CLUSTAL format seed alignment for MF_00315

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DXS_CHLMU       ------------MISPLLQHISSPQKLRSLSLDQLPLLCDEIRNRIIATLSLTGGHLASN
DXS_CHLTR       ------------MTYSLLPHIHSPQDLHALSLDKLPVLCDEIRNKIIESLSLTGGHLASN
DXS_CHLPN       ---------MTSSSCPLLDLILSPADLKKLSISQLPGLAEEIRYRIISVLSQTGGHLSSN
DXS_HELPY       -----------------MILQNKTFDLNPNDIAGLELVCQTLRNRILEVVSANGGHLSSS
DXS_HELPJ       -----------------MILQNKTFDLNPNDIAGLELVCQTLRNRILEVVSANGGHLSSS
DXS_CAMJE       ---------------MSKKFAHTQEELEKLSLKELENLAASMREKIIQVVSKNGGHLSSN
DXS_AGRFC       --------MTGMPQTPLLDRVNFPSDLKEIDDRDLPELARELRDEMIDAVSKTGGHLGAG
DXS_RHIME       ---MTQLPTNPMPATPLLDKVDYPDDLKKIDDRDLPQLAAELRAEMVDAVSRTGGHLGAG
DXS_RHILO       --------MNATPHTPLLDKVRIPADLRALDESELPQLASELRLELVDAVSRTGGHLGAG
DXS_BRUME       ---------MSRPSTPLLDKAPTPDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAG
DXS_BRUSU       ---------MSRPSTPLLDKAPTPDRLRALPEQDLPQLAEELRTELIDAVSTTGGHLGAG
DXS_CAUVC       ----------MSSKTPLLDTIASPADTRGLSLAELKQLAAEVRAETIDAVSVTGGHLGAG
DXS_RHOCA       -------MSATPSRTPHLDRVTGPADLKAMSIADLTALASEVRREIVEVVSQTGGHLGSS
DXS_CHLTE       ---------MISQAYPLLSSIHSPADLKKLSLHELELVAAECRKKVIELVSQNGGHFGSS
DXS_NOSS1       ---------------MHLSEITHPNQLHGLSIRQLQQIARQIRDKHLQTVAEFGGHLGPG
DXS_THEEB       ---------------MHLSELTHPNQLHGLSIAQLTQIAAQIRDKHLETVAATGGHLGPG
DXS_SYNY3       ---------------MHISELTHPNELKGLSIRELEEVSRQIREKHLQTVATSGGHLGPG
DXS_SYNP6       ---------------MHLSEITHPNQLHGLSVAQLEQIGHQIREKHLQTVAATGGHLGPG
DXS_SYNE7       ---------------MHLSEITHPNQLHGLSVAQLEQIGHQIREKHLQTVAATGGHLGPG
DXS_BACHD       ---------------MDLEKLHDPSLIKSMTKQELEQLAEEIRQFLIEKLSITGGHLGPN
DXS_BACSU       ---------------MDLLSIQDPSFLKNMSIDELEKLSDEIRQFLITSLSASGGHIGPN
DXS_LISIN       ----------MSCFYLDLLKIKDPSFMKQLDIQELEALAADIRAFLITSTSKSGGHIGPN
DXS_CLOAB       -------------MYNILDNYEDVDDIKNMSSDELKEFASEIRKFLIDKISKTGGHLASN
DXS_CLOPE       -------------MSEVLQRITDPKEIKDLDEKELEILAEDLREFLIESVSNTGGHFASN
DXS_CALS4       ----------------MLEQINSPYDLKKLDIKDLPRLSEEIRQFIVEKVSKTGGHLASN
DXS_BUCAI       -------MNFNFNKYPILSFANSVENLRLLSVEQLPQLCFELREYLLDVVSISKGHFASG
DXS_WIGBR       ---MNNSKNKNEIKFSILKKINNPIELRKLPKKKLIFLCEELREFLIDSVSSSSGHFASG
DXS_ECOL6       -------MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASG
DXS_ECO57       -------MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASG
DXS_ECOLI       -------MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASG
DXS_SALTI       -------MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASG
DXS_SALTY       -------MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASG
DXS_YERPE       -------MSLDIAKYPTLALAENPEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASG
DXS_VIBCH       -------MTLDISKYPTLALANTPDELRSLPKEVLPKLCDELRTYLLNSVSQSSGHLASG
DXS_VIBVU       -------MTLDISKYPTLALAETPDELRLLPKETLPTLCDELRTYLLNSVSQSSGHLASG
DXS_HAEIN       -------MTNNMNNYPLLSLINSPEDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASG
DXS_PASMU       -----------MQNYPLLSLINSPEDLRLLSKEQLPQICQELRAYLLESVSQSSGHLASG
DXS_SHEON       -------MSLDISQFPVLAQANTPNELRQLPQALLPQLADELREFLLKSVGMSSGHFASG
DXS_NEIMA       -----------MNPSPLLDLIDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASN
DXS_NEIMB       -----------MNPSPLLDLIDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASN
DXS_XANAC       --------MIDTTRYPRLSRIQTPDDLRRFDEAELTAIAEELRSYLIESVGKSGGHFAAG
DXS_XANCP       --------MIDSTRYPRLSRIQTPDDLRTFEEADLTAVADELRAYLIESVGKSGGHFAAG
DXS_XYLFA       --------MIDSTCYPRLSRIQIPEDLRTFQESELRAVADELRNYLIESVGLSGGHFAAG
DXS_PSEAE       MPKTLHEIPRERPATPLLDRASSPAELRRLGEADLETLADELRQYLLYTVGQTGGHFGAG
DXS_RALSO       ------------MTYELLNTIDAPAELRRLDRRQLGTLADELRAFVLESVAQTGGHLSSN
DXS_AQUAE       ----------MLEKYEILKDYKGPFDIKNYDYETLQKLAQEVRDYIINVTSKNGGHVGPS
DXS_COREF       --------------MGILNSISTPADLKALAEEDLEVLAGEIRSFLVDKVAATGGHLGPN
DXS_CORGL       --------------MGILNSISTPADLKALNDEDLDALAKEIRTFLVDKVAATGGHLGPN
DXS_MYCLE       ----------------MLEQIRRPADLQHLSQQQLRDLAAEIRELLVHKVAATGGHLGPN
DXS_MYCTU       ----------------MLQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPN
DXS2_KITGR      --------------MALLTRIRGPRDLDRLTPAQLAELAEEIRAFLVEEVSKTGGHLGPN
DXS2_STRCO      --------------MPLLTRITGPRDLDRLSLEELTQLAEEIRTFLVDAVSKTGGHLGPN
DXS_STRC1       --------------MTILENIRQPRDLKALPEEQLHELSEEIRQFLVHAVTRTGGHLGPN
DXS1_STRCO      --------------MTILENIRGPRDLKALSEAELGELSDEIRDFLVHAVARTGGHLGPN
DXS1_KITGR      --------------MPLLSRITGPADLRRLHPEQLPPLAAEIRAFLIDNVTRTGGHLGPN
DXS_TREPA       ------------MDLSLLRSLTGPHDLKSLSPEQVRALAQEVRQEILRVVSANGGHLASN
DXS_DEIRA       -----MNELPGTSDTPLLDQIHGPKDLKRLSREQLPALTEELRGEIVRVCSRGGLHLASS
DXS_THEMA       ---------------------MLLDEIKRMSYDELKRLAEDIRKRITEVVLKNGGHLASN
DXS_LEPIN       ----------MQQELTLLDRINYPAELRNIPLEKLPQICKEVRNYIIDTLSGIGGHFASN
DXS_FUSNN       ------------------------------MNEELTQRCEEIRKNLIEVVSKNGGHLGSN
DXS_MYCPE       ----------MKKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSN
                                                  :       *            *....

