CLUSTAL format seed alignment for MF_00313

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLSA1_ECO57      --------------------------MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLA
GLSA1_SHIFL      --------------------------MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLA
GLSA1_ECOL6      --------------------------MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLA
GLSA1_ECOLI      --------------------------MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLA
GLSA_BRUSU       -------------------------MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLA
GLSA_BACTN       -----------------------MDKKVTLAQLKEVVQEAYDQVKTNTGGKNADYIPYLA
GLSA2_YERPE      ---MEITDMPTDDSNNGIIDYVSTGHLPDPETVVKLVQEAHKRFSTDTAGVVSNVYPALE
GLSA_AGRFC       ----------------------------MQDIQGIVDSIYDSMLPRLGEGKVADYIPELA
GLSA_RHIEC       ----------------------------MADLQATLDSIYTDILPRIGEGKVADYIPELA
GLSA_RHIME       ----------------------MREPKPQEDLQAIIDDIYRELTPRLGEGKVADYIPQLA
GLSA_RHILO       ----------------------MPELERAPKLDQALAEVAAEMAERTDRGDVATYIPQLG
GLSA2_ECOLI      --------------------------MAVAMDNAILENILRQVRPLIGQGKVADYIPALA
GLSA2_ECO57      --------------------------MAVAMDNAILENILRQVRPLIGQGKVADYIPALA
GLSA2_ECOL6      --------------------------MAVAMDNAILENILRQVRPLIGQGKVADYIPALA
GLSA2_SHIFL      --------------------------MAVAMDNAILENILRQVRPLIGQGKVADYIPALA
GLSA_SALTY       --------------------------MARAMDNAILETILQRVRPLIGQGKVADYIPALA
GLSA_PHOLL       --------------------------MSTTFSNTLLSDILRQVRPLIGQGKVANYIPALA
GLSA1_YERPE      --------------------------MVTTLDNALLNDILQQVRPLIGQGKVADYIPALA
GLSA_VIBVU       ----------------------------MKPTKELLNEILHEVRPLIGRGKVANYIPALA
GLSA_VIBVY       ----------------------------MKPTKELLNEILHEVRPLIGRGKVANYIPALA
GLSA_VIBPA       ----------------------------MKPTAEILTDILAEVRPLIGQGKVADYIPALA
GLSA_VIBCH       ----------------------------MKPTADILASIIEEVRPLTSKGIVADYIPALA
GLSA_SHEON       -----------------------------MPETALLEEVVDRVRPLLGQGKVANYIPALA
GLSA_PSEAE       -------------------------------MQQLLNEILDEVRPLIGRGKVADYIPALA
GLSA_PSESM       -------------------------------MHDLLNEILDEVRPLLGQGKVADYIPALG
GLSA_CAUVC       --------------------------MKALSIPDVLAEVAVLVRPHFGKGKPADYIPQLA
GLSA_STRAW       -------------------MVIMSASWSSHAFQPVLERIADEIERTPGRGRPADYIPALA
GLSA_STRCO       -------------------------MSTPTTFRPVLERIAEEIERTPGSGRPADYIPALA
GLSA_CHRVO       -----------------------------MNLQALIEDIRQQVLPFYDQGRVADYIPALA
GLSA_RALSO       -----------------------------MDYQAILETIHRDIQPWLGKGRVADYIPELA
GLSA2_CLOPE      -------------------------------MKNFLESLIENNRQYVEHGKLASYIPELE
GLSA_CLOTE       ------------------------------MMQSKIESIIEECRKYTREGEVASYIPELK
GLSA_FUSNN       -------------------------------MKELLKELVEKNRKFTADGNVANYIPELD
