAEAEADADD
VATE_HALSA       --------------MSLETVVEDIRDE----ARERAKEIRADADERADEIVAEAEADADD
VATE_HALMA       --------------MSLQTVVEDIRDE----ARARAQEISDAADERAEEIIADAEADADQ
VATE_HALVD       --------------MSLDNVVEDIRDE----ARARAEDIRQDGQEQADEIVAEAEADAEE
VATE_METAR       --------------MGLDKVVKDIMDK----AEADSRDITAKAAAEAAEIKKSAEAEAKQ
VATE_METBU       --------------MGLETVIKDIMSA----AQTEVNVINADADAEVSQILDDARQTAKK
VATE_METAC       --------------MGLEIVIKDIQEG----ARAEVSRINTEADAKASEITNEAKEVQKK
VATE_METBF       --------------MGLEIVVKDIQEG----ASAEVSRIKAEGDAKASEIINEAKEVQKK
VATE_METMA       --------------MGLEIVVKDIQEG----ARAEVSRIKAEGDAKASEIINEAKEIQKK
VATE_THET2       -------------MSKLEAILSQE-------VEAEIQALLQEAEAKAEAVKREAEEKAKA
VATE_THET8       -------------MSKLEAILSQE-------VEAEIQALLQEAEAKAEAVKREAEEKAKA
VATE_DEIGD       --------------MALDKLLEHE-------AQAEIERIRAEARDRAQQILASARERADA
VATE_DEIDV       --------------MALDKLLEQE-------AQSEIERIRAEARDRSQMIVAQAQERAQA
VATE_DEIRA       --------------MALDKLLENE-------AQSEIERIRAEARGRAEKIVADARERAQT
VATE_ANADF       --------------MGYPELLRVLGEE----AAREAREVRAAADRECARILSEARAAADG
VATE_IGNH4       -------MVKVEFAGDVKNLTSYIEKD----AKAKIDSVVEEAVKEAEKLLNEKKEELLE
VATE_NITOC       ----------MTAEASVETLEAALLAR----AKRLAEEYLSRAQHSRDRIIEEANERLRL
VATE2_METHJ      --------------MAYEDLIKSIESA----AEEKKQEVLRNAEREVEAILREAETESSA
VATE_CENSY       ----------MPPDPRLEAAVDKILDR----TGEEILSGLGESRKEAAEALAGSAKTLER
VATE_AERPE       ---------MAKVQGDPRRFADTVLEK----PFKEALARVEEAREAGLKLVEEAYKSALS
VATE_GEOUR       --------------MGYVELIAALRRD----GEEQLEKIRSDAEREAERVKGDASARIER
VATE_FUSNN       -------------MSSLDNLVAEILQQ----AEKEANRILVKVKAENLEFTENENKKIQK
VATE_FINM2       -------------MSNLDNIINEILED----AKKESEHILNDANQEKEKIIETKIDQANQ
VATE_CLOD6       -------------MGNEQKMIDRIIAD----AKQEAQEILDKAKSEADLKVNSANEKAEK
VATE_CLOPS       -------------MSNLNNLTSKILND----AEEKKKYILAEAEAQKDKIISKKTNRAEA
VATE_CLOP1       -------------MSNLNNLTSKILND----AEEKKKYILADAEAQKDKIISKKTNRAEA
VATE_CLOPE       -------------MSNLNNLTSKILND----AEEKKKYILADAEAQKDKIISKKTNRAEA
VATE_CLOBA       -------------MSNIDNLTSRIIKD----AEDKKRIILSEAEEKKSKIIAKKQEKAAS
VATE_CLOBB       -------------MSNIDNLTSRIVKD----AEDKKRIILSEAEEKKSKIIAKKQEKAAS
VATE_CLONN       -------------MSNITGLTNKIIED----AKVSSKEIMDDAKKKEKIIIDEKVSIAEN
VATE1_CLOTE      -------------MSRLENLTSKIIKD----SEEKAKIILDEAKREEEKIMLGQKQEGES
VATE_CLOB1       -------------MSNLENLTSKIIED----ANKEAEELLSEAKKEENKIVDEKVKKGNK
VATE_CLOBH       -------------MSNLENLTSKIIED----ANKEAEELLSEAKKEENKIVDEKVKKGNK
VATE_CLOB6       -------------MSNLENLTSKIIED----ANKEAEKLLSEAKKEENKIVDEKIKKANK
VATE_CLOBJ       -------------MSNLENLTSKIIED----ANKEAEKLLSEAKKEENKIVNEKVKKGEK
VATE_CLOBM       -------------MSNLENLTSKIIED----ANKEAEKLLSEAKKEENEIVDEKVKKANK
VATE_CLOBK       -------------MSNLENLTSKIIED----ANKEAEKLLSEAKKEENEIVDEKVKKANK
VATE_CLOBL       -------------MSNLENLTSKIIED----ANKEAEKLLSEAKKEENEIVDEKVKKANK
VATE_THEPX       -------------MQGIAKIKEKIFEE----ATEQKNRIIEKAKKEAAEILEKARKQAVQ
VATE_THEP3       -------------MQGIAKIKEKIFEE----ATEQKNRIIEKAKKEAAEILEKARKQAVQ
VATE_ACET2       -------------MAGVEKIKERILEE----ARAQAEANIKRAEEEAAKIIEEAQKEAAA
VATE_STAMF       -----------MNTHEVEELRQKLLED----ARKKSEEIIREAEREAERIIEEAERKWRE
VATE_METKA       --------------MGVEELERKILED----AEKEAEEILEEAKRDAERIREKAEREAEE
VATE_THESM       -------------MEGARLIIEEINKE----AEQKIKYILEEAEQKAEKIKQEAEKKARI
VATE_THEKO       -------------MEGAELIIQEINRE----AEQKIQYILSEAQKEAEKIKEEARKRAED
VATE_THEGJ       -------------MEGAELIIQEIHRE----AEQKIQYILSEAQREAEKLKEEARKRAQS
VATE_DESSY       -------------MEGAELIIQEINRE----AEQKIQYILSEAKEEAEKLKEEARKRAEA
VATE_THEON       -------------MEGAELIIQEINRE----AEQKIQYILSEAQKEAEKIREEARKRAQA
VATE_PYRFU       -------------MNGAQVIIQEINRE----AEQKIKYILDEARKEAEKIKEEARKRGES
VATE_PYRAB       -------------MSGAELIIQEINRE----AERKIEYILNEAREEAEKIKEEAKRRAES
VATE_PYRHO       -------------MNGAELIIQEINKE----AERKIEYILNEARQQAEKIKEEARRNAEA
VATE_META3       --------------MGADKITSKILDD----ANNTASKIKSEAQKEADLILEKAKIEAEE
VATE_METJA       -----------MKLMGVDKIKSKILDD----AKAEANKIISEAEAEKAKILEKAKEEAEK
VATE_METVS       --------------MGAEKITSKIMED----AKIQANVILAEAQKEKEALIKKAHEEAEK
VATE_METM5       --------------MGAEKITSKIVED----ANKNAEKILAEALNEKEAILTEAKEEAST
VATE_METMP       --------------MGAEKITSKIVED----ANKNAEKILAEALNEKEAILTEAKEEASK
VATE_METM6       --------------MGAEKITSKIVED----ANKNAEKILAEALNEKEAILTEAKEEASK
VATE_METM7       --------------MGAEKITSKIVED----ANKNAEKILAEALNEKEAILTEAKEEASK
VATE_METST       ------------MSVGADKIISNIKAD----AQAKADEIISKAKAESEKIIADGEAKAQI
VATE_METTH       ------------MSSGAEKIVSSIMSE----AQAKADAIIREAEDEAAGIVDEGEKRARM
VATE_METS3       ------------MSSGTNKIVESIKSE----AQEKADKIIQDAQAEIATINSDAEKTAEA
                                                                             

VATE_DICT6       WKEKQKRSLKEKLNREENTLAAQLKLKYNAEKLRIESDAIAKVKNLVLER-LKSSSNE--
VATE_DICTD       WKEQQRKNLKESLNREESTLLSQLRLKYNTEKARIEAETVNRVKLLLLEK-IKSLSNE--
VATE_PICTO       IKEYYEKKKEADIKTLKKVQEDKIKIDSKSIKMEKRREIVKDALDISYYH-LMNITKS--