DXS_CHLMU       LGIVELTVALHYVFASPEDQFIFDVGHQAYVHKLLTGRNTEAFSNIRHDNGLSGFTSPQE
DXS_CHLTR       LGGVELTVALHYVFSSPDDQFIFDVGHQSYVHKLLTGRNTEAFSNIRHDNGLSGFTTPQE
DXS_CHLPN       LGIVELTIALHYVFSSPKDKFIFDVGHQTYPHKLLTGRNNEGFDHIRNDNGLSGFTNPTE
DXS_HELPY       LGAVELIVGMHALFDCQKNPFIFDTSHQAYAHKLLTGRF-ESFSTLRQFKGLSGFTKPSE
DXS_HELPJ       LGAVELIVGMHALFDCQKNPFIFDTSHQAYAHKLLTGRF-ESFSTLRQFQGLSGFTKPSE
DXS_CAMJE       LGAVELSIAMHLVFDAKKDPFIFDVSHQSYTHKLLSGKE-EIFDTLRQINGLSGYTKPSE
DXS_AGRFC       LGVVELTIAIHKVFNTPEDRLIFDVGHQCYPHKILTGRR-DRIRTLRQEDGLSGFTRRAE
DXS_RHIME       LGVVELTIAIHKIFDTPHDRLIFDVGHQCYPHKILTGRR-DRIRTLRQEDGLSGFTRRAE
DXS_RHILO       LGVVELTVALHYVFNTPDDRLIWDVGHQAYPHKILTGRR-DRIRTLRQEGGLSGFTRRAE
DXS_BRUME       LGVVELTVALHHVFNTPYDRIIWDVGHQAYPHKILTGRR-DRIRTLRQAGGLSGFTKRAE
DXS_BRUSU       LGVVELTVALHHVFNTPYDRIIWDVGHQAYPHKILTGRR-DRIRTLRQAGGLSGFTKRAE
DXS_CAUVC       LGVVELTVALHHVFETPKDIVIWDVGHQAYPHKILTGRR-DRIRTLRQGGGLSGFTKRAE
DXS_RHOCA       LGVVELTVALHAVFNSPGDKLIWDVGHQCYPHKILTGRR-SRMLTLRQAGGISGFPKRSE
DXS_CHLTE       LGVVELTVALHYVYQSPTDRIIWDVGHQAYVHKILTGRL-AQMETNRRYHGLAGFPKRSE
DXS_NOSS1       LGVVELTLGLYQTLDLDRDKVIWDVGHQAYPHKLITGRY-SDFHTLRQKDGIAGYLKRGE
DXS_THEEB       LGVVELTLALYQTLDLEKDRVVWDVGHQAYPHKMLTGRY-NNFHTLRQKGGIAGYLNRRE
DXS_SYNY3       LGVVELTVALYSTLDLDKDRVIWDVGHQAYPHKMLTGRY-HDFHTLRQKDGVAGYLKRSE
DXS_SYNP6       LGVVELTLALYQTLDLDRDKVVWDVGHQAYPHKLLTGRY-HNFHTLRQKDGIAGYLKRTE
DXS_SYNE7       LGVVELTLALYQTLDLDRDKVVWDVGHQAYPHKLLTGRY-HNFHTLRQKDGIAGYLKRTE
DXS_BACHD       LGVVELTLALHSLFDSPKDKLIWDVGHQAYVHKILTGRA-GQFDQLRQYKGLCGFPKRDE
DXS_BACSU       LGVVELTVALHKEFNSPKDKFLWDVGHQSYVHKLLTGRG-KEFATLRQYKGLCGFPKRSE
DXS_LISIN       LGVVELTIALHYTFNSPNDKFIWDVGHQSYVHKILTGRA-SQFDTLRQHGGLDGFPKRKE
DXS_CLOAB       LGVVELTLSLHKVFNLKKDKIIWDVGHQAYVHKILTGRK-DKFDSLKQFNGLSGFPKRNE
DXS_CLOPE       LGVIDLTVALFKNFDFSEDRIIWDVGHQSYAYKILTGRK-DKFNTLRQYGGLCGFPKRTE
DXS_CALS4       LGIVELTLALHYVFNSPVDKIIWDVGHQCYVHKMITGRR-DKFDTLRQFNGLSGYTKRTE
DXS_BUCAI       LGVVEITVALHYVYNTPFDNLLWDTGHQAYPHKILTGRG-EKINSIRKKNGLHSFPCREE
DXS_WIGBR       LGVIELTVALHYIYNTPFDYLVWDVGHQAYPHKIITGRR-DQIRSIRKKNGLHPFPFREE
DXS_ECOL6       LGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRR-DKIGTIRQKGGLHPFPWRGE
DXS_ECO57       LGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRR-DKIGTIRQKGGLHPFPWRGE
DXS_ECOLI       LGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRR-DKIGTIRQKGGLHPFPWRGE
DXS_SALTI       LGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRR-DKIGTIRQKGGLHPFPWRGE
DXS_SALTY       LGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRR-DKIGTIRQKGGLHPFPWRGE
DXS_YERPE       LGVVELTVALHYVYNTPFDHLIWDVGHQAYPHKILTGRR-DRISTIRQKDGLHPFPWRGE
DXS_VIBCH       LGTVELTVALHYVYHTPFDHLIWDVGHQAYPHKILTGRR-DQMPTIRQKDGLHPFPWREE
DXS_VIBVU       LGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRR-EQMPTIRQKGGLHPFPWREE
DXS_HAEIN       LGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRR-EQMSTIRQKDGIHPFPWREE
DXS_PASMU       LGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRR-DQMSTIRQKNGIHPFPWREE
DXS_SHEON       LGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRR-DRMHTIRQKNGLHPFPWREE
DXS_NEIMA       LGAVELTVALHYVYNTPEDKLVWDVGHQSYPHKILTGRK-NQMHTMRQYGGLAGFPKRCE
DXS_NEIMB       LGAVELTIALHYVYDTPEDKLVWDVGHQSYPHKILTGRK-NQMHTMRQYGGLAGFPKRCE
DXS_XANAC       LGVIELTVALHYLYQTPVDQLVWDVGHQTYPHKILTGRR-DQIHTVKQKDGVAPFPKREE
DXS_XANCP       LGVIELTVALHYLYQTPVDQLVWDVGHQTYPHKILTGRR-DQIHTVKQKDGVAPFPKREE
DXS_XYLFA       LGVVELTIALHYLYCTPIDHLVWDVGHQTYPHKILTGRR-DKISTVKHQGGLAPFPKREE
DXS_PSEAE       LGVVELTIALHYVFDTPDDRLVWDVGHQAYPHKILTERR-ELMGTLRQKNGLAAFPRRAE
DXS_RALSO       LGTVELTIALHYVFNTPDDRIVWDVGHQSYPHKILTGRR-EQMATLRQLDGISGFPRRSE
DXS_AQUAE       LGVVELTIALLRVFNPPEDVIVWDIGHQGYPWKILTDRK-EQFPTLRQYKGISGFLRREE
DXS_COREF       LGVVELTIGLHRVFDSPREPIIFDTSHQSYVHKILTGRG-DAFDTLRQKGGLSGYTSRAE
DXS_CORGL       LGVVELTIGLHRVFDSPQDPIIFDTSHQSYVHKILTGRA-KDFDSLRQKDGLSGYTCRAE
DXS_MYCLE       LGVVELTLALHRVFDSPHDPIIFDTGHQAYVHKMLTGRC-QDFDSLRKKAGLSGYPSRAE
DXS_MYCTU       LGVVELTLALHRVFDSPHDPIIFDTGHQAYVHKMLTGRS-QDFATLRKKGGLSGYPSRAE
DXS2_KITGR      LGVVELTLAMHRVFDSPRDRILFDTGHQSYVHKLLTGR--QDFSRLKMKGGLSGYPSRAE
DXS2_STRCO      LGVVELTLALHRVFESPKDKVLWDTGHQSYVHKLLTGR--QDFSKLKMKGGLSGYPSQGE
DXS_STRC1       LGVVELTIALHRVFESPVDRILWDTGHQSYVHKLLTGR--QDFSKLRGKGGLSGYPSREE
DXS1_STRCO      LGVVELTVALHRVFESPDDRILWDTGHQSYVHKLLTGR--QDFSKLRSKGGLSGYPSREE
DXS1_KITGR      LGVVELSIALHRVFDSPHDRILWDTGHQAYVHKLLTGR--QDFSRVRAKDGLSGYPSRAE
DXS_TREPA       LGVVELTIALHRVFSCPHDVVVWDVGHQCYAHKLLTGRA-GRFHTLRQKDGISGFPRRDE
DXS_DEIRA       LGAVDIITALHYVLDSPRDRILFDVGHQAYAHKILTGRR-DQMADIKKEGGISGFTKVSE
DXS_THEMA       LGTIELTLALYRVFDPREDAIIWDTGHQAYTHKILTGRD-DLFHTIRTFGGLSGFVTRRE
DXS_LEPIN       LGVVELTVALHYVFDTPKDRLVWDVGHQTYPHKILTGRK-DKLNTVRKFNGLSGFPKREE
DXS_FUSNN       LGVVELTVCLDEIFDFKEDIVLFDVGHQAYIYKILTDRA-ERFDSIRTRKGLSPFLDPNE
DXS_MYCPE       LGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRA-DKISTIRESNGLSGFQEPNE
                ** :::   :        : . :* .** *  *::: :    :   :   *:  :    *

DXS_CHLMU       SNHDIFFSGHAGNALSLALGLAKGAS-HG--SSHILPILGDAAFSCGLTLEALNNVPSDL
DXS_CHLTR       SNHDIFFSGHAGNALSLALGLAKGSS-NS--SSHILPILGDAAFSCGLTLEALNNIPADL
DXS_CHLPN       SDHDLFFSGHAGTALSLALGMAQTTPLES--RTHVIPILGDAAFSCGLTLEALNNISTDL
DXS_HELPY       SAYDYFIAGHSSTSVSIGVGVAKAFCLKQ-ALGMPIALLGDGSISAGIFYEALNELGDRK
DXS_HELPJ       SAYDYFIAGHSSTSVSIGVGVAKAFRLKQ-TLGMPIALLGDGSISAGIFYEALNELGDRK
DXS_CAMJE       --GDYFVAGHSSTSISLAVGACKAIALKG-EKRIPVALIGDGALSAGMAYEALNELGDSK
DXS_AGRFC       SEYDDFGAGHSSTSISAGLGMAVAAGLDG-SDRKVIAVIGDGSMSAGMAFEALNNAGALD
DXS_RHIME       SEYDPFGAAHSSTSISAGLGMAVAAELDG-KSRNVIAVIGDGAMSAGMAFEALNNAGALD
DXS_RHILO       SEYDPFGAAHSSTSISAGLGMAAARDLSG-GRNNVIAVIGDGAMSAGMAYEAMNNAGALD
DXS_BRUME       SEYDPFGAAHSSTSISAGLGMAVASELSG-EKRNVIAVIGDGSMSAGMAYEAMNNAGALD
DXS_BRUSU       SEYDPFGAAHSSTSISAGLGMAVASELSG-EKRNVIAVIGDGSMSAGMAYEAMNNAGALD