GLSA1_CLOPE      -------------------------------MDINLDALVEANRRYTKEGHVATYIPALA
GLSA1_BACAN      ---------------------------MQCIETNNLQQLLEQVKPYTKKGKLATYIPELG
GLSA1_BACCR      ---------------------------MQCIETNNLQQLLEQVKPYTKKGKLATYIPELG
GLSA1_BACHD      ----------------------------MWKQDETLEQIVLECKKYTEEGTVASYIPALA
GLSA2_BACSU      ---------------------------MVCQHNDELEALVKKAKKVTDKGEVASYIPALA
GLSA2_BACAN      ---------------MIKDSSVQVE--GQEKVC--LDQWVAHYRTYAAKGRSASYIPALG
GLSA2_BACCR      ---------------MIKDSSVQVE--GQEKVC--LDQWVAHYRAYAAKGRSASYIPALG
GLSA1_BACSU      ------------MKELIKEHQKDI----NPALQ--LHDWVEYYRPFAANGQSANYIPALG
GLSA2_BACHD      ---------------MLQQKQSLLE--HKPVLSKELEKLVNHYRTLSLNGQCAQYIPALR
GLSA_OCEIH       ---------------MVQGSVNLNTERGKEWLQDYVDNWVNFYQKQTDEGKVASYIPRLE
GLSA_NOSS1       ---------------MSDQANQGDLEIRPSPLLKVINDLHSKYKSLK-EGIVANYIPELA
GLSA_SYNY3       MGIGVNSDPKVVHHQSIPKPNAMAIANYRAITTKQWQTWVEAARLQALNGKLPQYIPQLS
                                                                  *  .   * * 

GLSA1_ECO57      NVPGQLAAVAIVTSD-GNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADP
GLSA1_SHIFL      NVPGQLAAVAIVTCD-GNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADP
GLSA1_ECOL6      NVPGQLAAVAIVTSD-GNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKVGADP
GLSA1_ECOLI      NVPGQLAAVAIVTCD-GNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADP
GLSA_BRUSU       SVPSDLFGLAVVTAD-GQTFKTGDADFAFAIESISKVFTLALVMEEIGPDSVREKVGADP
GLSA_BACTN       NVNKDLFGISVCLLN-GQTIHVGDTDYRFGIESVSKVHTAILALRQYGAKEILDKIGADA
GLSA2_YERPE      RIPADLFGICMVGTN-GKIHSAGDVDYEFTIMSVSKPFVFALVCQAIGAKTAREKLGVNS
GLSA_AGRFC       KVDPNQFGIAITTVD-GTTYTAGNALVPFSIQSISKVFMLTLALGKAGE-TVWNRVGREP
GLSA_RHIEC       KIDPRQFGMAIVTVD-GQVFRVGDADIAFSIQSISKVFMLTLALGKVGE-GLWKRVGREP
GLSA_RHIME       RVDARHFGMAIVTTG-GEVYRVGDAEMPFSIQSISKVFTLTLALGKHGE-NIWNRVGREP
GLSA_RHILO       KVDPRKFGIAAVTND-GRVLVAGDADQAFSIQSISKVFTLTLALGNVGD-ALWQRVGREP
GLSA2_ECOLI      TVDGSRLGIAICTVD-GQLFQAGDAQERFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDP
GLSA2_ECO57      TVDGSRLGIAICTVD-GQLFQAGDAQERFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDP
GLSA2_ECOL6      TVDGSRLGIAICTVD-GQLFQAGDAQERFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDP
GLSA2_SHIFL      TVDGSRLGIAICTVD-GQLFQAGDAQERFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDP
GLSA_SALTY       SVEGSKLGIAICTVD-GQHYQAGDAHERFSIQSISKVLSLVVAMRHYPEEEIWQRVGKDP
GLSA_PHOLL       EVPADNLAIAICTID-GQIFHAGDAEKRFSIQSISKILSLTLAMTRYQEQEIWQRVGQEP
GLSA1_YERPE      EVPANKLGIAVCTLD-GQIFQAGDADERFSIQSISKVLSLTLALSRYSEQDIWQRVGKEP
GLSA_VIBVU       RVPAHKLAIAVYTNQ-GEVIKAGDADEAFSIQSISKALSLTLAMGLYQPDEIWRRVGKEP
GLSA_VIBVY       RVPAHKLAIAVYTNQ-GEVIKAGDADEAFSIQSISKALSLTLAMGLYQPDEIWRRVGKEP
GLSA_VIBPA       KVPNNKLAIAVYTNE-GEVIKAGDADESFSIQSISKALSLTLAMCLYKQEEIWARVGKEP