VATE_THEVO       IRALYQEKMRAESSRITASIIDKANIEARSILRNKIEEILEGYVSAAQEI-LRNIRNM--
VATE_THEAC       LQREYENRMREEGSRLYNSIIDKANVEARNIVRMRVQEILDQYGAKADEL-IKNLAKT--
VATE_HALOH       KEKEIIELYRQEARMKKEQIVSRAVLKKKTEKRQKMDEYLHQILKELEEK-LHEYRND--
VATE2_CLOTE      YRNKNMQSVEKKIKSKFEKEVFKLKLEEQQQLLNLKENMINETLESLKER-IIDFTKS--
VATE_TREDE       ----SVKKAEAEALRFQKAAESSIDQAGRNTLISFRQGLLNELNAIIKAE-TAKNY-D--
VATE_BORBP       ----LKAKSEKEINDYKRHALEASRQAIRDLIIGVEKNLKSLFENTLKDN-VAEVFSD--
VATE_BORBU       ----LKAKSEKEANDYKCHALEASRQAIRDLIIGVEKNLKSLFENALKDN-VTEVLSD--
VATE_BORAP       ----LKAKSEKEINDYKSHALEASRQAIRDLIIGVEKNLKSLFENTLKDN-VVEVFSD--
VATE_BORRA       ----LKIKAEKEAYDYKRYSLEASRQAFRDLVIGTENSIKSLFKSALKDS-VSSVYDS--
VATE_BORDL       ----LKIKAEKEAYDYKRYSLEASRQAFRDLVIGTENSIKSLFKSALKDS-VSSVYDS--
VATE_BORT9       ----LKMQAEAEANEYKRYSLEASRQAVRDLIIGTEKNIKSLFKTALKDS-VSRVYDD--
VATE_BORHD       ----LKMQAEKEAGEYKIHSLEASRQAVRDLIIATENNIKSLFKIALKDS-VSEVYDD--
VATE_HYPBU       KLESELRRALREAEEQVQAYTAKREVELRKRLAEIRAKAVEEIMSVALQR-LREYVGL--
VATE_CHLPN       ----ILETAEERAHQKIKQGEVALSQAGKRALEALKQAVENKIFRESLVEWLEHVTTD--
VATE_CHLCV       ----IITSAQQDADHKLKQGESALAQAGKRSLESLKQAVENKVFKESLAEWLDNALAD--
VATE_CHLAB       ----IITSATEEADHKLKQGESALAQAGKRSLESLKQAVENKVFKESLAEWLENTLAD--
VATE_CHLFF       ----IIASAKEEADFKLRQGESALAQAGKRSLESLKQAVENKVFKESLAEWLDNALAD--
VATE_CHLMU       ----IIRSAEETASQTLKKGEAALVQAGKRSLENLKQAVETKIFKESLVEWLDGVTTD--
VATE_CHLTA       ----IIRSAEETADQTLKKGEAALVQAGKRSLENLKQAVETKIFRESLGEWLDHVATD--
VATE_CHLTR       ----IIRSAEETADQTLKKGEAALVQAGKRSLENLKQAVETKIFRESLGEWLDHVATD--
VATE_CHLT2       ----IIRSAEETADQTLKKGEAALVQAGKRSLENLKQAVETKIFRESLGEWLDHVATD--
VATE_CHLTB       ----IIRSAEETADQTLKKGEAALVQAGKRSLENLKQAVETKIFRESLGEWLDHVATD--
VATE_METS5       TYTAKMQEMVTKAKEEIEGERARLDIEVKRAVLGEKNYWLNKVYEGTIKS-LGTVKNS--
VATE_SACS2       EYSQRINELIVKTKEEIEGEKARLEVENKRTLLVEKEYWINKVYERVLGK-IGEVVKT--
VATE_SULIN       EYTQRINELITKTKEEIEGEKARLEVENKRTLLVEKEYWINKVYERVLEK-IGEVVKT--
VATE_SULIA       EYTQRINELITKTKEEIEGEKARLEVENKRTLLVEKEYWINKVYERVLEK-IGEVVKT--
VATE_SULIK       EYTQRINELITKTKEEIEGEKARLEVENKRTLLVEKEYWINKVYERVLEK-IGEVVKT--
VATE_SULIL       EYTQRINELITKTKEEIEGEKARLEVENKRTLLVEKEYWINKVYERVLEK-IGEVVKT--
VATE_SULIM       EYTQRINELITKTKEEIEGEKARLEVENKRTLLVEKEYWINKVYERVLEK-IGEVVKT--
VATE_SULIY       EYTQRINELITKTKEEIEGEKARLEVENKRTLLVEKEYWINKVYERVLEK-IGEVVKT--
VATE_SULAC       EYSKRIQEIISKNIEALRGEEAKLEVETKRAVNKEKDYWVQQVFQKTLDE-LEKIANT--
VATE_SULTO       EYSAKITDLVNKNNDRIRGEIAKMEIENKRLISKEMDYWIENVKENAKKS-LYEFVKT--
VATE_SPIOL       KIRPEYERKEKQVQVRRKIEYSMQLNASRIKVLQAQDDLVNSMKEEAAKE-LLRVSGD-H
VATE_GOSHI       KIRQEYEKKEKQVEIRKKIEYSMQLNASRIKVLQAQDDVVNAMKESASKD-FLNVSHD-H
VATE_CITLI       KIRQEYERKEKQVEIRKKIEYSMQLNASRIKVLQAQDDLVSNMMEAASKE-VLNVSRD-H
VATE_CITUN       KIRQEYERKEKQVEIRKKIEYSMQLNASRIKVLQAQDDLVSNMMEAASKE-VLNVSRD-H
VATE_HETSC       KIMEYYEKKEKQVELQRKIQRSNMQNQSRLKCLKARDDHLKNVLEEARAN-LSKISAD-R
VATE_MANSE       KIMEYYEKKEKQVELQKKIQSSNMLNQARLKVLKVREDHVRNVLDEARKR-LAEVPKD-I
VATE1_BOVIN      KIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQR-LSKVVKD-T
VATE1_RAT        KIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQR-LSKVVKD-T
VATE1_MOUSE      KIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQR-LSKVVKD-T
VATE1_HUMAN      KIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQR-LSKVVKD-T
VATE1_MACFA      KIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQR-LSKVVKD-T
VATE2_MOUSE      KIMDYFEKKEKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKDAKMR-LSRIVSD-E
VATE2_BOVIN      KIMEYYEKKEKQIEQQKKIQMSTLRNQARLKVLRARNDLISELLNDAKLR-LSRIVTD-P
VATE_SCHPO       AIDQTYDMKLKRASMAQKIAKSNVLNKSRLEILNSKQKVIDDIFSRVEKK-LDGIEQK-K
VATE_CANAX       AIDSTYEQKLKKASLAQQITKSTIGNKTRLRILSTKDEVLHEIFDEAEAE-LKKITKD-K
VATE_YEAST       NIDGNFKSKLKKAMLSQQITKSTIANKMRLKVLSAREQSLDGIFEETKEK-LSGIANN-R
VATE_THEPD       IKAEKLNQLLNEYRQKAMAELAPKRLELRHRAIREKHELIESALNRAIEE-AVKTILGND
VATE_PYRCJ       KSLERIATVESETLLEREKILYDAVVESRKMIAETYESLLQDLINSIYNE-IERMRGS--
VATE_PYRIL       KYSTQITNIESEVALERERILYSAIIEARRKIVETYEQILNDFIETIYNE-VDKLRGS--
VATE_PYRNV       KFSAQLANVESEATLERERIIYNAVVEARRKIAEVYDQMLKDLVNAVYEE-VDKMRGA--
NTPE_ENTHA       DFQKEKASKLEEIERSYRQLRNKQKMQVKQEILNAKQEVLQRLFTEATLQ-LENEPKE--
VATE3_METHJ      AYNHRIAEGQREIRQLIASQESRTRIEAKRKVREVREEMLRQCFDEVSSY-LKTIRTR--
VATE_METLZ       IRLAAEKDADTQADRIMIREVASANLVVKRDFLNAQKELLDKVYTSAAEE-IANLPAD--
VATE1_METHJ      IHLTVRDEVEKNLSHIISQEEAAAHLIVKRQVLNAQKDLMDQVYKQALDK-IVSMPES--
VATE_METB6       IKAEAEEASTKQAARVTAQEISAANLLVKREILNTQKGLLDEVYEGTIAE-IAKLPES--
VATE_METPE       IKTAVDEDVARQEARIINQEVSAANLLVKRSQLNAEKSLLDQVYAAVLLE-VRGASPD--
VATE_METMJ       IKASAQEEADRAVTHIINQEASAANLVVKRQVLNAQKTLLDQVYSASLAA-VGDLPAE--
VATE_METTP       IKSRKEAEAKHDIEALVRREMSSANLELKRAELNVHKEVLEQVRIKFLDA-VTNLPKD--
VATE_ARCFU       ILKKAREEAEKEAEAIRRQEISSVKLEMKRELLNVQKEILEEVFNLLRQK-VRDMDEE--
VATE_HALWD       ILEERKDEVEEQIEREREQALSSANLEAKQNRLEARRDVLDDVLNRVEDE-LASLSNA--
VATE_HALLT       IREERLAEVDRQIDQEREQTLSSAKLEAKQERLGARRDVLEDVYDDVEAA-IEGLDGD--