DXS_CAUVC       SEYDPFGAAHAATSISAALGFCAARDAKG-EDNSVIAVIGDGSLGAGMAYEAMNAATDTT
DXS_RHOCA       SPHDAFGAGHSSTSISAALGFAVGRELGQ-PVGDTIAIIGDGSITAGMAYEALNHAGHLK
DXS_CHLTE       SPHDAFGTGHASTSISAAAGLAAARDLAG-RKEKVVAIIGDGSLTGGMAFEAMNHLGDTK
DXS_NOSS1       NKFDHFGAGHASTSISAALGMALARDMNG-EKFKAVAVIGDGALTGGMALEAINHAGHLP
DXS_THEEB       SPFDHFGAGHASTSISAALGMAIARDLKG-ENFKVVAIIGDGALTGGMALEAINHAGHLP
DXS_SYNY3       SRFDHFGAGHASTSISAGLGMALARDAKG-EDFKVVSIIGDGALTGGMALEAINHAGHLP
DXS_SYNP6       NRFDHFGAGHASTSISAALGMALARDAQG-EDYRCVAVIGDGSLTGGMALEAINHAGHLP
DXS_SYNE7       NRFDHFGAGHASTSISAALGMALARDAQG-EDYRCVAVIGDGSLTGGMALEAINHAGHLP
DXS_BACHD       SEHDVWETGHSSTSLSAAMGMATARDLKG-TDENVIAIIGDGALTGGMALEALNHIGH-E
DXS_BACSU       SEHDVWETGHSSTSLSGAMGMAAARDIKG-TDEYIIPIIGDGALTGGMALEALNHIGD-E
DXS_LISIN       SIHDVFETGHSSTSLSAAVGMVIARDIKK-EDFYVIPIIGDGALTGGMAFEALNHIGD-M
DXS_CLOAB       SIYDAFETGHSSTSISAASGIARARDLSK-DNYDVIAVIGDGALTGGMALEALNDIGY-K
DXS_CLOPE       SEYDFFATGHSSTSLSSAAGMARAQRLLG-KDNKVIAVIGDGALTGGMALEALNDIGY-R
DXS_CALS4       SIHDIFGAGHSSTSLSAALGIATARDLKG-EKYHVIAVIGDGALTGGMALEALNNIGR-S
DXS_BUCAI       SEYDSLSVGHSSTSISAGLGMSIAAEKEG-RNRKTICIIGDGAMTAGMAFEAINHAGEIQ
DXS_WIGBR       SEYDILSVGHSSTSISASLGMSISARKEG-MGRKVVSVIGDGAITSGMAFEAMNHAGDIK
DXS_ECOL6       SEYDVLSVGHSSTSISAGIGIAVAAEKEG-KNRRTVCVIGDGAITAGMAFEAMNHAGDIR
DXS_ECO57       SEYDVLSVGHSSTSISAGIGIAVAAEKEG-KNRRTVCVIGDGAITAGMAFEAMNHAGDIR
DXS_ECOLI       SEYDVLSVGHSSTSISAGIGIAVAAEKEG-KNRRTVCVIGDGAITAGMAFEAMNHAGDIR
DXS_SALTI       SEYDVLSVGHSSTSISAGIGIAVAAEKEG-KDRRTVCVIGDGAITAGMAFEAMNHAGDIR
DXS_SALTY       SEYDVLSVGHSSTSISAGIGIAVAAEKEG-KDRRTVCVIGDGAITAGMAFEAMNHAGDIR
DXS_YERPE       SEYDVLSVGHSSTSISAGLGMAVAAEREG-KGRRTVCVIGDGAITAGMAFEAMSHAGDIH
DXS_VIBCH       SEYDTLSVGHSSTSISAALGMAICAGKEG-KDRKVVSVIGDGAITAGMAFEAMNHAGDVH
DXS_VIBVU       SEYDTLSVGHSSTSISAALGMAICAEKEG-QNRKVVSVIGDGAITAGMAFEAMNHAGDVH
DXS_HAEIN       SEFDVLSVGHSSTSISAGLGIAVAAEREN-AGRKTVCVIGDGAITAGMAFEALNHAGALH
DXS_PASMU       SEFDVLSVGHSSTSISAGLGIAVAAQREN-AGRKTVCVIGDGAITAGMAFEAMNHAGALH
DXS_SHEON       SEYDTFSVGHSGTSISAALAMAVAAEKEQ-AGRKVVAVIGDGAMTGGMVFEAMNHAGDLH
DXS_NEIMA       SEYDAFGVGHSSTSIGAALGMAAADKQLG-SDRRSVAIIGDGAMTAGQAFEALNCAGDMD
DXS_NEIMB       SEYDAFGVGHSSTSIGAALGMAAADKLLG-SDRRSVAIIGDGAMTAGQAFEALNCAGDMD
DXS_XANAC       SIYDTFGVGHSSTSISAALGMAIAAQRNG-DDRKVVAVIGDGAMTAGMVYEALNHAGGMD
DXS_XANCP       SVYDTFGVGHSSTSISAALGMAIAAQRNG-DDRKVVAVIGDGAMTAGMVYEALNHAGGMD
DXS_XYLFA       SIYDTFGVGHSSTSISAALGMAIVAQRHG-DERKVVAIIGDGAMTAGMAYEALNHAGGMS
DXS_PSEAE       SEYDTFGVGHSSTSISAALGMAIAARLQG-KERKSVAVIGDGALTAGMAFEALNHASEVD
DXS_RALSO       SPYDTFGTAHSSTSISAALGMALGAKTQG-ENRVAIAVIGDGAMSAGMAFEAMNNAGVYR
DXS_AQUAE       SIYDAFGAGHSSTSISAALGFRIGKDLKGEKEDYVIAVIGDGALTAGMAYEALNNAGHIR
DXS_COREF       SEHDWTESSHASAALSYADGMSKAFQLDGDTNRNVVAVVGDGALTGGMCWEALNNIAAGK
DXS_CORGL       SEHDWTESSHASAALSYADGLSKAKQLDGDTTHSVVAVVGDGALTGGMCWEALNNIAAGK
DXS_MYCLE       SEHDWVESSHASTALSYADGLAKAFELAGNRNRHVVAVVGDGALTGGMCWEALNNIAATP
DXS_MYCTU       SEHDWVESSHASAALSYADGLAKAFELTGHRNRHVVAVVGDGALTGGMCWEALNNIAASR
DXS2_KITGR      SEHDVIENSHASTVLGYADGLAKANKIQGHKDRPVVAVIGDGALTGGMAWEALNNIADSQ
DXS2_STRCO      SEHDVIENSHASTVLGWADGIAKANQVMERDD-HVVAVIGDGALTGGMAWEALNNIAAAK
DXS_STRC1       SEHDVIENSHASTALGWADGLAKARRVQGEKG-HVVAVIGGRALTGGMAWEALNNIAAAK
DXS1_STRCO      SAHDVIENSHASTVLGWADGLAKARQVQGERS-HVVAVIGDGALTGGMAWEALNNIAAAR
DXS1_KITGR      SPHDLIENSHASTALGHADGIAKADQLLGVDR-CTVAVIGDGALTGGMAWEALNNIAEAE
DXS_TREPA       SPYDAFGTGHSSTALSAASGILSALRYRGKSG-KVVAVVGDGALTAGLAFEALLNVGRSC
DXS_DEIRA       SEHDAITVGHASTSLANALGMALARDAQG-KDFHVAAVIGDGSLTGGMALAALNTIGDMG
DXS_THEMA       SPLDWFGTGHAGTSIAAGLGFEKAFELLG-EKRHVVVVIGDGALTSGMALEALNQLKNLN
DXS_LEPIN       SPYDLYNTGHAGTSISQALGEAAARDLVK-ENYNVVAIIGDASIATGMALEAMNHAGHLK
DXS_FUSNN       SSYDHFISGHAGTALPAAVGFAIANP-----DKKVIVVVGDASISNGHSLEALNYIGYKK
DXS_MYCPE       SIHDFISTGHSGNILSICQGFIEKNNSKS---KSVIPVIGDAAISNGLAFEALNNIAYNK
                   *    .*:.  :    .                 ::*. ::  *    *:       

DXS_CHLMU       S--KFIIVLNDNQMSISENVGNIPQGISQWIQPP---KFDKIFQKI----HSWMRKIPGF
DXS_CHLTR       S--KFIIVLNDNQMSISENVGNIPQGISHWMYPQ---KISKLSQKI----HSWIQNLPSF
DXS_CHLPN       S--KFVVILNDNNMSISKNVGAMSRIFSRWLHHP---ATNKLTKQV----EKWLAKIPRY
DXS_HELPY       --YPMIMILNDNEMSISTPIGALSKALSQLMKGP---FYQSFRSKV----KKILST---L
DXS_HELPJ       --YPMIMILNDNEMSISTPIGALSKALSQLMKGP---FYQSFRSKV----KKILST---L
DXS_CAMJE       --FPCVILLNDNEMSISKPIGAISKYLSQAMATQ---FYQSFKKRI----AKMLDI---L
DXS_AGRFC       A--RLIVILNDNDMSIAPPTGAMSAYLARLASGR---TYMGFRDFG----KKLTAY---L
DXS_RHIME       A--RLIVILNDNDMSIAPPTGAMSAYLARLASGR---TYMGIREVG----KKLTAY---L
DXS_RHILO       A--RLIVILNDNDMSIAPPTGAMSAYLARLASGK---AYAGLRDFG----KKLTSY---L
DXS_BRUME       A--RLIVILNDNDMSIAPPTGAMSAYLARLVSGR---TYRSVREAA----KQVAQK---L
DXS_BRUSU       A--RLIVILNDNDMSIAPPTGAMSAYLARLVSGR---TYRSVREAA----KQVAQK---L
DXS_CAUVC       K--RLIVILNDNDMSIAPPVGGMSAYLANLVSGG---AYRSVRKLG----KTVVEK---L
DXS_RHOCA       S--RMFVILNDNDMSIAPPVGALQHYLNTIARQA---PFAALKAAA----EGIEMH---L
DXS_CHLTE       S--DVLVILNDNQMAISPSTGGLKNYLVNLTLNK---TYNRLRKFVWDSLSLLHNE---I
DXS_NOSS1       K-TNLLVVLNDNEMSISPNVGAIPRYLNKMRLSP---PVQFIKDNF----EEQFKHIPFV
DXS_THEEB       H-TNLMVVLNDNEMSISPNVGAIPRYLNKIRLSP---QVQFITDNL----EEQFKHIPFF
DXS_SYNY3       H-TRLMVILNDNEMSISPNVGAISRYLNKVRLSS---PMQFLTDNL----EEQIKHLPFV
DXS_SYNP6       K-TRLLVVLNDNDMSISPNVGALSRYLNKIRVSE---PMQLLTDGL----TQGMQQIPFV
DXS_SYNE7       K-TRLLVVLNDNDMSISPNVGALSRYLNKIRVSE---PMQLLTDGL----TQGMQQIPFV
DXS_BACHD       Q-KDLIVVLNDNEMSIAPNVGALHNVLGRLRTAG---KYQKAKEDL----EMLIKKIPAF
DXS_BACSU       K-KDMIVILNDNEMSIAPNVGAIHSMLGRLRTAG---KYQWVKDEL----EYLFKKIPAV
DXS_LISIN       G-KDMIVILNDNDMSIAPNVGALHNVLGKLRTSN---TFQQTKTNI----DKLMRKIPTA
DXS_CLOAB       K-TNVIIILNDNQMSIAKNVGSISKYLNKIRLDP---KYNKLKKDV----KTKLQR-TNI
DXS_CLOPE       K-DNLIIILNDNQMSICKNVGGLATYLNKLRMGV---GYNKLKSDI----GSTLDT-TSL