GLSA_VIBCH       KVPSDKLGIAVFTNQ-GEVITAGDAQEGFSIQSISKVLSLTLAMGLYQPDELWSRVGKEP
GLSA_SHEON       NIDPGKLGIAVTTID-GETIGAGDYLEPFSIQSISKVFSLTLALTLYEETEIWSRVGKEP
GLSA_PSEAE       GVEPNQLGIAVYSRD-GELFHAGDALRPFSIQSISKVFSLVQAIQHSGE-DIWQRLGHEP
GLSA_PSESM       GVRPDQLGIAVYGND-GQVFSAGDAETLFSIQSISKVFSLVQAIGHSGE-DIWQRLGHEP
GLSA_CAUVC       TVPGGKFGMAVRMVD-GDEHVIGDADEGFSVQSITKVFALGLALNRLGD-EIWTRVGKEP
GLSA_STRAW       ACDPRRFGMAVAELD-GTVYGVGDWRQPFSTQSITKVFTLALDLAREGD-ALWEHVGREP
GLSA_STRCO       ARDPRRFGMAVAELD-GTVYGVGDWREPFSAQSLTKVFTLALDLAREGD-ALWEHVGREP
GLSA_CHRVO       SVPPHQFGIAIHTLD-GREHACGDADTPFSIQSISKAFMLALTLQADGE-QLWRHVGKEP
GLSA_RALSO       KASATDFGMAIVTPR-GEVFRVGQAETLFSIQSISKLFACTLAFQLEGE-SLWQRVGREP
GLSA2_CLOPE      KANKEDLGIYIVTLD-GKEVGAGEYDKKFTIQSISKVITLMLAILDNGKDRVFSRVGVEP
GLSA_CLOTE       KADKDALGIYIDKLD-GNEFCAGDYDTKFTIQSISKIIALIIAIMDNGMEKVLSKVGVEP
GLSA_FUSNN       KADKNALGIYVTTLD-GQEFFAGDYNTKFTIQSISKIISLMLAILDNGEEYVFSKVGMEP
GLSA1_CLOPE      KVNPDQLGVCIYDLKENKEFSAGEYDVRFAIESISKVPTLILAILDNGIEKVFSEVGTEP
GLSA1_BACAN      NANPDDLGIAIFHKE-TEYIHAGNSQTLFTLQSISKVITLALALLDRGEEYVFSKVGMEP
GLSA1_BACCR      NANPDDLGIAIFHKE-TEYIHAGNSQTLFTLQSISKVITLALALLDRGEEYVFSKVGMEP
GLSA1_BACHD      KADVSTLGIAIYRGG-DEQVIAGDADEKFTLQSISKVIALALALLDVGEEAVFSKVGMEP
GLSA2_BACSU      KADKHDLSVAIYYSN-NVCLSAGDVEKTFTLQSISKVLSLALVLMEYGKDKVFSYVGQEP
GLSA2_BACAN      EINVSQLGICIVKPD-GTMIKSGDWEIPFTLQSISKVIGFIAACLSRGISYVLERVDVEP
GLSA2_BACCR      EINVSQLGICIVKPD-GTMIKSGDWEIPFTLQSISKVIGFIAACLSRGISYVLERVDVEP
GLSA1_BACSU      KVNDSQLGICVLEPD-GTMIHAGDWNVSFTMQSISKVISFIAACMSRGIPYVLDRVDVEP
GLSA2_BACHD      EANQTYLGLYVVHSN-GIEIKSGDWQVPFTLQSISKIINFIAACLDRGITYVLDRVDVEP
GLSA_OCEIH       HADPNALGISIIGKN-GTVIRSGDTDLEFSIQSISKVLSFIVACMERGLSYVLQRVDVEP
GLSA_NOSS1       KVNPDLFSISIVTVD-GQVYQVGDYQQLFTIQSISKVFAYGLALEDHGRDYVLTRVGVEP
GLSA_SYNY3       LVDPGNFALDIGDQN-GIIYEAGDTDLTFSLMSVVKPFLWLYILHHRGWQWAEQKVGDRP
                        .:             *:    *   *: *                   :.  .

GLSA1_ECO57      TGLPFNSVIALELHGGK-PLSPLVNAGAIATTSLINA-ENAEQRWQRILHIQQQLAGEL-
GLSA1_SHIFL      TGLPFNSVIALELHGGK-PLSPLVNAGAIATTSLINA-ENAEQRWQRILHIQQQLAGEQ-
GLSA1_ECOL6      TGLPFNSVIALELHGGK-PLSPLVNAGAIATTSLINA-ENTEQRWQRILHIQQQLAGEQ-
GLSA1_ECOLI      TGLPFNSVIALELHGGK-PLSPLVNAGAIATTSLINA-ENVEQRWQRILHIQQQLAGEQ-
GLSA_BRUSU       TGLPFNSVIALELHNGK-SLSPLVNAGAIATASLVPG-DTADARWNNILECQCGFAGRR-
GLSA_BACTN       TGLPFNSIIAILLENDH-PSTPLVNAGAISACSMVQPIGDSAKKWDAIVENVTDLCGSA-
GLSA2_YERPE      TGMAFNSVTAIERASDG-RTNPMVNSGAIATTSLVPG-ATSDEQWKFIYDGLCRFAGRE-
GLSA_AGRFC       SGSSFNSIVQLEHEHGI-PRNPFVNAGAIVVTDIVLSGHQPREAIGELLRFVRYLADDDT
GLSA_RHIEC       SGSAFNSIVQLEHESGI-PRNPFINAGAIAVTDVVMAGHAPREAIGELLRFVRYLADDES
GLSA_RHIME       SGSAFNSIVQLEHEGGK-PRNPFINAGAIRISDLILAGHTPKELIGEIVRFVRYLADDEN