VATE_NATPD       IVDEAEREAERKISQERDQKLSSAKLEAKQARLEARREVLEEVHDDVEAQ-IADIDGD--
VATE_HALS3       IIADAEAEVTAEIDQEREQQLSSAELEAKQMRLEARRDALQSVRSAVEDR-IVALDGD--
VATE_HALSA       IIADAEAEVTAEIDQEREQQLSSAELEAKQMRLEARRDALQSVRSAVEDR-IVALDGD--
VATE_HALMA       IREEREAEVERTIEQEREQRLSSAKLEAKQARLNARRDILEDVHGDVEDA-LAALEGD--
VATE_HALVD       LLESRKADVEQQLEREREQALSSAKLEAKQARLSARRDVLQRVREQVERE-LAELEGD--
VATE_METAR       IIAAENARAEQAISKMRQRELSSAKLDVKKAKLNSEKDVLAETHEAFVRQ-LSTLPRE--
VATE_METBU       IMGDRLAKAEDDIKRLRQQEISSANLEVKRAMLNARKEVLDKVYNNAIDS-IVSLPGS--
VATE_METAC       MLGDSLAKVEEDLQKLHQQVISSANLEVKRITLNKRKELLDNVYSQTVES-IKSMPAS--
VATE_METBF       TLGDSLAKAEEDLQNLHQQVISSANLEVKRITLNKRKDLLDKVYVQTVEK-IKSMPAS--
VATE_METMA       TLGDSLAKAEEDLQSLHQQVISSANLEVKRITLNKRKELLDTVYNQTVEN-IKSMPAS--
VATE_THET2       LLQARERALEAQYRAALRRAESAGELLVATARTQARGEVLEEVRRRVREA-LEALPKK--
VATE_THET8       LLQARERALEAQYRAALRRAESAGELLVATARTQARGEVLEEVRRRVREA-LEALPQK--
VATE_DEIGD       LLESRRRLLETQRQAALVRARSAADLELSAARLTASEQGMAEVYRLVEGH-LREITGL--
VATE_DEIDV       LIESRQRALETQRQAGIVRARSAADLDLNAARLTASESGMSQVYELVNQQ-ITEITRV--
VATE_DEIRA       LLDSRQRLLENQRQAGLVRARSAADLELNAARLTASESGVTQVYQMVEDY-LGNVTSA--
VATE_ANADF       ARAAVLARVREESEAHRRASREAIALERERALLVERRRQLERLRLEALAR-LRGAGGP--
VATE_IGNH4       RAVVDVEKLLSDAQARLSAEKSSIDMEVRRKVEERKKELFQKVVEEAWKRALEEAEKK-T
VATE_NITOC       REEREILAAKAMAERVYRRQVQASELKLQGKLDRLRWEWVQAVVQNLSHQ-CKVLATD-K
VATE2_METHJ      IHAQYLEKAKRDLILENNRQKFLAKQEVKKRISAVRQKLIDDAFSRSKEK-ISGIRSD--
VATE_CENSY       EYDRIVEEGRKEADKIHRKIVGSADLEARNKQILLLETAIDRVLEKV----LASISAERG
VATE_AERPE       AARKRLESRVEEARERLQGLKSKADLEVRTEAERVKDELVSRLIEEALAE-FRRRKAG-M
VATE_GEOUR       LRAEYAERLASLEAAQARAILADAESKASSIRLATESALAVRLFLLARSS-LHHLRDE--
VATE_FUSNN       EIENIQWKTNEEAISLKERIISNANLKSRDMVLQAKEELVDKVLKMTLER-LKNLDSD--
VATE_FINM2       EKDTILKKAESEAKGVYDRHLSQVVLKSRDNALFAKQEVIDSVLQKIKDK-LKNMSLE--
VATE_CLOD6       EMASYTKLAEAEAEKAASKEISGAYMEAKKQILSKKQEILEEVILEAKNK-LLNLKDN--
VATE_CLOPS       DKEEIITKANIEAEVKKARIISNAKLSVRNDMLRAKQDVISKVFNEAIEK-LQNLSNG--
VATE_CLOP1       DKEEIITKANIEAEVKKARIISNAKLSVRNDMLRAKQDVISKVFNEAIEK-LQNLSNG--
VATE_CLOPE       DKEEIITKANIEAEVKKARIISNAKLSVRNDMLRAKQDVISKVFNEAIEK-LQNLSNG--
VATE_CLOBA       EEKIIIEKAETEAVAREERIISSAELQARNEKLKSKQTVISKVFETTIEE-LCNASSD--
VATE_CLOBB       EEKIIIEKAETEAVAREERIISSAELQARNEKLKSKQTVISKVFETTIEE-LCNASSD--
VATE_CLONN       ERKLILSKAEEESKVRAGRIISNANLQVRDMKLSAKIEVLDNVFNAAVEE-LSRMTGG--
VATE1_CLOTE      IKSKIIEKAYLESKNRKERIISNSHLFVRNRKLEAKQEVIDKVYKEALNK-LAKLNKE--
VATE_CLOB1       AKEQIIEKSKREAKTKAERIISNTHLKIRNNKLEAKQEMINKVFDEAVIK-LQNLSKD--
VATE_CLOBH       AKEQIIEKSKREAKTKAERIISNTHLKIRNNKLEAKQEMINKVFDEAVIK-LQNLSKD--
VATE_CLOB6       AKEQIIERAKRESRTKAERVISNAHLKVRNNKLEAKQEMINKVFDKAVIK-LQNLSKD--
VATE_CLOBJ       VKEQIIEKSKGEAKTKAERVISNTQLKVRNNKLEAKQEMINKVFDEAVIK-LQNLPQE--
VATE_CLOBM       AKEQIIEKTKREAKTKAERVISNTHLKVRNNKLEAKQEMINKVFDEAVIK-LQNLPQE--
VATE_CLOBK       AKEQIIEKTKREAKTKAERVISNTHLKVRNNKLEAKQEMINKVFDEAVIK-LQNLPQE--
VATE_CLOBL       AKEQIIEKTKREAKTKAERVISNTHLKVRNNKLEAKQEMINKVFDEAVIK-LQNLPQE--
VATE_THEPX       LEAEAEKKAKKVAREEKRKILSIAELEERKRYLEAKQALINEAFVSAEKK-LLNLESE--
VATE_THEP3       LEAEAEKKAKKVAREEKRKILSIAELEERKRYLEAKQALINEAFVRAENK-LLNLEPE--
VATE_ACET2       KKAQILEKAKQEAVDVKKRLKAMAELEARKKKLQARQEVVDEAFNKTIEK-LNSLPDR--
VATE_STAMF       KAEQEREKIITNARLEAQKIISEARRNYRITISKAKAEVINKILEEAKIR-LTNRIGF--
VATE_METKA       VRREILDRARREAETRRRREIAQAKLEIRQERLRVKEEYIEKAIERAEEK-IRELAEEGR
VATE_THESM       KADWIIRKAQTQAELEKQRIIANAKLEVRRKKLVLQEELINEVIGAIKDR-LLSIPEA--
VATE_THEKO       RAQWILRKAKTQAEMEKQRAIASARLEVRKKRLEVQEEMIRAVLSALRER-LASLPAD--
VATE_THEGJ       QAEWILRKAKTQAEIEKQRIIANAKLEVRRKKLAVQEELIGEVLSAMREK-LAALPDD--
VATE_DESSY       KAEWILRKAKTQAEIEKQRIIANAKLEVRKKKLAVQEELIRSVIESLKER-LANLPED--
VATE_THEON       RAEWILRKAQTQAEIEKQRIIANAKLEIRKKRLEVQEALIQEVITALRER-LAELPEE--
VATE_PYRFU       RAEWILRKAKTQAELEKQRIIATARLEVRRKKLSLQEEYISRVLKEVTSR-LSNLSED--
VATE_PYRAB       KAEWILRRAKTQAELEKQRIIANARLEVRRKRLAVQEEIIRNVLDEVRKR-LQEMPEE--
VATE_PYRHO       KAEWIIRRAKTQAELEKQRIIANARLEVRRKRLAIQEEIISSVLEEVKRR-LETMSED--
VATE_META3       QTQDILKRGDKEAETTYNRILAEARLNSKKKMLKERENLINMAIEKLKED-LKELPKK--
VATE_METJA       RKAEILKKGEKEAEMTKSRIISEAKLEAKKKLLEAKEEIIEMAINKLKEE-LVKLPEQ--
VATE_METVS       KKQAILKKGEKDAEMTRNRILAEARLSAKKNSLEERERTIAKAIQKLEED-LVKLPQK--
VATE_METM5       KEQAIAKKGEKDAEMTKNRILAEARLSAKKKLLEEREKTIQLTLEKLEED-LVKLPQK--
VATE_METMP       KEQAIAKKGEKDAEMTKNRILAEARLSAKKKLLEEREKTIQLTLEKLEED-LVKLPQK--
VATE_METM6       KEQAIAKKGEKDAEMTKNRILAEARLSAKKKLLEEREKTIQLTLEKLEED-LVKLPQK--
VATE_METM7       KEQAIAKKGEKDAEMTKNRILAEARLSAKKKLLEEREKTIQLTLEKLEED-LVKLPQK--
VATE_METST       EKEQILDSANKQADMKYQQIISEAKVNSRRKELEAREELIEKAFRIASEK-IEKLASENS
VATE_METTH       ASERILESARKQADMRYQQIISEAKMNARRAELEAREEVIQEAFKKAEEE-LKNLASTSQ
VATE_METS3       EKNKILDNGKKQSDMKYQQIISEAKMNARRAELGAKEEVIEAAFAKATED-LKAKASSDD
                                                                             

VATE_DICT6       -VYNKIWENLLERESIKS------GEMILTKNEDKIDVD---------------YFCKKY