DXS_CALS4       R-KDVIVILNHNEMSISENVGSLSLYLSKLRTDP---TYNKVKQEI----DNLLNIIPPI
DXS_BUCAI       S--NLLVILNDNQMSISRNVGALNKHLKILRSVQ---NTQKNRKK-----IRLLN----K
DXS_WIGBR       S--DLLIVLNDNEMSISENVGALNKYSNNFISKK---IFPFLKKNG----EKLLN----K
DXS_ECOL6       P--DMLVVLNDNEMSISENVGALNNHLAQLLSGK---LYSSLREGG----KKVFS----G
DXS_ECO57       P--DMLVVLNDNEMSISENVGALNNHLAQLLSGK---LYSSLREGG----KKVFS----G
DXS_ECOLI       P--DMLVILNDNEMSISENVGALNNHLAQLLSGK---LYSSLREGG----KKVFS----G
DXS_SALTI       P--DMLVILNDNEMSISENVGALNNHLARLLSGK---LYSSLREGG----KKVFS----G
DXS_SALTY       P--DMLVILNDNEMSISENVGALNNHLAQLLSGK---LYSSLREGG----KKVFS----G
DXS_YERPE       S--DMLVILNDNGMSISENVGGLNNHLAQLLSGK---LYASLREGG----KKAFS----A
DXS_VIBCH       P--DMLVVLNDNEMSISENVGALNNHLAQVLSGS---LYTSIREGG----KKVLS----G
DXS_VIBVU       S--DMLVILNDNEMSISENVGALNNHLARVLSGN---LYTSIREGG----KKVLS----G
DXS_HAEIN       T--DMLVILNDNEMSISENVGALNNHLARIFSGS---LYSTLRDGS----KKILD----K
DXS_PASMU       T--DMLVILNDNEMSISENVGALNNHLARLLTGS---FYSSIREGG----KKILS----G
DXS_SHEON       N--DMLMVLNDNEMSISENVGALNNHLAQLMSGR---FYTTIRESS----KKVLK----G
DXS_NEIMA       V--DLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQT----GKVLD----K
DXS_NEIMB       V--DLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQT----GKVLD----K
DXS_XANAC       PEPNLLVILNDNRMSISEAVGGLTKMLGRASGSR---TLNAIREGG----KKILGDK--K
DXS_XANCP       PEPNLLVILNDNRMSISEAVGGLTKMLGRASGSR---TLNAIREGG----KKILGDK--K
DXS_XYLFA       PAPNLLVILNDNRMSISEAVGGLTKMLGRATGSK---ALNAIREGG----KRIFGDK--K
DXS_PSEAE       A--DMLVILNDNDMSISHNVGGLSNYLAKILSSR---TYSSMREGS----KKVLS----R
DXS_RALSO       N-LPLVVVLNDNDMSISPPVGALNRYLARLMSGQ---FYAATKKGV----EKLLS----V
DXS_AQUAE       P-DRFIVILNDNEMSISPNVGAISTYLNRIISGH---FVQETRQKI----KNFLQHF--G
DXS_COREF       D-RNVVVVVNDNGRSYSPTIGGFAENLAQLRMEP---FYDRVMEQG----KSTLKSMGWV
DXS_CORGL       D-RKVVVVVNDNGRSYSPTIGGFAENLAGLRMQP---FYDRFMEKG----KTSLKSMGWV
DXS_MYCLE       --RPVVIVVNDNGRSYAPTIGGVADHLATLRLQP---AYERLLEKG----RDALHSLPLI
DXS_MYCTU       --RPVIIVVNDNGRSYAPTIGGVADHLATLRLQP---AYEQALETG----RDLVRAVPLV
DXS2_KITGR      D-LPIVIVVNDNERSYSPTIGGLANHLATLRTTQ---GYERFLSWG----KDALQRTPVV
DXS2_STRCO      D-RPLVIVVNDNERSYAPTIGGLANHLATLRTTD---GYERFLART----KEVLERTPVV
DXS_STRC1       D-QPLIIVVNDNERSYAPTIGGLANHLATLRTTD---GYEKVLAWG----KDVLLRTPIV
DXS1_STRCO      D-RPLIIVVNDNERSYAPTIGGLANHLATLRTTD---GYERALAWG----KDVLQRTPVV
DXS1_KITGR      D-RPLVIVVNDNERSYAPTIGGLAHHLATLRTTK---GYERFLAWG----KDALQRTPVV
DXS_TREPA       --SDLIVILNDNKMSISPNTGSFSRYLSTLTVKG---PYQKLKTRL----RRALQTVPLV
DXS_DEIRA       --RKMLIVLNDNEMSISENVGAMNKFMRGLQVQK---WFQEGEGAG----K---KAVEAV
DXS_THEMA       S--KMKIILNDNGMSISPNVGGLAYHLSKLRTSP---IYLKGKKVL----KKVLEKTE-I
DXS_LEPIN       K--DMIVILNDNYMSISKNVGSISNYLNNIITSH---FYNHWKRVF----YTFLKWLPII
DXS_FUSNN       L-ENILIIVNDNEMSIGENVGFISKFLKKVISSG---KYQNFREDV----KSFINRI--K
DXS_MYCPE       T--PMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKI----LFKKEWSKKI
                      :::*.*  :     * .                                     

DXS_CHLMU       SRQKSELLHKVDIALKSL--SH-------PLFEQFGIHYVGPFDGHNIKKLIPALEAVKG
DXS_CHLTR       LHKKKTLSHKVDIALKSL--SH-------PLFEQFGLHYVGPIDGHNVKKLVQALQMIKD
DXS_CHLPN       GDSLAKHSRRLSQCVKNLFCPT-------PLFEQFGLAYVGPIDGHNVKKLIPILQSVRN
DXS_HELPY       PESVNYLASRFEESFKLITPGV--------FFEELGINYIGPINGHDLSAIIETLKLAKE
DXS_HELPJ       PESVNYLASRFEESFKLITPGV--------FFEELGINYIGPINGHDLGTIIETLKLAKE
DXS_CAMJE       PDSATYMAKRFEESFKLITPGL--------LFEELGLEYIGPIDGHNLGEIISALKQAKA
DXS_AGRFC       GKTIDRAITRAVTHARGYVTGG-------TLFEELGFYHIGPIDGHSFDHLLPVLRNVRD
DXS_RHIME       GKTVDRAITRAVEHARGYVTGG-------TLFEEMGFYHIGPIDGHSFDHLLPVLRNVRD
DXS_RHILO       GKRADRAITRAVEHARGYVTGG-------TLFEELGFYHIGPIDGHNLEHLIPVLKNVRD
DXS_BRUME       PKFLQDKARKSEEYARAFFTGG-------TLFEELGFYYVGPIDGHNLDHLLPVLKNVRD
DXS_BRUSU       PKFLQDKARKSEEYARAFFTGG-------TLFEELGFYYVGPIDGHNLDHLLPVLKNVRD
DXS_CAUVC       PTPMREAARKAEEYARGMVTGG-------TFFEELGFYYIGPIDGHDMDALVSVLKNAKA
DXS_RHOCA       PGPVRDGARRARQMVTAMPGGA-------TLFEELGFDYIGPVDGHDMAELVETLRVTRA
DXS_CHLTE       GETAKTAVHRIEDGIKAAFTPG-------AYFEALGFRYFGPIDGHNMEQLIKALREMRQ
DXS_NOSS1       GESLSPELGRIKEGMKRLAVPKV-----GAVFEELGFTYMGPVDGHNLEELIATFQQAHQ
DXS_THEEB       GENLTPEMQRLKEGMKRLAVPKV-----GAVFEELGFTYVGPVDGHNLEELIATFQHAHT
DXS_SYNY3       GDSLTPEMERVKEGMKRLVVPKV-----GAVIEELGFKYFGPIDGHSLQELIDTFKQAEK
DXS_SYNP6       GGAITQGFEPVKEGMKRLSYSKI-----GAVFEELGFTYMGPVDGHNLEELIATFREAHK
DXS_SYNE7       GGAITQGFEPVKEGMKRLSYSKI-----GAVFEELGFTYMGPVDGHNLEELIATFREAHK
DXS_BACHD       GGKLAQAAERVKDSLKYLLVS-------GIFFEEMGFTYLGPVDGHDLDDLMENLKYAKK
DXS_BACSU       GGKLAATAERVKDSLKYMLVS-------GMFFEELGFTYLGPVDGHSYHELIENLQYAKK
DXS_LISIN       GEKLADTAEKAKDGIKHLLVE-------GTFFEELGFMYLGPIDGHNLEDVITNLEIAKR
DXS_CLOAB       GSEVANSIERIKGGIKQMVVS-------GMFFEDIGIKYLGPIDGHNIEELTSVISKAKE
DXS_CLOPE       GKRVKNSLSKLKDGIKKIVVP-------SMYFEDIGLKYFGIVDGHNIRELNEVLSIAKN
DXS_CALS4       GKSLHKYIEKIKDSIKQLVVP-------GMFFEELGFTYLGPIDGHNVEELIEVLERSKK
DXS_BUCAI       KLFFKD-----KRIQNH--SISF-----NSIFSNLGCKYLGPFDGHNIFSIINTLKKIKN
DXS_WIGBR       IPRFKKIIEILENKINN--YFSP-----KYLFEELGFNYSGPYNGHDVLLLSNILKKLRL
DXS_ECOL6       VPPIKELLKRTEEHIKG-MVVP------GTLFEELGFNYIGPVDGHDVLGLITTLKNMRD
DXS_ECO57       VPPIKELLKRTEEHIKG-MVVP------GTLFEELGFNYIGPVDGHDVLGLITTLKNMRD
DXS_ECOLI       VPPIKELLKRTEEHIKG-MVVP------GTLFEELGFNYIGPVDGHDVLGLITTLKNMRD
DXS_SALTI       VPPIKELLKRTEEHIKG-MVVP------GTLFEELGFNYIGPVDGHDVMGLISTLKNMRD
DXS_SALTY       VPPIKELLKRTEEHIKG-MVVP------GTLFEELGFNYIGPVDGHDVMGLISTLKNMRD
DXS_YERPE       LPPIKDLLKRTEEHLKG-MVVP------STLFEELGFNYIGPVDGHDVHTLTQTLKNMRD
DXS_VIBCH       IPPIKELVRRTEEHLKG-MVVP------GTLFEELGFNYIGPVDGHDVLELIKTLKNMRE
DXS_VIBVU       VPPIKELVRRTEEHLKG-MVVP------GTLFEELGFNYIGPIDGHDVVELVKTLKNMRE
DXS_HAEIN       VPPIKNFMKKTEEHMKGVMFSPE-----STLFEELGFNYIGPVDGHNIDELVATLTNMRN
DXS_PASMU       MPPIKEFVKKTEEHVKG-FVSPV-----GTMFEQLGFNYIGPIDGHNIEELISTLKNMRA