GLSA_RHILO       SGNPFNSIVQLEHENGI-PRNPFINAGAIVISDILLAGHQPREAIGEILRFIQFLADDDT
GLSA2_ECOLI      SGSPFNSLVQLEMEQGI-PRNPFINAGALVVCDMLQGRLSAP--RQRMLEVVRGLSGVSD
GLSA2_ECO57      SGSPFNSLVQLEMEQGI-PRNPFINAGALVVCDMLQGRLSAP--RQRMLEVVRGLSGVSD
GLSA2_ECOL6      SGSPFNSLVQLEMEQGI-PRNPFINAGALVVCDMLQGRLSAP--RQRMLEVVRGLSGVSD
GLSA2_SHIFL      SGSPFNSLVQLEMEQGI-PRNPFINTGALVVCDMLQGRLSAP--RQRMLEVVRGLSGVSD
GLSA_SALTY       SGSPFNSLVQLEMEQGI-PRNPFINAGALVVCDMLQGRLSAP--RQRMLEVVRALCGVSD
GLSA_PHOLL       SGQPFNSLVQLELEKGK-PRNPFVNAGALIVCDMLQSRLSAP--KQRMLEVVRKLAGCPD
GLSA1_YERPE      SGQPFNSLVQLELEKGK-PRNPFINLGALVVCDMLQSRLSAP--KQRLLEVVRQLVKDDS
GLSA_VIBVU       SGQAFNSLIQLEMEQGI-PRNPFINAGAIVVADLLASRLSAP--RQRLLEFVRQLSGETH
GLSA_VIBVY       SGQAFNSLIQLEMEQGI-PRNPFINAGAIVVADLLASRLSAP--RQRLLEFVRQLSGETH
GLSA_VIBPA       SGQAFNSLIQLEMEQGI-PRNPFINAGAIVVADLLQSRLSAP--RQRLLEFVRQLSGDTH
GLSA_VIBCH       SGQAFNSLIQLEMEQGI-PRNPFINAGAIVVCDMLQSRLSAP--RQRLLEFVRQLSGEPQ
GLSA_SHEON       SGHSFNSLVQVELERGK-PRNPFINAGALVIADLLQSRLGAP--KHRMLELVRALSQNDK
GLSA_PSEAE       SGQPFNSLVQLEFERGK-PRNPFINAGALVICDINQSRFAAP--AQSMRDFVRRLCGNPE
GLSA_PSESM       SGQPFNSLVQLEFEQGR-PRNPFINAGALVICDINQARFAAP--SLSMRDFVRRLCGNRS
GLSA_CAUVC       SGTPFNHLSLLEAEQGV-PRNPFINAGALAVTDVLMDVTRDP--AALVRDFGGFLCGE-R
GLSA_STRAW       SGNPFNSLVQLEYESGI-PRNPFINAGALVVTDRLQTQTGDA--AGSLLEFLRAESGNPR
GLSA_STRCO       SGNPFNSLVQLEYENGI-PRNPFINAGALVVTDRLHTRTGDA--AGELLAFLRAESGNPD
GLSA_CHRVO       SGNPFNSLVQLEYEHGI-PRNPFINAGALVVTDRAIGHFGDA--HARLLAWLREETGNAG
GLSA_RALSO       SGNAFNSLVQLEHENGI-PRNPFINAGALVVTDVLCRRFVQA--ETAMVQFMRRLVDNPR
GLSA2_CLOPE      TGDSFNSIVSLERKPSKKPFNPMVNSGAILTTSLIEGDSEEEK-FERILEFTRKVTGNDD
GLSA_CLOTE       SAYSFNSIVTLEVKNANKPLNPMINAGAIATVSLIKGNSPEEI-IERILEFTRKVTGNKN
GLSA_FUSNN       SGDPFNSIRKLETSSRKKPYNPMINAGAIAVASMIKGKDDREK-FSRLLNFAKLITEDDS
GLSA1_CLOPE      SGFAFNSIMNMQINHKNKPSNPFINAGAIKVVSLLKGKNDEER-FKRILDFYRKIMNDDE
GLSA1_BACAN      TGDPFNSIIKLETTSPSKPLNPMINAGALAITSMLAGKDNEEK-MERILHFVREITDNPT
GLSA1_BACCR      TGDPFNSIIKLETTSPSKPLNPMINAGALAITSMLEGKDNEEK-MERILHFVREITDNPT
GLSA1_BACHD      TGDPFNSISKLETSVPSKPLNPMINAGALAVTNMIIGETTEQS-LGRLLSFIHELTKNPT
GLSA2_BACSU      TGDPFNSIIKLETVNPSKPLNPMINAGALVVTSLIRGRTVKER-LDYLLSFIRRLTNNQE
GLSA2_BACAN      TGDAFNSIIRLEIHKPGKPFNPMINAGAITIASLLPGTSVQEK-LESIYVLIEKMIEKR-
GLSA2_BACCR      TGDAFNSIIRLEIHKPGKPFNPMINAGAITIASLLPGTSVQEK-LESLYVLIEKMIEKR-
GLSA1_BACSU      TGDAFNSIIRLEINKPGKPFNPMINAGALTIASILPGESAYEK-LEFLYSVMETLIGKR-
GLSA2_BACHD      TGDPFNSMVRLEMRKTGKPFNPMINAGAITVASLLSGKSPTEK-LESVYSLVEKMLGRR-
GLSA_OCEIH       TGESFNSIMHLEINQPKKPFNPLVNSGAITVSSLLNGRTSDQK-LEPLYQLLEKILGHR-
GLSA_NOSS1       TGEAFNAIILDE--QSKRPYNPMVNAGAIATTSLIKGAGATER-LNRVLEMFRRYIGHD-
GLSA_SYNY3       SHLPFNSVEQLEQDGGY-PRNTMVNSGAICLAGHIPGATIEQR-CENFLTWLNHTAQCQL
                 :  .** :            ..::* **:   .              .            