VATE_DICTD       -LYNGIWDGFVEKESVK-------GGEIILAKGEDKIDV-------------D-HFCKKY
VATE_PICTO       KRYDSILNSMVSTAIKTLG-----EDCEIFASESDAKKI--------------------N
VATE_THEVO       PEYPALLNKMIEVAKKYLG-----QDCIIKVDSKDKAVA----------------PSSGI
VATE_THEAC       KEYDDVLKKMIEVSRKALG-----PDCIVKVNTADKGRI-----------------SDGN
VATE_HALOH       TGYRDFLKRLVKDSLNVMES----SHVIIKLNSHDLKIF-----NEIQDELRNEIDNIEI
VATE2_CLOTE      DEYINYIKSHLDNTLKDIEN---KEGIIIYFNKKDLEKF--------KKVINK----DNV
VATE_TREDE       ---SAVLKNLIPEAVKGWVKTGNTENLSVILADKDLKELESSL----SAALKD-HIAKGM
VATE_BORBP       ---NDFLSELIIKITDSWIKE---EKLVIQLNESDFSGL----EQILRLKLGN-KLKEGI
VATE_BORBU       ---NNFLAELIIKITDSWAKG---EKLVIQLNESDFSSL----EQILRLKLGN-KLKEGM
VATE_BORAP       ---NNFLAELIIKITDSWAKE---EKLVVQLNESDFSSL----EQILRLKLGN-KLAQGI
VATE_BORRA       ----NFLRELIIRVLDVWGK---DDKIDIMLNESDIDNLSSILKTSIRNKFGA-----EI
VATE_BORDL       ----NFLRELIIRVLDVWGK---DDKIDIMLNESDIDNLSSILKTSIRNKFGA-----EI
VATE_BORT9       ----NFLRDLIIKVVDIWSK---NDKIDIMLNESDFSNL----LSVLRAKIGN-RLDDAI
VATE_BORHD       ----NFLRELIIRVVDIWSK---KDKIDIILNESAVSNL----LSILRVNIGN-RLDDAI
VATE_HYPBU       EAYKEFIKRLLDSALETASR---RSRRVIVHPARPDQAIVAELAPRVAAE-------KGI
VATE_CHLPN       PEVSTKLIQALVQALEAQGV---SGNLTAYIGKHVSPRAVNELLG--KAVTTK-LRKKSV
VATE_CHLCV       PEVSAKLVAALIQAIEDQGI---SGDLTACIGKHVATRAVNEFLG--KSVLAK-LKGKGV
VATE_CHLAB       PEVSAKLVAALIQAIEDKGI---SGDLTAYIGKHVATRAVNEFLG--KTVLAK-LKGKGV
VATE_CHLFF       PEVSAKLVAALIQAIEDKGI---SGDLTAYIGKHVATRTVNEFLG--KTILAK-LRGKGV
VATE_CHLMU       PGVSAKFVQALVQTVETQGI---SGNLSACIGKHVSARAVNEALG--KEITSK-LKDKGV
VATE_CHLTA       PEVSAKLVQALVQAVDAQGI---SGNLSAYIGKHVSARAVNEALG--KEITSK-LKEKGV
VATE_CHLTR       PEVSAKLVQALVQAVDAQGI---SGNLSAYIGKHVSARAVNEALG--KEITSK-LKEKGV
VATE_CHLT2       PEVSAKLVQALVQAVDAQGI---SGNLSAYIGKHVSARAVNEALG--KEITSK-LKEKGV
VATE_CHLTB       PEVSAKLVQALVQAVDAQGI---SGNLSAYIGKHVSARAVNEALG--KEITSK-LKEKGV
VATE_METS5       QGYKQGLESVLKRELR--------DGSIVYCSEDEVDQV--------QKMIKG--LKAKA
VATE_SACS2       KEYKDAIENIISKEIKEIRE----EKVTIYCSPNDKLMI--------EKIVGN---NKNV
VATE_SULIN       KEYKDAIQSILNKEIKEIEG----EKITVYCSPNDKSTV--------EKVVGN---NKNV
VATE_SULIA       KEYKDAIQSILNKEIKEMEG----EKITVYCSPNDKSTV--------EKVVGN---NKNV
VATE_SULIK       KEYKDAIQSILNKEIKEMEG----EKITVYCSPNDKSTV--------EKVVGN---NKNV
VATE_SULIL       KEYKDAIQSILNKEIKEMEG----EKITVYCSPNDKSTV--------EKVVGN---NKNV
VATE_SULIM       KEYKDAIQSILNKEIKEMEG----EKITVYCSPNDKSTV--------EKVVGN---NKNV
VATE_SULIY       KEYKDAIQSILNKEIKEMEG----EKITVYCSPNDKSTV--------EKVVGN---NKNV
VATE_SULAC       KDYKNRIESILSRELT--------EGAIVYCSNNDKKFI--------EGILTT-KRINNV
VATE_SULTO       DNYKKGLESIISREVS--------DGSIIYCSPSDQKSI--------SDIIKK--KKISC
VATE_SPIOL       HHYKRLLKELVVQSLLRLRE----PGVLLRCREDDVHLVEHVLNSAKEEYAEK-AEVHTP
VATE_GOSHI       HVYKRLLKDLIVQSLVRLKE----PGVLLRCRKEDLHLVESVLDSAKEEYASK-VNVHPP
VATE_CITLI       NSYKKLLKDLIVQSLLRLKE----PAVLLRCRKDDHHLVESVLESAKEEYAQK-LQVHPP
VATE_CITUN       NSYKKLLKGLIVQSLLRLKE----PAVLLRCRKDDHHLVESVLESAKEEYAQK-LQVHPP
VATE_HETSC       ERYPAILKGLLLQGLFQLLE----SKVVLRCRKKDEEMVARILPECLEEVQRT-WGNRSE
VATE_MANSE       KLYSDLLVTLIVQALFQLVE----PTVTLRVRQADKALV-ESLLGRAQQDYKA-KIKKDV
VATE1_BOVIN      TRYQVLLDGLVLQGLYQLLE----PRMIVRCRKQDFPLVKAAVQKAIPVYKVA--TKRDV
VATE1_RAT        TRYQVLLDGLVLQGLYQLLE----PRMIVRCRKQDFPLVKAAVQKAIPMYKIA--TKKDV
VATE1_MOUSE      TRYQVLLDGLVLQGLYQLLE----PRMIVRCRKQDFPLVKAAVQKAIPMYKIA--TKKDV
VATE1_HUMAN      TRYQVLLDGLVLQGLYQLLE----PRMIVRCRKQDFPLVKAAVQKAIPMYKIA--TKNDV
VATE1_MACFA      TRYQVLLDGLVLQGLYQLLE----PRMIVRCRKQDFPLVKAAVQKAIPMYKIA--TKNDV
VATE2_MOUSE      EIYQDLLDKLVLQALLRLLE----PVMIVRCRPQDLHLVESAVLRAIPQYMR--LCQKHL
VATE2_BOVIN      EFYQGLLDKLVLQGLLRLLE----PVVIVRCRPQDHFLVEAAVQRAIPQYTAV--SHRCV
VATE_SCHPO       DAYTKFMADLIVQAMELLGE----PVGIVYSRQRDAEIVKAAIPKATEVLKSK-NGSIDY
VATE_CANAX       KQYKPVLVGLIEEGVLALME----PKVSIKVREQDVDVAKEAITEAAKNFEEK--AKFKV
VATE_YEAST       DEYKPILQSLIVEALLKLLE----PKAIVKALERDVDLIESMKDDIMREYGEK-AQRAPL
VATE_THEPD       DYRRTFLEKSLEKGVVALSS----TDLVVHPCRGSASIV-GQVVEAVAARLSK--VKPGL
VATE_PYRCJ       ERYINFLSRLLENAVTYIQS----KEVVIYASPKDRGVV---------ETLARKLGLSGL
VATE_PYRIL       ERYVKFLRFLIESAINYTQT----KDVIIYASPKDRGVV--------ETLAKN-LGITGF
VATE_PYRNV       ERYVKFLTSLLETAEKYVQT----KDVVIYASPKDKGVV--------EAVARN-LGLTGI
NTPE_ENTHA       -EQLALMKQMIQTLPIN-------GTARLIPGEKSADILTPAVIAEWNEELPF-ELIRED
VATE3_METHJ      PEYPSFLEAMITESAKNLGP----SDIAVKVHPDDRRLA--------ADSISR-INQEGF
VATE_METLZ       -VHAKAVRELLKESAKQI------KAGVVFTNARDEKAA--------KEAISGLKTLSGF
VATE1_METHJ      -FHEEAITSLLRKAKEEI------PKGRVSCAARDEKIL--------KNVLKQ-SEFSAY
VATE_METB6       -FHREAIKKLLTEAKKEI------PKGKIHCNARDEAAA--------KAVLAE-KEFSGF
VATE_METPE       -FHRAALSSLLQQARAEI------GEGMIHASARDLPMV--------QTLLKE-GSYPGF
VATE_METMJ       -FQEKALTALLKRAVKEI------KKGVVHANERDSPVV--------EEILSQLKMFSGY
VATE_METTP       -KNEALIKKLLEPYDL--------KDMKVYSSKRDQAFV--------SSLVPN-------
VATE_ARCFU       -TRKKILKNLLEKNAS--------PGMVVYSRKEDEDIV--------KELIKE--LKLDV
VATE_HALWD       -KREELTKPLVTAAITEFDD---DETVKLYARADDADLL--------NSLLEE---HEKA
VATE_HALLT       -RRRELTETLLDATLAEFDD---DEDVAVYTHTEDVDLV--------EELVED----RNA