DXS_SHEON       MPVIKEMAKRTEEHLKG-MVVP------GTLFEELGFNYIGPIDGHDVDALVETLRNMRN
DXS_NEIMA       IPGAMEFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLEDLRG
DXS_NEIMB       IPGAMEFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLRS
DXS_XANAC       NNPTARFVRRWEEHWKGMFVPS-------TLFEEMGFHYTGPIDGHDLPSLVGALKTLQT
DXS_XANCP       NNPTARFVRRWEEHWKGMFVPS-------TLFEEMGFHYTGPIDGHDLPSLVGALKTLKT
DXS_XYLFA       TNATARFLRRWEEHWKGMFVPS-------TLFEEMGFHYTGPIDGHDLPALLGALKTLRT
DXS_PSEAE       LPGAWEIARRTEEYAKGMLVPG-------TLFEELGWNYIGPIDGHDLPTLVATLRNMRD
DXS_RALSO       APPVLEFAKRFEEHAKGMLVPA-------TMFEEFGFNYIGPIDGHDLESLVPTLQNIRQ
DXS_AQUAE       ETPLRIM-KLTEEFLKGLISPG-------VIFEELGFNYIGPIDGHDIKALEDTLNNVKD
DXS_COREF       GERTFEALHAFKEGVKSTVIPTEM-------FPELGMKYIGPVNGHDQKAVDNALAYARD
DXS_CORGL       GERTFEALHAFKEGVKSTVIPTEM-------FPELGMKYVGPVDGHNQKAVDNALKYAHD
DXS_MYCLE       GQIAYRFMHSVKAGIKDSLSPQLL-------FTDLGLKYVGPVDGHDEHAVEVALRKARG
DXS_MYCTU       GGLWFRFLHSVKAGIKDSLSPQLL-------FTDLGLKYVGPVDGHDERAVEVALRSARR
DXS2_KITGR      GQAMFDTLHGAKKGLKDFIAPQGM-------FEDLGLKYLGPIDGHDLQALESAFTKARN
DXS2_STRCO      GRPLYDTLHGAKKGLKDFIAPQGM-------FEDLGLKYVGPIDGHDLEALESALTRAKR
DXS_STRC1       GHPLYEALHGAKKGFKDAFAPQGM-------FEDLGLKYVGPIDGHDIGAVESALRRAKR
DXS1_STRCO      GHTVYEALHGAKKGFKDAFAPQGL-------FEDLGLKYLGPIDGHDIGAVESALRRAKR
DXS1_KITGR      GPPLFDALHGAKKGFKDAFAPQGM-------FEDLGLKYLGPIDGHDIAGVEQALRRARN
DXS_TREPA       GRPACRALSRLKRSARTLLYQSNI-------FADFGFEYVGPLNGHHIEDLERVLNDAKK
DXS_DEIRA       SKPLADFMSRAKNSTRHFFDPASVN-----PFAAMGVRYVGPVDGHNVQELVWLLERLVD
DXS_THEMA       GFEVEEEMKYLRDSLKGMIQGT-------NFFESLGLKYFGPFDGHNIELLEKVFKRIRD
DXS_LEPIN       GPATERFFKKVEKGFKDVLTPG-------GLFEDLGFGYIGPEDGHDVIRLVKMLEKVKK
DXS_FUSNN       ADRVKRTLERLERSIKGYVTPF-------YALESLGFRFFNVFEGNNIEKLLPMLKKIKD
DXS_MYCPE       YWSIYKSFSKLSKFFKGK-----------NFFESLGFHYFGVIDGNNLKKTINVLKRIKN
                                               :  :*  . .  :*:        :     

DXS_CHLMU       LPY----PVLFHVCTAKGNGLAEAEKDP-ALYHGVKAYFKNHSPKKKP-----LSSEVKT
DXS_CHLTR       QPQ----PILFHVCTVKGNGLAEAERDP-IRYHGVKAHFQNTSLKKTS-----GNVELQT
DXS_CHLPN       LPF----PILVHVCTTKGKGLDQAQNNP-AKYHGVRANFNKRESAKH-------LPAIKP
DXS_HELPY       LKE----PVLIHAQTLKGKGYKIAEGRYEK-WHG-VGPFDLDTGLSK-----KS--K-SA
DXS_HELPJ       LKE----PVLIHAQTLKGKGYKIAEGRYEK-WHG-VGPFDLDTGLSK-----KS--K-SA
DXS_CAMJE       MQK----PCVIHAQTIKGKGYALAEGKHAK-WHG-VGAFDIDSGESV-----KK--S-DT
DXS_AGRFC       NQKG---PVLIHVVTQKGKGYAPAEAAADK-YHG-VNKFDVITGAQA-----KA--KPNA
DXS_RHIME       NAKG---PVLIHVVTQKGKGYPPAEAAADK-YHG-VNKFDVITGAQA-----KA--KPNA
DXS_RHILO       NGEG---PVLIHVVTQKGKGYAPAEAAADK-YHG-VNKFDVITGAQA-----KA--PANA
DXS_BRUME       TQKG---PVLIHVVTQKGKGYAPAEAAADK-YHG-VNKFDVITGKQA-----KP--PANA
DXS_BRUSU       TQKG---PVLIHVVTQKGKGYAPAEAAADK-YHG-VNKFDVITGKQA-----KP--PANV
DXS_CAUVC       FGDK---PVLVHCVTQKGKGYAPAEGAADK-LHA-VVKFDVVTGQQQ-----KA--AGGP
DXS_RHOCA       RASG---PVLIHVCTTKGKGYAPAEGAEDK-LHG-VSKFDIETGKQK-----KS--IPNA
DXS_CHLTE       LHH----PKLLHVITTKGKGFKPAEENQPK-WHASVGGFDIETGKNV-----KAPGKPAK
DXS_NOSS1       IAG----PVLVHVATIKGKGYELAEKDQ-VGYHA-QTPFNLTTGKAI-----PS--NKPK
DXS_THEEB       IPG----PVLVHVATVKGKGYAIAEKDQ-VGYHA-QNPFDLVTGKAK-----PS--SKPK
DXS_SYNY3       VPG----PVFVHVSTTKGKGYDLAEKDQ-VGYHA-QSPFNLSTGKAY-----PS--SKPK
DXS_SYNP6       HTG----PVLVHVATTKGKGYPYAEEDQ-VGYHA-QNPFDLATGKAK-----PA--SKPK
DXS_SYNE7       HTG----PVLVHVATTKGKGYPYAEEDQ-VGYHA-QNPFDLATGKAK-----PA--SKPK
DXS_BACHD       TKG----PVLIHVLTKKGKGYAPAENDEKGTWHG-VGHYKIESGELV-----K---KPAP
DXS_BACSU       TKG----PVLLHVITKKGKGYKPAETDTIGTWHG-TGPYKINTGDFV-----KP--KAAA
DXS_LISIN       TKG----PVLLHIITKKGKGYQPAELDSRGTWHG-TGPYKVETGSFI-----KP--AKTV
DXS_CLOAB       IKG----PVILHVKTQKGKGYSYAEENP-NKFHS-IGKFNSKTGEAL-----S----KPK
DXS_CLOPE       IKG----PVIIHTVTKKGKGYELAEKNP-NKYHG-VSPFDLGEGVIS-----K----FSS
DXS_CALS4       MKG----PLLIHVVTKKGKGYMFAEKRP-DKFHS-AAPFDIETGKFV-----G----EGK
DXS_BUCAI       KKG----TYLLHLVTKKGKGYLPAELNPIK-WHT-ISSRDSSVSKSL-------------
DXS_WIGBR       KKG----PNILHVITKKGMGYAPAEKDPIG-WHA-VPKFNLQIGIPP-----KK--QNSL
DXS_ECOL6       LKG----PQFLHIMTKKGRGYEPAEKDPIT-FHA-VPKFDPSSGCLP-----KS--SGGL
DXS_ECO57       LKG----PQFLHIMTKKGRGYEPAEKDPIT-FHA-VPKFDPSSGCLP-----KS--SGGL
DXS_ECOLI       LKG----PQFLHIMTKKGRGYEPAEKDPIT-FHA-VPKFDPSSGCLP-----KS--SGGL
DXS_SALTI       LKG----PQFLHIMTKKGRGYEPAEKDPIT-FHA-VPKFDPSSGCLP-----KS--SGGL
DXS_SALTY       LKG----PQFLHIMTKKGRGYEPAEKDPIT-FHA-VPKFDPSSGCLP-----KS--SGGL
DXS_YERPE       LKS----PQLLHIMTKKGKGYAPAEKDPIG-WHA-VPKFDPASGTLP-----KS--QSSL
DXS_VIBCH       LKG----PQFLHVMTKKGKGYAPAEKDPIG-YHG-VPKFDPSHHSLP-----KS--SNTK
DXS_VIBVU       LKG----PQFLHIMTKKGKGYEPAEKDPIG-YHG-VPKFDPAHNSLP-----KS--SGGK
DXS_HAEIN       LKG----PQFLHIKTKKGKGYAPAEKDPIG-FHG-VPKFDPISGELP-----KN--N-SK
DXS_PASMU       LKG----PQFLHIMTKKGKGYAPAEKDPIG-FHG-VPKFDHLSGQLP-----KS--N-TT
DXS_SHEON       LKG----PQVLHIMTKKGRGYEPAEKDPIG-WHA-VPKFDPSLFKKP-----AT--KPGL
DXS_NEIMA       RKG----PQLLHVITKKGNGYKLAENDPVK-YHA-VANLPKESAAQMPSEKEPK--PAAK
DXS_NEIMB       RKG----PQLLHVITKKGNGYKLAENDPVK-YHA-VANLPKESAAQMPSEKEPK--PAAK
DXS_XANAC       LKG----PQLLHVITTKGKGYELAEGDQIG-YHA-VGPFDPSKGLVA-----KT--GAKK
DXS_XANCP       LKG----PQLLHVITTKGKGYELAEGDQIG-YHA-VGPFDPSKGLVA-----KA--GAKK
DXS_XYLFA       LKG----PQLLHVITTKGKGYELAEGDQIG-YHA-VAPFDPQKGLI------KA--GAKK
DXS_PSEAE       MKG----PQFLHVVTKKGKGFAPAELDPIG-YHA-ITKLEAPGSAPK-----KT--GG--
DXS_RALSO       RALEGGRPQFLHVVTKKGQGYKLAEADPIL-YHG-PGKFNPQEGIKP-----AA--RPAK
DXS_AQUAE       IKG----PVLLHVYTKKGKGYKPAEENPVK-WHG-VAPYKVESGEIIK----KS--SP--
DXS_COREF       FKG----PIIVHVVTEKGRGYAPAERDLDELMHA-TGVMDPRTGIPV-----AA--S--K
DXS_CORGL       YDG----PIIVHMVTEKGRGYAPAEQDLDELMHS-TGVIDPLTGAPK-----SA--S--K
DXS_MYCLE       FGG----PVIVHVVTRKGMGYPPAEADQAEQMHT-CGVMDPTTGQPT-----KI--A--A
DXS_MYCTU       FGA----PVIVHVVTRKGMGYPPAEADQAEQMHS-TVPIDPATGQAT-----KV--A--G