GLSA1_ECO57      VALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLINTVELATLGA
GLSA1_SHIFL      VALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLINTVELATLGA
GLSA1_ECOL6      VALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLINTIELATLGA
GLSA1_ECOLI      VALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGA
GLSA_BRUSU       LKLSNEVNQSEQTTNFHNRAIAWLLYSAGTCYSDPMEAVDIYTRQCSTLVTATDLATMGA
GLSA_BACTN       PQLIDELYKSESDTNFNNRSIAWLLKNYNRIYDDPDMALDLYTRQCSLGVTALQLSVAAG
GLSA2_YERPE      LTLNEEVYQSACETNFRNRGIANVLQGYGRLGCDPIIATDLYTRQCSLNVSARDLAVMGA
GLSA_AGRFC       ISIDDTVAKSEQATGFRNFALANFMRSFGNLHHPVEHTLGVYFHQCALSMTCAQLSRAGL
GLSA_RHIEC       ITIDDKVARSETQTGYRNVALANFMRAYRNLDHPVDHVLGVYFHQCALAMSCEQLARAGL
GLSA_RHIME       IVIDHEVARSETATGYRNIALANFMRSFGRLDHPVEHVLGVYFHHCALAMTCSQLAKAGL
GLSA_RHILO       IIIDREVAASERATGYRNFALANYMKSFGNLHHAPELALGVYFHHCAIAMSCRQLAMAGR
GLSA2_ECOLI      ISYDTVVARSEFEHSARNAAIAWLMKSFGNFHHDVTTVLQNYFHYCALKMSCVELARTFV
GLSA2_ECO57      ISYDTVVARSEFEHSARNAAIAWLMKSFGNFHHDVTTVLQNYFHYCALKMSCVELARTFV
GLSA2_ECOL6      ISYDTVVARSEFEHSARNAAIAWLMKSFGNFHHDVTTVLQNYFHYCALKMSCVELARTFV
GLSA2_SHIFL      ISYDTVVARSEFEHSARNAAIAWLMKSFGNFHHDVTTVLQNYFHYCALKMSCVELARTFV
GLSA_SALTY       ITYDATVARSEFEHSARNAAIAWLMKSFGNFHHDVPTVLQNYFHYCALKMSCMELARTFV
GLSA_PHOLL       ICYDSKVARSEMEHSHRNAAIAYLMKSFGNFDNDVLAVLQTYFHYCALKMNCIELAKCFI
GLSA1_YERPE      ISYDPRVARSEFEHSDRNAAIAYLMKSFGNFDNDVLTVLQTYFHYCAMRMSCVELARCFV
GLSA_VIBVU       ICYDKVVAASEMMHSDRNAAIAYLMRSFGNFENEVIPVLNNYFHACALKMSCVDLAKTFS
GLSA_VIBVY       ICYDKVVAASEMMHSDRNAAIAYLMRSFGNFENEVIPVLNNYFHACALKMSCVDLAKTFS
GLSA_VIBPA       IVYDKVVAASEMMHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFS
GLSA_VIBCH       IAYDKVVAASEMMHSDRNAAIAYLMRSFGNFHNEVIPVLHNYFHACALKMSCVELAKTFS
GLSA_SHEON       VCFDKQVADSEYQHSARNAAIAYLMKSFGNFQGDVDTVLRTYFHYCALKMNCADLSKAML
GLSA_PSEAE       VVSDSVVARSEYQHRSRNAAAAYLMKSFGNFHNDVEAVLFSYFHHCALRMSCVDLARAFC
GLSA_PSESM       ITSDSKVAESEYQHRSRNAAAAYLMKSFDNFHGDVEDVLRSYFHHCALSMNCIDLAKAFG
GLSA_CAUVC       LEIDPAVATSELAHAWQNRAIASLMRAKGTITHDPEAVVAAYCRQCALSMSCRQLARAFL
GLSA_STRAW       LTFDQDVAASEAAHGDRNAALGHFMASYGNIDNSVPVLLDQYFRQCSIEASCADLALATG
GLSA_STRCO       LGHDEEVAASEAAHGDRNAALAHFMASYGNIDNPVPVLLDQYFRQCSVAASCADLALATG
GLSA_CHRVO       LMADQAIAASERAHGDRNAALAHFMKSYGNLGHPVETVLDQYFHNCSIAMSCRELARAGL
GLSA_RALSO       VDYNPRVALSELEHADRNRAMAHFMRSFGNLHMPVETVIDAYCRQCAIEMHCVDLARAVL
GLSA2_CLOPE      IQLNEDVYLSEKETGDRNRALAYFMKSNGVIEGNIDDILDLYFKQCSLEVNAKDLARFGA
GLSA_CLOTE       IKVNEEVYQSEKKTGDRNRSLAYFMKGTGIIEKDVEKVLDAYFQQCSIEVTCKDIAKIAS
GLSA_FUSNN       LDLNYKIYIGESDTGFRNYSMAYFLKGEGIIEGNVNEALTVYFKQCSIEGTAKTISTLGK
GLSA1_CLOPE      ITLDTEIYLSERETGDINRSLAYYMKGNGIMEGDVTDILDSYFKQCSVLVTAKDLARLGA
GLSA1_BACAN      INYSSKVANSELETAYLNRSLCYYMKQNGIIDCDIEELMDLYTRQCAVEVNCIDLARIGL
GLSA1_BACCR      INYSSKVADSELETAYLNRSLCYYMKQNGIIDCDIEELMDLYTRQCAVEVNCIDLARIGL
GLSA1_BACHD      ITYNLEVAQSEFDTAFLNRSLSYFLKQHGVIQADVEQLLDLYTKQCAIEMCCSDLARIGY
GLSA2_BACSU      ITYCREVAESEYSTSMINRAMCYYMKQYGIFEDDVEAVMDLYTKQCAIEMNSLDLAKIGS