VATE_NATPD       -EREALTRSLLDAAAEEFDG----DSVRVHGHEDDADLL--------EGIVAD---YDGF
VATE_HALS3       -EREELTRELLDAASTEFDG---ADTVRVFGRADDEALI--------SEILDD---YDGY
VATE_HALSA       -EREELTRELLDAASTEFDG---ADTVRVFGRADDEALI--------SEILDD---YDGY
VATE_HALMA       -RREELTRALLDAAVDEFDDS---DELSVYGRASDQSLL--------EDVLDD---YDGA
VATE_HALVD       -RREELTRSLLDAAAVEFED---ADEVSVYGRADDEELL--------SSILED---YDGY
VATE_METAR       -KKADLLQKLVKLAKKDI------PQGKIFTNAADADLV----------------KDSGY
VATE_METBU       -KQEELLKAIIDENDS--------NGSNIYSNKDSEKLV---------------RKLSSL
VATE_METAC       -KNEKLLKHIIDKYEA--------SGDKIYSSKASEETV---------------RKLSSL
VATE_METBF       -KKEELLKNILSKYEA--------SGARVYSSKDSEDIV---------------KKLTSL
VATE_METMA       -KKEELLKSILDKHEA--------SGARAYSSKESEELV---------------KKLTSL
VATE_THET2       PEWPEVVRKLALEALEALP-----GAKALVANPEDLPHL---------EALAK---ERGV
VATE_THET8       PEWPEVVRKLALEALEALP-----GAKALVANPEDLPHL--------EALARE----RGV
VATE_DEIGD       PEYREILARLIAEARQAIP-----EAEAVEVNPADLALA--------RELVTD------L
VATE_DEIDV       PEYRDILGRLIYQAREVIT-----DAEAVEVNPAEAALA--------RELVHD------I
VATE_DEIRA       PEYGNILSRLIQEGLQAVP-----DAEAIEVNPAEMNVA-------------R-HLVSGV
VATE_ANADF       ----ALDAALLAELLPEAGD----GPLEVIVDPGAEAEVGRALASLDPAVAAR------A
VATE_IGNH4       ERYKKFLEKVLIAMSNEAGE----DEVIAYVRADDLEDV--------RAMVQE-KGLKNV
VATE_NITOC       SRYLPVLQRLLAAGAAAIER----EELIAEINQQDLGRLQETWKTFAAEAVSD----KCV
VATE2_METHJ      PSYPALYERLTREVISALAG----EEIILHIDPADSKIC--------SDVLKK--TGIVC
VATE_CENSY       PGYPDMIKSLIGEATATLGT----TQVVVRAGSRDKDVV--------QASLGG---FPGA
VATE_AERPE       ESYRQYLERVLGSAAGESGG----SVAKVLCAPEDEEIV--------REVLGK-LGLDGV
VATE_GEOUR       -GYEQLFADLVRELPPG-------EWRRVVVNPADMALAA--------------RHFPNA
VATE_FUSNN       -SYLDFVENALKTLNIS-------KNAEIILTKKMKDVL----------------GKEIF
VATE_FINM2       -DYKKYLTNSLSKMDLN-------SDDLLVLQSDKYDSL---------------KNENFN
VATE_CLOD6       -EYEEIILNMIEKSNCT-------DDSEIVLSKKDKKTL--------KDVLSK----KGI
VATE_CLOPS       -DYKYYVISTLDSLELE-------GTEVIIINEKDKDIFSNEFLEALNKELES-KGKKGS
VATE_CLOP1       -DYKYYVISTLDSLELE-------GTEVIIINEKDKDIFSNEFLEALNKELES-KGKKGS
VATE_CLOPE       -DYKYYVISTLDSLELE-------GTEVIIINEKDKDIFSNEFLEALNKELES-KGKKGS
VATE_CLOBA       -DFKGFVKTVILNSTLA-------GDENLILNEQGKKMIDSDFVAELNREIGS-KGNITL
VATE_CLOBB       -DFKGFVKTVILNSALA-------GDENLILNEQGKKMIDSDFVAELNREIGS-KGNITL
VATE_CLONN       -ELLNFIKNTILLLDID-------GDEEIIVGENEDRVT-TEFINEINKELNA-KGKLGK
VATE1_CLOTE      -EYLNFIKDSILALEIY-------GDEEIILS-QDEKYINKETIEEINKELKS-KGKKGE
VATE_CLOB1       -EYLDFVKSSILSLDIE-------GDEEIIISPNDKDKMDVNFMLTLNNKLKA-KGKKGL
VATE_CLOBH       -EYLDFVKSSILSLDIE-------GDEEIIISPNDKDKMDVNFMLTLNNKLKA-KGKKGL
VATE_CLOB6       -EYLNFVKSSILSLDIE-------GDEEIIVSPNDKDKIDISLMLTLNNQLKA-KGKKAL
VATE_CLOBJ       -EYLNFIKNSILSLDIE-------GDEEIIVSPNDKNKIDISFILTLNNKLKA-KGKKDL
VATE_CLOBM       -EYLNFIKNSILSLDIE-------GDEEIIVSSNDKDKIDISFMLTLNNKLKD-KGKKEL
VATE_CLOBK       -EYLNFIKNSILSLDIE-------GDEEIIVSPNDKNKIDISFILTLNNKLKA-KGKKDL
VATE_CLOBL       -EYLNFIKNSILSLDIE-------GDEEIIVSPNDKNKIDISFILTLNNKLKA-KGKKDL
VATE_THEPX       -KYRDLVYRMILAAAVD-------GNEEIIVSEADKEKITPELLERVNEALKK-QGKAGN
VATE_THEP3       -KYRDLVYRMILAAAVD-------GNEEIIVSEADKEKITPELLERVNEALKK-QGKAGN
VATE_ACET2       -EYEEIISQMIVNSVES-------GSEEIILSPKDKQRISPGFIENINKKLSQ-KGIDGK
VATE_STAMF       -DIEESLKKLLDEALYYIE-----NPSKIIINPRDRDFI--------KKVLKE-KGLKNI
VATE_METKA       KEYLEFLKRSAIEAVNAISS----DEVVLRANENDLMLL-DEMLSEIRDETGK-----DV
VATE_THESM       -EYMEILKDLIVTGIRELGE----EKVVLSSNGETLSLL-KAHLKEMEESVNE-KLGKDI
VATE_THEKO       -EYFQTLVTLTTEALEELNI----DSAVVRSNEETLKLI-VEKLPEFKKSVSE-KLGKEV
VATE_THEGJ       -EYFEALVSLTKEAIEELGT----KKIVLRSNERTLKLI-DSRMEEFSEKV-------GV
VATE_DESSY       -EYFPMLVELTVKAVEELGT----DKVVVRSNERTLKLI-VERLSEFREKLRE-ALGKDV
VATE_THEON       -EYFPMLVDLTGKAVEELGS----GSVVVKSNERTLKLL-EGRLDEFKKALTE-KLGRDV
VATE_PYRFU       -EYLETVLALLKEALKELDV----KEIRVHSNEKTLALI-SSRIEEIRRELGD----VSI
VATE_PYRAB       -EYFESIKALLKEAVEELKE----GKVRVYSNERTLALI-SSRIEEIRDYLGS----ISI
VATE_PYRHO       -EYFESVKALLKEAIKELNE----KKVRVMSNEKTLGLI-ASRIEEIKSELGD----VSI
VATE_META3       DSYKDILLKLIIEGVMSLDG----NELVVVLNEQDMELIEDSALWAIEKELES-KVKKVI
VATE_METJA       PEYKDKLIKLIKDGAISLGG----GELIVRLNKRDMELIDDSTLWNLEKEVEN-ATKKVT
VATE_METVS       DEYKDILLKMIITGVYSVGG----GELDLQLNKNDWKLIDDSTLWALEKEMED-RLKKVT
VATE_METM5       EEYKDILLKMIISGVYSVGG----GELELLLNKKDFEIIDDSTLWALEKEMED-RLKKVT
VATE_METMP       EDYKDILLKLIISGVYSVGG----GELELLLNKKDFELIDDSTLWALEKEMED-RLKKVT
VATE_METM6       DEYKDTLLKLIISGVYSVGG----GELELLLNKKDFEVIDDSTLWALEKEMED-RLKKVT
VATE_METM7       EEYKDILLKLIISGVYSVGG----GELELLLNKKDFEVIDDSTLWALEKEMED-RLKKVT
VATE_METST       ANYVESLKVMIKDASIQVGS----TQLEILVREDDVENV-KSMIDEVSEYVTK-ETGNET
VATE_METTH       EEYVSALRGMIKEAAVEIGG----GDLVVSMREDDRSL--DLGLDKIAAEVEA-ETGKKT
VATE_METS3       AEYSESLIKMIEEATEELGG----GDLIVQVKESDVAKV-EGHLKKLSADLAT-KTGVST
                                                                             

VATE_DICT6       SLTLSKDRME---------------------GNGGFVIQ--KDNLVIDLTVDTIIEELVN