DXS2_KITGR      FGG----PVIVHCITEKGRGYHAAENNDEDRFHA-VGVIHPDTGLPV-----KT--S--G
DXS2_STRCO      FGG----PVIVHCLTEKGRGYQPALQDEADRFHA-VGKIHPDTGLPI-----ST--S--G
DXS_STRC1       FHG----PVLVHCLTVKGRGYEPALAHEEDHFHT-VGVMDPLTCEPL-----SP--TD-G
DXS1_STRCO      FHG----PVLVHCLTEKGRGYEPALRDEEDHFHT-VGVMDPLTCEPL-----GP--AG-G
DXS1_KITGR      FGG----PVIVHCLTVKGRGYRPAEQDEADRFHA-VNPIDPYTCLPI-----SP--SA-G
DXS_TREPA       LTR----PTLLHVQTVKGKGYPFAEQNPTD-FHG-VGPFNLAEGIVE-----KK--D--A
DXS_DEIRA       LDG----PTILHIVTTKGKGLSYAEADPIY-WHG-PAKFDPATGEYV-----PS--S--A
DXS_THEMA       YDY----SSVVHVVTKKGKGFTAAEENP-TKYHS----ASP-SGKPK-------------
DXS_LEPIN       MKG----PILLHIITQKGKGYDPAERDPIK-YHG-VTPFRKEDGAMD------S--GDTS
DXS_FUSNN       LKG----PTILLVKTEKGKGYCFAEEDKEK-FHG-IAPFNIETGNTY-----------KS
DXS_MYCPE       IVPF--GPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-------------
                       . ..   * ** *   *        *                           

DXS_CHLMU       PSSFPQHVGHILCQLGEKHPRLQVVTPAMSLGSCLEDFRKQFPDRFTDVGIAEGHAVTFS
DXS_CHLTR       PISFPQHAGNILCRLGKKYPQLQVVTPAMSLGSCLEDFRKQFPDRFTDVGIAEGHAVTFS
DXS_CHLPN       KPSFPDIFGQTLCELGEVSSRLHVVTPAMSIGSRLEGFKQKFPERFFDVGIAEGHAVTFS
DXS_HELPY       ILSPTEAYSNTLLELAKKDEKIVGVTAAMPSGTGLDKLIDAYPLRFFDVAIAEQHALTSS
DXS_HELPJ       TLSPTEAYSNTLLELAKKDEKIVGVTAAMPSGTGLDKLIDAYPLRFFDVAIAEQHALTSS
DXS_CAMJE       KKSATEIFSKNLLDLASKYENIVGVTAAMPSGTGLDKLIEKYPNRFWDVAIAEQHAVTSM
DXS_AGRFC       P-SYTSVFAEALIQEATLDEKIIGVTAAMPNGTGLDKMAELFPSRTFDVGIAEQHAVTFA
DXS_RHIME       P-AYTSVFADALTQEASLDDKIVAITAAMPSGTGLDKFASVHPSRCFDVGIAEQHAVTFA
DXS_RHILO       P-AYTKVFAESLIREAREDDRIVAVTAAMPSGTGLDLFGEVFPSRTFDVGIAEQHAVTFA
DXS_BRUME       P-SYTKIFGTSLIEEARHDDKIVAVTAAMPTGTGLDLFGEAFPKRVFDVGIAEQHAVTFA
DXS_BRUSU       P-SYTKIFGTSLIEEARHDDKIVAVTAAMPTGTGLDLFGEAFPKRVFDVGIAEQHAVTFA
DXS_CAUVC       P-SYTKVFAQELIKQAEKDDKIVAITAAMPSGTGLDLFGKAFPERTFDVGIAEQHAVTFA
DXS_RHOCA       P-NYTAVFGERLTEEAARDQAIVAVTAAMPTGTGLDIMQKRFPRRVFDVGIAEQHAVTFA
DXS_CHLTE       P-KYQEVFGEALVELALKDPTITAITAAMPSGTSLDLFQQAIPSRCFDVGIAEQHAVTFA
DXS_NOSS1       PPAYAKVFSHTLVKLAEQNPKIIGITAAMATGTGLDKLQAKLPNQYIDVGIAEQHAVTLA
DXS_THEEB       PPSYSKVFGETLTKLAENDPRIVGITAAMATGTGLDILQKRVPKQYIDVGIAEQHAVTMA
DXS_SYNY3       PPSYSKVFAHTLTTLAKENPNIVGITAAMATGTGLDKLQAKLPKQYVDVGIAEQHAVTLA
DXS_SYNP6       PPSHSKVFGQTLTTLAKSDRRIVGITAAMATGTGLDILQKALPKQYIDVGIAEQHAVVLA
DXS_SYNE7       PPSYSKVFGQTLTTLAKSDRRIVGITAAMATGTGLDILQKALPKQYIDVGIAEQHAVVLA
DXS_BACHD       P-SYSGVFAETLKKIARNDPRIVALTAAMPGGTKLDQFAKEFPDRMFDVGIAEQHATTMA
DXS_BACSU       P-SWSGLVSGTVQRMAREDGRIVAITPAMPVGSKLEGFAKEFPDRMFDVGIAEQHAATMA
DXS_LISIN       A-SWSSVISNELMRLAANDERIVAITPAMPVGSKLEKFAKTFPERFFDVGIAEQHATTMA
DXS_CLOAB       D-TYSKAFGKAMVQMAENNDKIVAITAAMTDGTGLCEFSKKFPQRFFDVGISEQHAVTMA
DXS_CLOPE       R-NYSSTFGEEMIKLAKNDDKVVAITAAMPDGTGLKDFREEFPDRFFDVGIAEQHAVTLA
DXS_CALS4       D-SYSDVFGKTLAEMALKDEKIVAITAAMPEGTGLIHFAKLIPDRFFDVGIAEQHATTFA
DXS_BUCAI       --SYSDVFGTWLCEIAAFDKKLIAITPAMCEGSGMVKFSRLFPNQYFDVAIAEQHAVTFA
DXS_WIGBR       N-TYSSIFGKWLCDTAKKDKKLIAITPAMREGSGLVNFSKMYPNQYFDVAIAEQHAVTFA
DXS_ECOL6       P-SYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFA
DXS_ECO57       P-SYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFA
DXS_ECOLI       P-SYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFA
DXS_SALTI       P-GYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFA
DXS_SALTY       P-GYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFA
DXS_YERPE       P-TYSKIFGEWLCETAAKDSKLMAVTPAMREGSGMVRFSREYPQQYFDVAIAEQHAVTFA
DXS_VIBCH       P-TFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLA
DXS_VIBVU       P-SFSNIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPEQYFDVAIAEQHAVTLA
DXS_HAEIN       P-TYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRFPKQYFDVAIAEQHAVTFA
DXS_PASMU       P-TYSKIFGDWLCEMAENDPKLIGITPAMREGSGMVEFSNRFPQQYFDVAIAEQHAVTFA
DXS_SHEON       P-TFSQVFGKWLCDIAEQDEKVLGITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLG
DXS_NEIMA       P-TYTQVFGKWLCDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFA
DXS_NEIMB       P-TYTQVFGKWLCDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFA
DXS_XANAC       P-TYTDVFSDWVCDMAAAEPKLLVITPAMREGSGLVRFSKQYPQRYFDVAIAEQHAVTLA
DXS_XANCP       P-TYTDVFSDWVCDMAAADPKMLVITPAMREGSGLVRFSKEYPQRYFDVAIAEQHAVTLA
DXS_XYLFA       Q-TYTDVFSEWLCDMAAVEPRLLAITPAMREGSGLVRFSQEYPQRYFDVAIAEQHAITLA
DXS_PSEAE       P-KYSSVFGQWLCDMAAQDARLLGITPAMKEGSDLVAFSERYPERYFDVAIAEQHAVTLA
DXS_RALSO       V-SYTQVFGQWLCDMAAADKRLVGITPAMREGSGMVEFEQRFPDRYYDVGIAEQHAVTFA
DXS_AQUAE       P-TWTSVFGKALVELAERDEKIVAITPAMREGSGLVEFAKRFPDRFFDVGIAEQHACTFA
DXS_COREF       P-GWTAAFSEELVKLGGRREDIVAITAAMAGPTGLAKFAANFPSRFYDVGIAEQHALTSA
DXS_CORGL       P-GWTSVFSDELVKIGAQNENVVAITAAMAGPTGLSKFEANFPNRFFDVGIAEQHAVTSA
DXS_MYCLE       P-DWTAIFSDALIGYAMKRRDIVAITAAMPGPTGLTAFGQCFPDRLFDVGIAEQHAMTSA
DXS_MYCTU       P-GWTATFSDALIGYAQKRRDIVAITAAMPGPTGLTAFGQRFPDRLFDVGIAEQHAMTSA
DXS2_KITGR      K-DWTSVFGEEMVALGRERRDLVAITAAMLHPVGLAPFAKAYPERIFDVGIAEQHAAVCA
DXS2_STRCO      A-DWTSVFGDEMLKLGKEREDVVAITAAMLQPVGLDKFAKAFPDRVYDVGIAEQHGAVSA
DXS_STRC1       P-SWTSVFGDEIVRIGAEREDIVAITAAMLHPVGLARFADRFPDRVWDVGIAEQHAAVSA
DXS1_STRCO      P-SWTSVFGEEIVRIGEERADVVAITAAMLHPVGLAPFAERFPDRVWDVGIAEQHAAVSA
DXS1_KITGR      A-SWTSVFGKEMLALGAERPELVAVTAAMLHPVGLGPFAKAYPGRTFDVGIAEQHAVASA
DXS_TREPA       L-TFTEAFSHTLLNAARTDDRVVAITAAMTGGTGLGLFSHIYPERFFDVGIAEQHAVTFA
DXS_DEIRA       Y-SWSAAFGEAVTEWAKTDPRTFVVTPAMREGSGLVEFSRVHPHRYLDVGIAEEVAVTTA
DXS_THEMA       MLSYSELLGHTLSRVAREDKKIVAITAAMADGTGLSIFQKEHPDRFFDLGITEQTCVTFG
DXS_LEPIN       KIAYSKIVGKMLAILTETNPKIAAITPAMIEGSGLKEYAEKYPEHLFDVGIAEQHSVAFA
DXS_FUSNN       LVSYSEVFGNKILELGKEDENIYTLSAAMIKGTGLHKFSEEFPERCIDTGIAEGFTVTLA
DXS_MYCPE       --TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKA
                        .  :            :..**     :       * .  * .*:*    .  