GLSA2_BACAN      PAINEIVFQSEWETAHRNRALAYYLKENGFLESDVEETLEVYLKQCSIEINTEDIALIGL
GLSA2_BACCR      PAINEIVFQSEWETAHRNRALAYYLKENGFLESDVEETLEVYLKQCSIEINTEDIALIGL
GLSA1_BACSU      PRIHEEVFRSEWETAHRNRALAYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGL
GLSA2_BACHD      ASANEAVFHSEWQTAHRNRSLAYYLKDTGYLESEVDDALHVYFTLCAIEVATKDIAKIGL
GLSA_OCEIH       PEIDVEVYVSERDTSMRNRAIGYYLLEEGYLESDLSITLETYFKHCSLNVTVDDLAMIGL
GLSA_NOSS1       VFVDISVFTSERSTGHRNRAMAHLMLNFGMIDRNIEEALDLYFQQCAVMVNCHDLAVMAA
GLSA_SYNY3       WLDQELLASVHSLPNPRNLAIAHLLAAKGYVE-DATLALETYNQLCCLSGCLKDLFKLGL
                       :          * .    :                *   *.       :     

GLSA1_ECO57      TLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVV
GLSA1_SHIFL      TLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVV
GLSA1_ECOL6      TLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVV
GLSA1_ECOLI      TLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVV
GLSA_BRUSU       TLAAGGVNPISGKRMVSAGNVAPILAEMTMEGLYTASGDWAYTVGLPGKSGVGGGIMAVV
GLSA_BACTN       TIANGGVNPVTKKEVFDASLAPKITAMIAAVGFYEHTGDWMYTSGIPAKTGVGGGVMGVL
GLSA2_YERPE      TLADGGVNPLTRERVVDNDICHYALAVMVTAGLYETSGDWLYDIGLPGKSGIGGGIVTVS
GLSA_AGRFC       FLANRGRNPLSGHTVVSDRRARRINALMLTCGHYDGSGDFAYHVGLPGKSGVGGGIMAVA
GLSA_RHIEC       FLAARGSNPMTGHSVVSPKRARRINALMLTCGHYDGSGDFAYHVGLPGKSGVGGGIFAVA
GLSA_RHIME       FLAAGGTNPLTGHSVVSRQRARRINALMLTCGHYDGSGDFAYRVGLPGKSGVGGGIMAVA
GLSA_RHILO       FLANGGKNPATGHSVVSAERARRIGAMMLTCGHYDGSGDFAFRVGIPGKSGVGGGILGIV
GLSA2_ECOLI      FLANQGKAIHIDEPVVTPMQARQINALMATSGMYQNAGEFAWRVGLPAKSGVGGGIVAIV
GLSA2_ECO57      FLANQGKAIHIDEPVVTPMQARQINALMATSGMYQNAGEFAWRVGLPAKSGVGGGIVAIV
GLSA2_ECOL6      FLANQGKAIHIDEPVVTPMQARQINALMATSGMYQNAGEFAWRVGLPAKSGVGGGIVAIV
GLSA2_SHIFL      FLANQGKAIHIDEPVVTPMQARQINALMATSGMYQNAGEFAWRVGLPAKSGVGGGIVAIV
GLSA_SALTY       FLANQGEAFHLDEPVVTPMQARQINALMATSGMYQNAGEFAWRVGLPAKSGVGGGIVAIV
GLSA_PHOLL       YLANQGSTIGSEQQILSPRQARQINALMMTCGMYDGSGEFAFRIGMPGKSGVGGGIVCVV
GLSA1_YERPE      YLANQGRSISGSESLITPMQARQINALMITSGMYDGAGEFAFRVGMPGKSGVGGGIIAIV
GLSA_VIBVU       YLANKGVSVHTDQRVISPVQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAIV
GLSA_VIBVY       YLANKGVSVHTDQRVISPVQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAIV
GLSA_VIBPA       YLANKGTSVQTGKPVVSPTQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVV
GLSA_VIBCH       YLANKGVSVVTGETVITPTQSKQTNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVV
GLSA_SHEON       YLANRGKTLDGTE-LISQVQTRQLNALLATSGLYDGAGEFAYRVGMPGKSGVGGGIIAVI
GLSA_PSEAE       FLADKGFCKHSGEQVLNERQTKQVNAIMATSGLYDEAGNFAYRVGLPGKSGVGGGIIAVV
GLSA_PSESM       FLANQGFCAHSGVQILTARQATQVNSIMATSGLYDEAGNFAYRVGLPGKSGVGGGIVAIV
GLSA_CAUVC       PLAAGGFSPIAQETVFPERLTRRLNALLLTCGIYDSVGSFAYRVGLPAKSGVGGGIVAVV
GLSA_STRAW       FLARHGIRAD-GSRLLTQSQAKQVNAVMLTCGTYDAAGDFAYRVGLPGKSGVGGGIIAVV
GLSA_STRCO       FLARHGIRAD-GTRLLSRSRAKQINAVMLTCGTYDAAGDFAHRVGLPGKSGVGGGIIAVV
GLSA_CHRVO       FLANHGLSPQTGTQYLSRSQAKQVNAVMLTCGTYDAAGEFAYRVGLPVKSGVGGGLLAVI