VATE_DICTD       GLVLGKD--RVE-------------------GKGGFVIQ--KDNLVIDLTIDTIVEELVN
VATE_PICTO       NAKADHK------------------------INGGIIAYSKDKKRMLDFRLNSIFENIKD
VATE_THEVO       TYSNIDP-------------------------YGGILASSRDGKVELDLRVSSIMEEVLE
VATE_THEAC       IKFEDID------------------------PYGGVLATSRDGKIELDLRISSIRRDILE
VATE_HALOH       EVANNPLN-----------------------ISGGVIVEDRDGKEIVENTFETCLEEVKE
VATE2_CLOTE      EVSNESKD-----------------------IIGGYIIQDKNNKFRVDCSLEISIEECKE
VATE_TREDE       ELKADSK------------------------IAGGFRIGTKDGSAYYDFSAEAVADLFSS
VATE_BORBP       EIKPFKG------------------------ISKGFKIQKKNTGLQYDFSVETIADILFD
VATE_BORBU       ELRPFRG------------------------ISKGFKIQKKNIGLHYDFSAETIADILFD
VATE_BORAP       EIKPFKG------------------------ISKGFKIQKKNIGLQYDFSAETVADILFD
VATE_BORRA       EIKPFKG------------------------INKGFKVQQRDGSLYYDFTSEAIADILFE
VATE_BORDL       EIKPFKG------------------------INKGFKVQQRDGSLYYDFTSEAIADILFE
VATE_BORT9       EIKPFKG------------------------ISKGFTIQQRDGNLYYDFTSETVADILFE
VATE_BORHD       ELKPFKG------------------------ISKGFKIQQRDGNLYYDFTSDTIADILFE
VATE_HYPBU       EVEVGEA---VE-------------------GAGGFTVRAVEAGLTLDYRLEVILAPALE
VATE_CHLPN       VVGS---------------------------FVGGVQLKVEEKNWVLDLSSSALLEIFTR
VATE_CHLCV       AVGN---------------------------FVGGVQLKVEDKNWVLDLSSDTLLDLLMR
VATE_CHLAB       AIGK---------------------------FVGGVQLRVEDKNWVLDLSSDTLLDLLMR
VATE_CHLFF       AVGS---------------------------FVGGVQLKVEDKNWVLDLSSDTLLDLLMR
VATE_CHLMU       VIGK---------------------------FSGGAQLKVEERNWVLDISSEALLDLLTR
VATE_CHLTA       SVGN---------------------------FSGGAQLKVEERNWVLDMSSEVLLDLLTR
VATE_CHLTR       SVGN---------------------------FSGGAQLKVEERNWVLDMSSEVLLDLLTR
VATE_CHLT2       SVGK---------------------------FSGGAQLKVEERNWVLDMSSEVLLDLLTR
VATE_CHLTB       SVGK---------------------------FSGGAQLKVEERNWVLDMSSEVLLDLLTR
VATE_METS5       EVRSDPK------------------------IMGGVKIQYSDVGLVRDYSLNLILDQVFE
VATE_SACS2       TVKTDEK------------------------MLGGIKIYFERSGLTRDFSLKLILDQVFD
VATE_SULIN       TIKTDDK------------------------MLGGIRIYYEGSGLTRDFSLKLILDQVFD
VATE_SULIA       TIKTDDK------------------------MLGGIRIYYEGSGLTRDFSLKLILDQVFD
VATE_SULIK       TIKTDDK------------------------MLGGIRIYYEGSGLTRDFSLKLILDQVFD
VATE_SULIL       TIKTDDK------------------------MLGGIRIYYEGSGLTRDFSLKLILDQVFD
VATE_SULIM       TIKTDDK------------------------MLGGIRIYYEGSGLTRDFSLKLILDQVFD
VATE_SULIY       TIKTDDK------------------------MLGGIRIYYEGSGLTRDFSLKLILDQVFD
VATE_SULAC       SVEVDNS------------------------IKGGVKIYYPDKKLTRDFTLKTILNQIFE
VATE_SULTO       KIVVDEK------------------------IVGGIKIYYPDKSLSKDFTLETILNQVFD
VATE_SPIOL       EIIVDSIHLPAGPSHHKEHGLH---------CSGGVVLASRDGKIVFENTLDARLEVAFR
VATE_GOSHI       EIIVD-DVHLPPGPSHHHGFFHHHAEAHGPFCSGGVVIASRDGKIVFENTLDARLDVAFN
VATE_CITLI       EIIVDHHIYLPPGPGHHN--------AHGPSCSGGVVVASRDGKIVCENTLDARLDVVFR
VATE_CITUN       EIIVDHHIYLPPGPGHHN--------AHGPSCSGGVVVASRDGKIVCENTLDARLDVVFR
VATE_HETSC       VKIDNEHFLSPE-------------------SAGGVELLAKDGKIRVSSTLEARLDLIAD
VATE_MANSE       VLKIDNENFLPPD------------------TCGGIELIAAKGRIKISNTLESRLELIAQ
VATE1_BOVIN      DVQIDQEAYLPEE------------------IAGGVEIYNGDRKIKVSNTLESRLDLIAQ
VATE1_RAT        DVQIDLEAYLPED------------------IAGGVEIYNGDRKIKVSNTLESRLDLIAQ
VATE1_MOUSE      DVQIDQEAYLPEE------------------IAGGVEIYNGDRKIKVSNTLESRLDLIAQ
VATE1_HUMAN      DVQIDQESYLPED------------------IAGGVEIYNGDRKIKVSNTLESRLDLIAQ
VATE1_MACFA      DVQIDQESYLPED------------------IAGGVEIYNGDRKIKVSNTLESRLDLIAQ
VATE2_MOUSE      EVQVDQTEHLPSN------------------AAGGVEVYSSDQKIKVSNTLESRLNLAAM
VATE2_BOVIN      EVQVDKEVQLATD------------------TTGGVEVYSSDQRIMVSNTLESRLDLLSQ
VATE_SCHPO       ELDAETDDFLNDS------------------VLGGVVLVGLGGKIRVDNTLRARLEIVKE
VATE_CANAX       EISIDDKNFLAKD------------------IAGGIVVVNGSGKIEVDNTLEERLKILSE
VATE_YEAST       EEIVISNDYLNKD-----------------LVSGGVVVSNASDKIEINNTLEERLKLLSE
VATE_THEPD       RLEIGDP---LG-------------------CTEGVVIVSRDGREIYNATLEAKIAEVRE
VATE_PYRCJ       IAERD--------------------------MKGGVVVASKDGSIVVDYSIESIIANKVE
VATE_PYRIL       VIEKD--------------------------IKGGVIVMTRDGSITVDYSLETLLSNKLE
VATE_PYRNV       VAEKD--------------------------IRGGVVVTTRDGSITVDYSLESLIANKIE
NTPE_ENTHA       FTEKAQA---------------------------GLIID--DAGIQYNFLFSHLIKEIQE
VATE3_METHJ      SLILSEEPII---------------------TSGGVICERISDRVVIDNTVEVRFVRLER
VATE_METLZ       TFGGITD------------------------IAGGVVVQSTDGQLTLDFSYQTFMGEVWE
VATE1_METHJ      TFGSVID------------------------TDGGIIVESDDGQLQVDYSYRTFLNQVWE
VATE_METB6       ILGEPAH------------------------IDGGILIEGEGGELQIDYSYRTFMNKVWE
VATE_METPE       VAGSPVD------------------------IDGGIIAESRDGLLQVDYSYRTFLDRVWE
VATE_METMJ       TMGAPVD------------------------IPGGIIVESNDGELQIDYSYRTFLDEIWE
VATE_METTP       -YGGTLD------------------------IIGGVVVESKDGSVRFDHSYETLARDIFN
VATE_ARCFU       TYGGNID------------------------CIGGVILEDPAGDIRLNLTFDELVSQVYE
VATE_HALWD       EYAGEYD------------------------CLGGVVAEGQQSRVRVNNTFDSILDAVWE