DXS_CHLMU       AGIARSGTPVVCSIYSTFLNRAMDNVFHDVCMQELPVIFAIDRAGLAFHDGRSHHGIYDL
DXS_CHLTR       AGIARSGTPVCCSIYSTFLHRAMDNVFHDVCMQELPVIFAIDRAGLAFHDGRSHHGIYDL
DXS_CHLPN       AGIAKAGNPVICSIYSTFLHRALDNVFHDVCMQDLPVIFAIDRAGLAYGDGRSHHGIYDM
DXS_HELPY       SAMAKEGFKPFVSIYSTFLQRAYDSIVHDACISSLPIKLAIDRAGIVGEDGETHQGLLDV
DXS_HELPJ       SAMAKEGFKPFVSIYSTFLQRAYDSIVHDACISSLPIKLAIDRAGIVGEDGETHQGLLDV
DXS_CAMJE       AAMAKEGFKPFIAIYSTFLQRAYDQVIHDCAIMNLNVVFAMDRAGIVGEDGETHQGVFDL
DXS_AGRFC       AGLAADGYKPFCALYSTFLQRGYDQLVHDVAIQSLPVRFPIDRAGFVGADGPTHAGSFDT
DXS_RHIME       AGLAAEGYKPFAALYSTFLQRAYDQVVHDVAIQGLPVRFPIDRAGFVGADGPTHAGSFDT
DXS_RHILO       AGLATEGYKPFAAIYSTFLQRAYDQVVHDVAIQKLPVRFPIDRAGFVGADGATHCGAFDT
DXS_BRUME       AGLASEGYKPFCAIYSTFLQRGYDQVVHDVSIQNLPVRFPIDRAGLVGADGPTHAGSFDT
DXS_BRUSU       AGLASEGYKPFCAIYSTFLQRGYDQVVHDVSIQNLPVRFPIDRAGLVGADGPTHAGSFDT
DXS_CAUVC       AGMAADGMKPFAAIYSTFLQRGYDQVVHDVAIQGLPVRFAMDRAGLVGADGPTHAGSFDI
DXS_RHOCA       AGMAAAGLKPFLALYSSFVQRGYDQLVHDVALQNLPVRLMIDRAGLVGQDGATHAGAFDV
DXS_CHLTE       AGLACGGFKPVFAVYSTFLQRAYDQLIHDVALQNLHVVFAIDRAGLVGEDGPTHHGAFDL
DXS_NOSS1       AGLATEGMRPVAAIYSTFLQRAYDQIIHDVCIQNLPVFFCLDRAGIVGSDGPTHQGMYDI
DXS_THEEB       AGMATQGMRPVAAIYSTFLQRAYDQIVHDVCIQKLPVFFCMDRAGIVGADGPTHQGMYDI
DXS_SYNY3       AGMACEGIRPVVAIYSTFLQRGYDQIIHDVCIQKLPVFFCLDRAGIVGADGPTHQGMYDI
DXS_SYNP6       AGMACDGMRPVVAIYSTFLQRAFDQVIHDVCIQKLPVFFCLDRAGIVGADGPTHQGMYDI
DXS_SYNE7       AGMACDGMRPVVAIYSTFLQRAFDQVIHDVCIQKLPVFFCLDRAGIVGADGPTHQGMYDI
DXS_BACHD       GGLATQGLKPVFAVYSTFLQRGYDQVVHDICRQNLNVFFAIDRAGLVGADGETHQGVFDI
DXS_BACSU       AAMAMQGMKPFLAIYSTFLQRAYDQVVHDICRQNANVFIGIDRAGLVGADGETHQGVFDI
DXS_LISIN       AGLATQAMKPFLAIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDI
DXS_CLOAB       AGLAATGYKPVFAVYSTFLQRAYDQVLHDVCIQKLPVVFAIDRAGIVGEDGETHQGVFDI
DXS_CLOPE       AGMAAEGLKPFFAVYSTFLQRAYDQVLHDVCIQKLPVTLCLDRAGLVGEDGETHQGIFDI
DXS_CALS4       AGLAVEGYKPYFAVYSTFLQRAYDQVIHDVCIQKLPVVFAVDRAGIVGEDGETHQGVFDI
DXS_BUCAI       AGLAISGYKPVVSIYSTFFQRAYDQLIHDIALQKLSVLFAVDRAGIVGNDGQTHQGVFDL
DXS_WIGBR       AGLAIGGYKPIVAIYSTFLQRAYDQIIHDIAIQKLPVLFAIDRAGIVGPDGPTHQGFLDL
DXS_ECOL6       AGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDL
DXS_ECO57       AGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDL
DXS_ECOLI       AGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDL
DXS_SALTI       AGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDL
DXS_SALTY       AGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDL
DXS_YERPE       AGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRGGLVGADGQTHQGAFDL
DXS_VIBCH       TGMAIAGYHPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGIVGADGQTHQGAFDL
DXS_VIBVU       TGMAIGGYNPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGLVGADGQTHQGAFDL
DXS_HAEIN       TGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDI
DXS_PASMU       AGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQNLPVLFAIDRAGVVGADGQTHQGAFDI
DXS_SHEON       AGFACEGYKPVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDRGGIVGADGPTHQGAFDL
DXS_NEIMA       GGLACEGMKPVVAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDL
DXS_NEIMB       GGLACEGMKPVVAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDL
DXS_XANAC       AGMATQGAKPVVAIYSTFLQRGYDQLVHDVAVQQLDVLFAIDRGGVVGPDGATHAGNLDL
DXS_XANCP       AGMATQGAKPVVAIYSTFLQRGYDQLVHDVAVQKLDVLFAIDRGGVVGPDGATHAGNLDL
DXS_XYLFA       AGMATQGAKPVVAIYSTFLQRGYDQLVHDVALQKLDVLFAVDRGGVVGPDGATHAGNLDL
DXS_PSEAE       AGMACEGMKPVVAIYSTFLQRAYDQLIHDVAVQHLDVLFAIDRAGLVGEDGPTHAGSFDI
DXS_RALSO       GGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDM
DXS_AQUAE       AGLAAEGLRPVAAYYSTFLQRAYDQVIHDVALQNLPVTFAIDRAGLVGDDGPTHHGVFDL
DXS_COREF       AGLALAGKHPVVAIYSTFLNRAFDQLLMDVALLNLPVTVVLDRSGVTGSDGASHNGVWDL
DXS_CORGL       AGLALGGKHPVVAIYSTFLNRAFDQLLMDVGMLNQPVTLVLDRSGVTGSDGASHNGVWDM
DXS_MYCLE       AGLAMGRMHPVVAIYSTFLNRAFDQIMMDVALHKLPVTMVIDRAGITGSDGPSHNGMWDL
DXS_MYCTU       AGLAMGGLHPVVAIYSTFLNRAFDQIMMDVALHKLPVTMVLDRAGITGSDGASHNGMWDL
DXS2_KITGR      AGLATNGLHPVVAVYATFLNRAFDQVLMDVALHKLGVTFVLDRAGVTGTDGASHNGMWDM
DXS2_STRCO      AGLAHGGVHPVFAVYATFLNRAFDQVLMDVALHKCGVTFVLDRAGVTGTDGASHNGMWDM
DXS_STRC1       AGLATGGLHPVVAVYATFLNRAFDQLLMDVALHRCGVTFVLDRAGVTGVDGASHNGMWDM
DXS1_STRCO      AGLATGGLHPVVAVYATFLNRAFDQLLMDVALHRCGVTFVLDRAGVTGVDGASHNGMWDM
DXS1_KITGR      AGLATGGLHPVVAVYATFLNRAFDQVLMDVALHRLGVTFVLDRAGVTGNDGASHNGMWDL
DXS_TREPA       AGLACAGVKPVVAVYSTFLQRAVDQVIHDVAVQNLPVIFALDRAGAVPHDGETHQGLFDL
DXS_DEIRA       AGMALQGMRPVVAIYSTFLQRAYDQVLHDVAIEHLNVTFCIDRAGIVGADGATHNGVFDL
DXS_THEMA       AALGLHGMKPVVAIYSTFLQRAYDQIIHDVALQNAPVLFAIDRSGVVGEDGPTHHGLFDI
DXS_LEPIN       GAMTNGNIIPYMCIYSTFLTRAMDQLVQDVSLMNLPVRFVIDRAGCVGPDGETHQGLFDL
DXS_FUSNN       AGLAKSGKKPYVCIYSTFIQRAISQLIHDVSIQNLPVRFIIDRSGIVGEDGKTHNGIYDL
DXS_MYCPE       AGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDI
                 .:         . *::*. *. ..:. *       : . :** .    ** :* *  * 

DXS_CHLMU       GFLCSMPNMVVCQPRNASVLERLLFSSLLWK-SPCAIRYPNLSTRKEVSNP--SFSPIFP
DXS_CHLTR       GFLCSMPNMVICQPRNALVLERLFFSSLLWK-SPCAIRYPNIPANEKASNSFFPFSPILP
DXS_CHLPN       SFLRAMPQMIICQPRSQVVFQQLLYSSLHWS-SPSAIRYPNIPAPHGDPLTGDPNFLRSP
DXS_HELPY       SYLRSIPNMVIFAPRDNETLKNAVRFANEHDSSPCAFRYPRGSFALKEGV--FEPSGFVL
DXS_HELPJ       SYLRSIPNMVIFAPRDNETLKNAVYFANEHDSSPCAFRYPRGSFALKEGV--FEPSGFVL
DXS_CAMJE       SFLAPLPNFTLLAPRDEQMMQNIMEYAYLHQG-PIALRYPRGSFILDKE---FNPCEIKL
DXS_AGRFC       TFLATLPGMVVMAAADEAELKHMVRTAAAYDEGPISFRYPRGEGVGVEMP--ARGEILQI
DXS_RHIME       TYLATLPGFVVMAAADEAELKHMVRTAAAYDEGPISFRYPRGEGVGVELP--ERGEILAI
DXS_RHILO       TFLASLPGFVVMAAADEAELRHMVRTAAAYDDGPIAFRYPRGNGVGVDMP--ERGEVLEL