GLSA_RALSO       FLANGGVVPWSGERVIETSPAKRLSALMLTCGTYDAAGDFVYRVGLPAKSGVGGGIVAVL
GLSA2_CLOPE      MLANDGVLPWNGERVISREICRIIKTIMVTCGMYDDSGKFAVHIGIPAKSGVGGGIMAAV
GLSA_CLOTE       FLANDGVLPSTGERIIPAEVAKIVKAVMVTCGMYDASGSFAVKVGIPSKSGVGGGILATV
GLSA_FUSNN       FLANDGVLS-NGERILTTRMAKIIKTLMVTCGMYDSSGEFAVRVGIPSKSGVGGGICSVV
GLSA1_CLOPE      VLANEGVMPWNGERLFSVETATVVKSLMTTYGLYDESGAFSVHIGLPSKSGVGGGILSSV
GLSA1_BACAN      IFAMDGYDPYKKKQIIPKHITKICKTFMVTCGMYNESGEFAIRVGIPAKSGVAGGIFGCV
GLSA1_BACCR      IFAMDGYDPYKKKQIIPKHITKICKTFMVTCGMYNESGEFAIRVGIPAKSGVAGGIFGCV
GLSA1_BACHD      VFANEGRDPDTGQRIVPLHVARIIKTFMVTCGMYNASGEFAIRVGIPAKSGVSGAILALV
GLSA2_BACSU      VFALNGRHPETGEQVISKDVARICKTFMVTCGMYNASGEFAIKVGIPAKSGVSGGIMGIS
GLSA2_BACAN      ILAHDGYHPIRKEQVLPKEVARLTKALMLTCGMYNASGKFAAFIGLPAKSGVSGGIMTLV
GLSA2_BACCR      ILAHDGYHPIRKEQVLPKEVARLTKALMLTCGMYNASGKFAAFIGLPAKSGVSGGIMTLV
GLSA1_BACSU      ILAHDGYHPIRHEQVIPKDVAKLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALV
GLSA2_BACHD      ILANNGYDPLSHQQIFPKEVAKLTKALMLTCGMYNASGTFAAHIGIPAKSGVSGGIMAAV
GLSA_OCEIH       VLSNDGVHPNTDEPLIPKQIARVAKSLMLTCGMYDASGKFASYVGIPAKSGVSGGILAVV
GLSA_NOSS1       TLANRGVNPITGEQAVNSRYIKDILSVMYTCGMYNFAGEWAYKVGIPAKSGVCGGIMAVV
GLSA_SYNY3       MLQCP-------QPPLQPDTTARVKATMAKAGLYEMSEAFFRRTGFICKSGVSGLILACL
                  :             .         : :   * *     :    *.  *:*: * :    

GLSA1_ECO57      P-----------GVMGIAAFSPPLDEEGNSVRGQKMVASVAKQLGYNVFKG---------
GLSA1_SHIFL      P-----------GVMGIAAFSPPLDEEGNSVRGQKMVASVAKQLGYNVFKG---------
GLSA1_ECOL6      P-----------GVMGIAAFSPPLDEEGNSVRGQKMVASVAKQLGYNVFKG---------
GLSA1_ECOLI      P-----------GVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFKG---------
GLSA_BRUSU       P-----------GELAIAAFSPPLDPAGNSVKAMAAVAAVADSLGHNLYTTRGKVSS---
GLSA_BACTN       P-----------GQFGIAAFAPPLDGAGNSVKAQLAIQYVMNKLGLNVFSDNHLIVVD--
GLSA2_YERPE      P-----------GKGGLGTFAPLLDSAGNSIKGQLAARFLSRSLGMDMFVSEPYTEKN--
GLSA_AGRFC       P-----------GNASIAVWSPGLNKVGNSALGSQALELLATKTGWSVFGA---------
GLSA_RHIEC       P-----------GIASIAVWSPGLNKVGNSQLGAVALEMLAARTGWSVFGD---------
GLSA_RHIME       P-----------GKASIAVWSPGLNDYGNSLLGSLALEMLAARTGWSVFGP---------
GLSA_RHILO       P-----------GVASLAVWSPGLNANGNSKLGSIALEKLARMMNWSIFAP---------
GLSA2_ECOLI      P-----------HEMAIAVWSPELDDAGNSLAGIAVLEQLTKQLGRSVY-----------
GLSA2_ECO57      P-----------HEMAIAVWSPELDDAGNSLAGIAVLEQLTKQLGRSVY-----------
GLSA2_ECOL6      P-----------HEMAIAVWSPELDDAGNSLAGIAVLEQLTKQLGRSVY-----------
GLSA2_SHIFL      P-----------HEMAIAVWSPELDDAGNSLAGIAVLEQLTKQLGRSVY-----------
GLSA_SALTY       P-----------HEMAIAVWSPELDPAGNSLAGIAALEQLTQTLGRSVY-----------
GLSA_PHOLL       P-----------GEFTVTVWSPELDRSGNSLAGCAALELLADRVGRSVF-----------
GLSA1_YERPE      P-----------DEFCIAVWSPELDHAGNSLAGTAALERLAQQMGRSIF-----------
GLSA_VIBVU       P-----------GEMTIAVWSPELDPSGNSLAGTKALELLSERIGRSIF-----------
GLSA_VIBVY       P-----------GEMTIAVWSPELDPSGNSLAGTKALELLSERIGRSIF-----------
GLSA_VIBPA       P-----------GEMTIAVWSPELDASGNSLAGTKALELLSERIGRSIF-----------