VATE_HALLT       VVDGEID------------------------CLGGVVAESDTSRVRVNNTFDSILESVWD
VATE_NATPD       EVGEPVD------------------------CLGGVVVESDASRVRVNNTFDSILEDVWE
VATE_HALS3       EYAGEYD------------------------CLGGVVVESDASRIRVNNTFDSILADAWE
VATE_HALSA       EYAGEYD------------------------CLGGVVVESDASRIRVNNTFDSILADAWE
VATE_HALMA       TYAGERD------------------------CLGGVVVESNESRVRVNNTFDSILEDVWE
VATE_HALVD       EFAGERD------------------------CLGGVVVEGSNSRVRVNNTFDSVLDTVWE
VATE_METAR       EYGGNVK------------------------CIGGIVVTSVDGSVNLDYTFDSILEDVWT
VATE_METBU       EYAGNID------------------------CIGGLTIENSDGTVRLDYTYDMILKNVNE
VATE_METAC       TYAGNID------------------------CIGGVVLENEDGTVRLDYTYDSILKNVYE
VATE_METBF       SYAGNLD------------------------AIGGIVLENEDGTVRLDFTYDSILKNVYE
VATE_METMA       SYAGNID------------------------SIGGIVLENEDRTVRLDFTYDSILKSVYE
VATE_THET2       ELKAEPA------------------------LRLGVRAVGAEGKTQVENSLLARLDRAWD
VATE_THET8       ELQAEPA------------------------LRLGVRAVGAEGKTQVENSLLARLDRAWD
VATE_DEIGD       SVRENPA------------------------IQGGVRVVARGGKSGITNTLAGRLDRLRG
VATE_DEIDV       AVRENPA------------------------IQGGVRVVARGGKSGITNTLAGRLERVRG
VATE_DEIRA       EVRENPS------------------------IKGGVRVVARGGKSGVTNTLSGRLERVKA
VATE_ANADF       AVRAAPE------------------------ARGGVALV--AGRRVLDDTLPSRLDRAWT
VATE_IGNH4       VEVKDVKEVGRE-------------------IKGGVLGKSKSGGVWYNYTLEKAFDELLR
VATE_NITOC       VLSSEPLT-----------------------CSGGVRVVSKDGRIRVDNTFEGRLERLAE
VATE2_METHJ      DIMQDIT------------------------TIGGLSGTSADGRIRAYNTLESRMERIRD
VATE_CENSY       ELAQEPIE-----------------------CLGGVKVSSKDGSMTLDNTIDARFDRMKP
VATE_AERPE       SVEAVEG------------------------IYGGVVVELAEGA-RLDYTVNNIIAAEEP
VATE_GEOUR       EIVSHPA------------------------IVGGLEVSEEGGSISVVNTLEKRMERAWP
VATE_FUSNN       GYKVSDDI-----------------------VESGCNIK--DGNVIYNNEFSSLLEFNKE
VATE_FINM2       VKLSDET------------------------VDSGFCIK--RGNVLINNNFSSLVDSMKD
VATE_CLOD6       KVSDETRD-----------------------ITGGFIVK--KGDIEYNYSFEAIIAVEHE
VATE_CLOPS       ITL-NME---GK-------------------FNGGFILD--RNGIQINNTFEALINSLRG
VATE_CLOP1       ITL-NME---GK-------------------FNGGFILD--RNGIQINNTFEALINSLRG
VATE_CLOPE       ITL-NME---GK-------------------FNGGFILD--RNGIQINNTFEALINSLRG
VATE_CLOBA       SDKTGN-------------------------FKGGFILE--KNGIEINNTFEALVSSLKD
VATE_CLOBB       SDKTGN-------------------------FKGGFILE--KNGIEINNTFEALVSSLKD
VATE_CLONN       IKLSQKR---IK-------------------IKGGYILA--KNGIEINNTFESRVKSLRD
VATE1_CLOTE      IKISDKK---RD-------------------FRGGFILN--KDGIEINNTFEALILSLKD
VATE_CLOB1       LKISNEN---RN-------------------IKGGFILY--KNGIEINNSFEALVDSLRD
VATE_CLOBH       LKISNEN---RN-------------------IKGGFILY--KNGIEINNSFEALVDSLRD
VATE_CLOB6       LKISNEN---RN-------------------IKGGFILY--KNGIEINNSFEALVDSLRD
VATE_CLOBJ       LKISNEN---RN-------------------IKGGFILY--KNGIEINNSFEALVDSLRD
VATE_CLOBM       LKISNEN---RD-------------------IKGGFILY--KNGIEINNSFEALVDSLRD
VATE_CLOBK       LKISNEN---RN-------------------IKGGFILY--KNGIEINNSFEALVDSLRD
VATE_CLOBL       LKISNEN---RN-------------------IKGGFILY--KNGIEINNSFEALVDSLRD
VATE_THEPX       IRFSGEK---RA-------------------IKGGFILK--SATVEINCTFDYLLKVQRE
VATE_THEP3       IRFSGEK---RA-------------------IKGGFILK--SATVEINCTFDYLLKVQRE
VATE_ACET2       IKLSEET---KN-------------------ISGGFILK--SGDIEINNSFEAIIRMKRE
VATE_STAMF       EIVESDN------------------------ILGGLIIESIDGE-RVDNSYNTRLERAKS
VATE_METKA       ELGEPVE------------------------AVGGVIAESKDGSEAYDNTVDARLRRRRS
VATE_THESM       TISLGEP---IE-------------------TIGGVIVQNLEKTIRIDNTFEARMERLQA
VATE_THEKO       EITVGEP---IS-------------------TIGGVLVESSDGSVRVDNTFEARIERLEA
VATE_THEGJ       EVSLGEP---IE-------------------CIGGVLVESPDGTVRVDNTFDARIERLES
VATE_DESSY       EVTVGEP---IQ-------------------TIGGILVESSDGTVRVDNTFDSRIERFES
VATE_THEON       EVTLGEP---IT-------------------TIGGILVETPDRTVRVDNTFESRIERFEG
VATE_PYRFU       EIGSPIQ------------------------TIGGVIVETKDGNMRVDNTFEARMARLES
VATE_PYRAB       EIGSAIS------------------------TMGGVIVETEDGRIRIDNTFEARMERFEG
VATE_PYRHO       ELGETVD------------------------TMGGVIVETEDGRIRIDNTFEARMERFEG
VATE_META3       ILKKGAP---AN-------------------IIGGCIIKTADGTKFCDNSLESVFERNME
VATE_METJA       VLKKGEP---VD-------------------IAGGCIIETADGLKSLDNSLEAIFNRNLN
VATE_METVS       VLKKGES---LP-------------------IIGGCVVKTADKTKVSDNSLEATFERNLD
VATE_METM5       VLKKGEA---KS-------------------IIGGCIIKTADQTKVSDNSLEATFERNLD
VATE_METMP       VLKKGEA---KS-------------------IIGGCIIKTADQTKVSDNSLEATFERNLD
VATE_METM6       VLKKGEA---KS-------------------IIGGCIIKTADHTKVSDNSLEATFERNLD
VATE_METM7       VLKKGEA---KS-------------------IIGGCIIKTADKTKVSDNSLEATFERNLD
VATE_METST       SFVIGEP---ID-------------------IIGGAVVKTVDGDVEVKNTIEARMLRYRK
VATE_METTH       TLKVGDS---IR-------------------TIGGAVVRTEDGLIEVNNTIEARMSRFRK
VATE_METS3       TLVLGEP---ID-------------------AIGGAILKTRNGDIEVNNTIESRLDRFKG
                                                   *                         