GLSA_VIBCH       P-----------GEMTIAVWSPALDQSGNSLAGTRALELLAQRIGRSIF-----------
GLSA_SHEON       P-----------GELSVCVWSPELDTQGNSLAGTAMLEQLSQRLGRSIF-----------
GLSA_PSEAE       P-----------GRFTVCVWSPELNAAGNSLAGIAALEKLSERIGWSIF-----------
GLSA_PSESM       P-----------ERASVCVWSPALNAAGNSLVGMAALEKLSARVDWSVF-----------
GLSA_CAUVC       P-----------GKATVAVWSPELDRFGTSVVGTAALEAFSQITNCSVL-----------
GLSA_STRAW       P-----------GRCTLCVWSPGLDERGNSVAGVAALDRFTTLTGVSVF-----------
GLSA_STRCO       P-----------GHCTLCVWGPGLDERGNSVAGVAALDRFTTLTGLSVF-----------
GLSA_CHRVO       P-----------GKMAIAAWSPQLDARGNSVLGLEALDRFTTRTGLSIF-----------
GLSA_RALSO       P-----------GEFGVCVWSPGLDVSGNSLAGLQALEWLTTLSGRSIF-----------
GLSA2_CLOPE      P-----------RRMGIGIFGPSLDDKGNSIAGTHVMKDLSEELDLSIF-----------
GLSA_CLOTE       P-----------GVMGIGVFGPALDKKGNSIAGVKILERLSEELNLSIF-----------
GLSA_FUSNN       P-----------GKMGIGVYGPSLDKKGNSLAGGHLLEDLSAELSLNIF-----------
GLSA1_CLOPE      P-----------NKCGIGLFSPALDVSGNSVASMKLLKEIADKLKLDIFR----------
GLSA1_BACAN      K-----------GEMGIGIFGPALDANGNSIAGFKILELLSAQEGWSIF-----------
GLSA1_BACCR      K-----------GDMGIGIFGPALDANGNSIAGFKILELLSAQEGWSIF-----------
GLSA1_BACHD      P-----------NKYGIAVYSPALDEKGNSLAGIKLLETLSCREEWSIF-----------
GLSA2_BACSU      P-----------YDFGIGIFGPALDEKGNSIAGVKLLEIMSEMYRLSIF-----------
GLSA2_BACAN      PSKSR-KDLSFQDGCGIGIYGPAIDEYGNSLPGIMLLEHIAKEWDLSIF-----------
GLSA2_BACCR      PSKSR-KDLSFQDGCGIGIYGPAIDEYGNSLPGIMLLEHIAKEWDLSIF-----------
GLSA1_BACSU      PPSAR-REQPFQSGCGIGIYGPAIDEYGNSLTGGMLLKHMAQEWELSIF-----------
GLSA2_BACHD      PARGR-SD----EAMGIGIYGPAIDDFGNSVAGVALLKHLSHMWDLSIF-----------
GLSA_OCEIH       PPRVRDQNLPFLEGCGIGVFGPALDKQGNSIAGIKLLRHIANQWDLSLF-----------
GLSA_NOSS1       P-----------NLMGIAVFSPPLDIRGNSVRGVKVCEELSQQLGLHLFECMKVGNGEWG
GLSA_SYNY3       PAP---------SPTIFACYSPPLNEEGNPVAPLALLEFLAEFTSRN-------------
                                 .  :.* ::  *..         .                    

GLSA1_ECO57      ------
GLSA1_SHIFL      ------
GLSA1_ECOL6      ------
GLSA1_ECOLI      ------
GLSA_BRUSU       ------
GLSA_BACTN       ------
GLSA2_YERPE      ------
GLSA_AGRFC       ------
GLSA_RHIEC       ------
GLSA_RHIME       ------
GLSA_RHILO       ------
GLSA2_ECOLI      ------
GLSA2_ECO57      ------
GLSA2_ECOL6      ------
GLSA2_SHIFL      ------
GLSA_SALTY       ------
GLSA_PHOLL       ------
GLSA1_YERPE      ------
GLSA_VIBVU       ------
GLSA_VIBVY       ------
GLSA_VIBPA       ------
GLSA_VIBCH       ------
GLSA_SHEON       ------
GLSA_PSEAE       ------
GLSA_PSESM       ------
GLSA_CAUVC       ------
GLSA_STRAW       ------
GLSA_STRCO       ------
GLSA_CHRVO       ------
GLSA_RALSO       ------
GLSA2_CLOPE      ------
GLSA_CLOTE       ------
GLSA_FUSNN       ------
GLSA1_CLOPE      ------
GLSA1_BACAN      ------
GLSA1_BACCR      ------
GLSA1_BACHD      ------
GLSA2_BACSU      ------
GLSA2_BACAN      ------
GLSA2_BACCR      ------
GLSA1_BACSU      ------
GLSA2_BACHD      ------
GLSA_OCEIH       ------
GLSA_NOSS1       VGNCEC
GLSA_SYNY3       ------