VATE_DICT6       KNILEIAQILHGER-------
VATE_DICTD       KNILEIAQILRGEK-------
VATE_PICTO       DLASYFYENIEE---------
VATE_THEVO       KIKVKIYTRLEE---------
VATE_THEAC       RFKVRLYSMIED---------
VATE_HALOH       DIAVELHSKVL----------
VATE2_CLOTE      KIGISITELFM----------
VATE_TREDE       YLSPKTAEILKNAAKEL----
VATE_BORBP       YLNPRFKEVIKVV--------
VATE_BORBU       YLNPRFKEVIKVV--------
VATE_BORAP       YLNPRFKEIIKVV--------
VATE_BORRA       YLNPRFKEIIKLD--------
VATE_BORDL       YLNPRFKEIIKLD--------
VATE_BORT9       YLNPRFKEVIKLI--------
VATE_BORHD       YLNPRFKEVIKLG--------
VATE_HYPBU       EARARVLEVLNQ---------
VATE_CHLPN       YLQKDFREMIFQGS-------
VATE_CHLCV       YLQKDFREMIFQGS-------
VATE_CHLAB       YLQKDFREMIFQGS-------
VATE_CHLFF       YLQKDFREMIFQGS-------
VATE_CHLMU       FLQKDFREMIFQSC-------
VATE_CHLTA       FLQKDFREMIFQSC-------
VATE_CHLTR       FLQKDFREMIFQSC-------
VATE_CHLT2       FLQKDFREMIFQSC-------
VATE_CHLTB       FLQKDFREMIFQSC-------
VATE_METS5       SLKPKIAEILFGEM-------
VATE_SACS2       SMRGKISDMLFGGK-------
VATE_SULIN       SMRGKISDMLFGGK-------
VATE_SULIA       SMRGKISDMLFGGK-------
VATE_SULIK       SMRGKISDMLFGGK-------
VATE_SULIL       SMRGKISDMLFGGK-------
VATE_SULIM       SMRGKISDMLFGGK-------
VATE_SULIY       SMRGKISDMLFGGK-------
VATE_SULAC       DLRDDVARILFGE--------
VATE_SULTO       DIRDKIAQILFGE--------
VATE_SPIOL       KKLPQIRKQLFAVAAA-----
VATE_GOSHI       KKLPEIRKWLFGQVAA-----
VATE_CITLI       KKLPEIRKQLVSQVAA-----
VATE_CITUN       KKLPEIRKQLVSQVAA-----
VATE_HETSC       KITPQVRTALFGPNQNRRFFD
VATE_MANSE       QLLPEIRNALFGRNPNRKFTD
VATE1_BOVIN      QMMPEVRGALFGANANRKFLD
VATE1_RAT        QMMPEVRGALFGANANRKFLD
VATE1_MOUSE      QMMPEVRGALFGANANRKFLD
VATE1_HUMAN      QMMPEVRGALFGANANRKFLD
VATE1_MACFA      QMMPEVRGALFGANANRKFLD
VATE2_MOUSE      QKMPEIRGILFGDNTSRKFFT
VATE2_BOVIN      QKMPEIRKALFGANANRKFFV
VATE_SCHPO       EALPEIRRLLFGENPNRKFDN
VATE_CANAX       EALPAIRLELFGPSTTRKFFD
VATE_YEAST       EALPAIRLELYGPSKTRKFFD
VATE_THEPD       SVKPKVLELVSRARA------
VATE_PYRCJ       EIKHLLYEMTYER--------
VATE_PYRIL       ELKHLIYLETHER--------
VATE_PYRNV       ELKHLLYQMTYER--------
NTPE_ENTHA       TMSAEIAKELFD---------
VATE3_METHJ      EMIVAASRILFHGER------
VATE_METLZ       TSLKDASEILFG---------
VATE1_METHJ      SGLKDASDSLFA---------
VATE_METB6       SGLKDASDILFG---------
VATE_METPE       SGLKNASDILFG---------
VATE_METMJ       SGLKDASDILFT---------
VATE_METTP       AKVKEVSKLLFG---------
VATE_ARCFU       QKLSEVSKLLFK---------
VATE_HALWD       ETLGDVSEQLFDQ--------
VATE_HALLT       DELKNISERLFDQ--------
VATE_NATPD       ENLREISARLFEE--------
VATE_HALS3       NNLKAISARLFDEEQ------
VATE_HALSA       NNLKAISARLFDEEQ------
VATE_HALMA       DNLKAISDRLFEDQ-------
VATE_HALVD       DNLKEVSARLFDDQ-------
VATE_METAR       SSMKPVSDILFGSR-------
VATE_METBU       QSLKQTSDILFG---------
VATE_METAC       RSLKQISDILYG---------
VATE_METBF       RSLKQISDLLYG---------
VATE_METMA       RSLKQISDILYG---------
VATE_THET2       ALSSKVAQALWG---------
VATE_THET8       ALSSKVAQALWG---------
VATE_DEIGD       ELAPQVSRLLAE---------
VATE_DEIDV       ELAPQVSRLLAE---------
VATE_DEIRA       DMAPQISRLLAE---------
VATE_ANADF       VLEAEVARLLFGEG-------
VATE_IGNH4       EVYPKVLEALGF---------
VATE_NITOC       ELHQSIMERLFVPPSGLHG--
VATE2_METHJ      TSTLEIINLILGGPDG-----
VATE_CENSY       LIRKEIVSKFGIGI-------
VATE_AERPE       RLRRAVKRALFEA--------
VATE_GEOUR       ELLPEILRDIYREL-------
VATE_FUSNN       DLEREILKKIFG---------
VATE_FINM2       ELEVEIAKTLFKK--------
VATE_CLOD6       YIEQIAAEILFN---------
VATE_CLOPS       ELEFEVNKVLFD---------
VATE_CLOP1       ELEFEVNKVLFD---------
VATE_CLOPE       ELEFEVNKVLFD---------
VATE_CLOBA       EMGLEVARVLFS---------
VATE_CLOBB       EMGLEVARVLFS---------
VATE_CLONN       DMEAEVAKVLFS---------
VATE1_CLOTE      DLEPVIIDTLFS---------
VATE_CLOB1       ELEQEIIEALFS---------
VATE_CLOBH       ELEQEIIEALFS---------
VATE_CLOB6       ELEQEIIEALFS---------
VATE_CLOBJ       ELEQEIIEALFS---------
VATE_CLOBM       ELEQEIIEALFS---------
VATE_CLOBK       ELEQEIIEALFS---------
VATE_CLOBL       ELEQEIIEALFS---------
VATE_THEPX       ELETEVARILFEE--------
VATE_THEP3       ELETEVARILFEE--------
VATE_ACET2       EVEAEVIKALF----------
VATE_STAMF       IVLAELNIILWGK--------
VATE_METKA       EIVRRVSETLFGG--------
VATE_THESM       DLRTKIAKILFG---------
VATE_THEKO       DLRARIAKALFG---------
VATE_THEGJ       ELRATVAKALFG---------
VATE_DESSY       DLRATIAKALFG---------
VATE_THEON       ELRAAIAKALFG---------
VATE_PYRFU       ELRSKIAEILFG---------
VATE_PYRAB       EIRAKIAKVLFGG--------
VATE_PYRHO       EIRSTIAKVLFG---------
VATE_META3       SIRANVASLLF----------
VATE_METJA       VIRARITEKLF----------
VATE_METVS       IIRAKIAEMLF----------
VATE_METM5       SVRAKIAEMLF----------
VATE_METMP       SVRAKIAEMLF----------
VATE_METM6       SVRAKIAEMLF----------
VATE_METM7       SVRAKIAEMLF----------
VATE_METST       HLRSEVAKKLFR---------
VATE_METTH       ALRSEVARVLFE---------
VATE_METS3       LLRSEVANVLFKN--------