DXS_BRUME       GFLAALPGFVVMAASDEAELRHMVRTAAEYDEGPISFRYPRGDGVGVDLP--ERGSVLEI
DXS_BRUSU       GFLAALPGFVVMAASDEAELRHMVRTAAEYDEGPISFRYPRGDGVGVDLP--ERGSVLEI
DXS_CAUVC       GFMGALPGMVLMAAADEVELARMVATAAEIDDRPSAFRYPRGEGLGLDMP--AIAEPLEI
DXS_RHOCA       SMLANLPNFTVMAAADEAELCHMVVTAAAHDSGPIALRYPRGEGRGVEMP--ERGEVLEI
DXS_CHLTE       SYLNVVPNLTIMAPGDEQELRNMLYTALYDIKGPVAIRYPRGSGSGATLH--KEFTPVPV
DXS_NOSS1       AYLRCIPNIVMMAPKDEAEMQRMVVTGIEHTTGPIAMRFPRGNGYGVPLME-EGWEPLEI
DXS_THEEB       AYLRCLPNMVLMAPKDEAELQRMIVTGINYTDGPIALRYPRGNGYGVALME-EGWEPLEI
DXS_SYNY3       AYLRCIPNLVLMAPKDEAELQQMLVTGVNYTGGAIAMRYPRGNGIGVPLME-EGWEPLEI
DXS_SYNP6       AYLRLIPNMVLMAPKDEAELQRMLVTGIEY-DGPIAMRFPRGNGIGVPLPE-EGWESLPI
DXS_SYNE7       AYLRLIPNMVLMAPKDEAELQRMLVTGIEY-DGPIAMRFPRGNGIGVPLPE-EGWESLPI
DXS_BACHD       AYLRHLPNMKILMPKDENELQHMVYTAIQYEGGPIAVRYPRGNGYGIKMDE-V-LKEIPI
DXS_BACSU       AFMRHIPNMVLMMPKDENEGQHMVHTALSYDEGPIAMRFPRGNGLGVKMDE-Q-LKTIPI
DXS_LISIN       SFLNSIPNMIITMPKDEEEARQLMDTAFAYDDGPFAIRYPRGNGPGKELSE-S-SKLIPI
DXS_CLOAB       SYLSSIPNMTIMAPKCVEELNYIMNWAVKQNY-PIAVRYPKGGNDISDVLA-P-LKEFRH
DXS_CLOPE       SFLSPMPNMTIVAPKCIDEMEVILKWASNFNA-PLAIRYPRGG-DIDVNLK-P-LSKIEY
DXS_CALS4       SFLRAIPNIAIMSPKDANELVEMVKLSRNLDF-PVAIRYPRGK-AGEYDIS-R-KPSFPL
DXS_BUCAI       AYLRCIPGIVIMTPSNENECRQMLYTGYMHNKGPSVVRYPKGYGVGELL---MPMNRIPI
DXS_WIGBR       SYLRCIPNMIIMTPSDENECRLMLHTGYQQ-LGPSAVRYPRGYGIGVKF---SNLYKIPL
DXS_ECOL6       SYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVEL---TPLEKLPI
DXS_ECO57       SYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVEL---TPLEKLPI
DXS_ECOLI       SYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVEL---TPLEKLPI
DXS_SALTI       SYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVAL---TPLEKLPI
DXS_SALTY       SYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVAL---TPLEKLPI
DXS_YERPE       SFMRCIPNMVIMAPSDENECRQMLYTGYHHN-GPAAVRYPRGNGTSAVL---EPLEMLPI
DXS_VIBCH       SYMRCIPNMLIMAPADENECRQMLYTGHQHQ-GPSAVRYPRGNGMGVELE--SSFTALEI
DXS_VIBVU       SYMRCIPNMVIMAPSDENECRQMLYTGHKHQ-GPSAVRYPRGNGMGTPIE--SEFTALEI
DXS_HAEIN       SFMRCIPNMIIMTPSDENECRQMLYTGYQCG-KPAAVRYPRGNAVGVKL---TPLEMLPI
DXS_PASMU       SFLRCIPNMVIMTPSDENECRQMLYTGYKLN-QPAAVRYPRGNAIGVEL---TPLTMLAL
DXS_SHEON       SFMRCIPNMVIMAPSDENECRQMLYTGYCYDAGPSAVRYPRGSATGATQV--EAMTALPI
DXS_NEIMA       SFLRCIPNMIVAAPSDENECRLLLSTCYQAD-APAAVRYPRGTGTGVPVS--DGMETVEI
DXS_NEIMB       SFLRCVPNMIVAAPSDENECRLLLSTCYQAD-APAAVRYPRGTGTGAPVS--DGMETVEI
DXS_XANAC       SFLRCVPHMVVMAPADEAECRQMLSTGVQYQ-GPAAVRYPRGTGPGAALD--ASLATLPI
DXS_XANCP       SFLRCVPHMVVMAPADEAECRQMLTTGLRYE-GPAAVRYPRGTGPGTALD--AALTTLPI
DXS_XYLFA       SFLRCVPNMMLMAPADEAECRKMLSTGFHYS-GPVAVRYPRGTGPGVVPS--AELDVLPV
DXS_PSEAE       SYLRCIPGMLVMTPSDEDELRKLLTTGYLFD-GPAAVRYPRGSGPNHPID--PDLQPVEI
DXS_RALSO       AYLRCIPNMMVMAPADENECRQLLSTAFAQD-CPTAVRYPRGAGTGVVVQ--PTLEPLPV
DXS_AQUAE       SYLRCVPNMVVCAPKDEQELRDLLYTGIYSG-KPFALRYPRGAAYGVPT---EGFKKIEI
DXS_COREF       ALTSIVPGIRVAAPRDEDTLRELLGEAVDINDGPSVVRFPKGDLPAPIE---AIETL-ED
DXS_CORGL       ALTSIVPGVQVAAPRDEDSLRELLNEAISIDDGPTVVRFPKGDLPTPIV---AIDTL-ED
DXS_MYCLE       SMLGIVPGMRVAAPRDAIRLREELGEALDVDDGPTAIRFPKGDVCEDIP---ALKR--RS
DXS_MYCTU       SMLGIVPGIRVAAPRDATRLREELGEALDVDDGPTALRFPKGDVGEDIS---ALER--RG
DXS2_KITGR      SILQVVPGLRLAAPRDAEQVRLQLREAVEVADAPTVVRYSKGNVGPAVP---AVGT--VG
DXS2_STRCO      SILQVVPGLRLAAPRDADQVRAQLREAVVVDDAPTVVRFSKGAVGPAVP---AVGR--VG
DXS_STRC1       SVLQVVPGLRIAAPRDADHVRAQLREAVAVDDAPTLIRFPKESVGPRIP---ALDR--VG
DXS1_STRCO      SVLQVVPGLRIAAPRDADQLRTQLREAVAVDDAPTLLRFPKESVGPAVP---AVDR--IG
DXS1_KITGR      SVLQVVPGLRIAAPRDAARVREHVRQAVAVEDAPTVVRFPKGELGPEAP---AIER--IG
DXS_TREPA       SILRAVPNINILCPASAHELSLLFGWALAQ-DTPVAIRYPKALCPPEED---GFSTPVHT
DXS_DEIRA       SFLRSIPGVRIGLPKDAAELRGMLKYAQTH-DGPFAIRYPRGNTAQVPA---GTWPDLKW
DXS_THEMA       NYLLPVPNMKIISPSSPEEFVNSLYTVLKHLDGPVAIRYPKESFYGEVESLLENMKEIDL
DXS_LEPIN       GYLLGLPNMDVFVPSNGQDLIDALRWMEKYDKSPVAIRFPKSS-VDLKTLDFYKETELQP
DXS_FUSNN       SFFLSIQNFTVLCPTTAKELGQALEISKNFNLGPLVIRIPRDSIFDIEN-----EEPLEI
DXS_MYCPE       GFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV-----KKEFSF
                     :    :  .         .         .  .* ..                   

DXS_CHLMU       GEAEVLCQ-----------GDDLLLIALGHMCDTALAVKEQLLD-HGISTTVVDPIFIKP
DXS_CHLTR       GEAEILCQ-----------GDDLLLIALGHMCNTALTVKEHLLD-YGISTTVVDPIFIKP
DXS_CHLPN       GNAETLSQ-----------GEDVLIIALGTLCFTALSIKHQLLA-YGISATVVDPIFIKP
DXS_HELPY       GQSE-LLKK----------EGEILLIGYGNGVGRAHLVQLALKE-KNIECALLDLRFLKP
DXS_HELPJ       GRSE-LLKK----------EGEILLIGYGNGVGRAHLVQLALKE-KNIECALLDLRFLKP
DXS_CAMJE       GKAQWLVKN----------NSEIAFLGYGQGVAKAWQVLRALQE-MNNNANLIDLIFAKP
DXS_AGRFC       GKGR-IIKE----------GTKVALLSFGTRLAECLAAAEDLDA-AGLSTTVADARFAKP
DXS_RHIME       GKGR-IVKQ----------GNKVALLSFGTRLADCLLAAEDLDA-AGLSTTVADARFAKP
DXS_RHILO       GKGR-VVRE----------GSKVALLSFGTRLQDCLIAAEELGA-AGLSTTVADARFAKP
DXS_BRUME       GKGR-IVRE----------GTKVALLSFGTRLQECLAAAEELGA-AGLSTTVADARFAKP
DXS_BRUSU       GKGR-IVRE----------GTKVALLSFGTRLQECLAAAEELGA-AGLSTTVADARFAKP
DXS_CAUVC       GKGR-IVRE----------GTSVAIVSFGTRLSESLKAADLLAA-RGLSATVCDARFAKP
DXS_RHOCA       GKGR-VMTE----------GTEVAILSFGAHLAQALKAAEMLEA-EGVSTTVADARFCRP
DXS_CHLTE       GRGR-ILRD----------GKSVALLGIGTMSNRALETAALLEA-AGLDPLVCDMRFLKP
DXS_NOSS1       GKGE-ILRN----------GDDVLIIGYGTMVYPSMQAAEILSE-HGIEATVINARFVKP
DXS_THEEB       GKGE-LLRS----------GEDLLLVAYGSMVYPAMQVAEILKE-HGMSAAVINARFAKP
DXS_SYNY3       GKAE-ILRS----------GDDVLLLGYGSMVYPALQTAELLHE-HGIEATVVNARFVKP
DXS_SYNP6       GKAE-QLRQ----------GDDLLMLAYGSMVYPALQTAELLNE-HGISATVINARFAKP
DXS_SYNE7       GKAE-QLRQ----------GDDLLMLAYGSMVYPALQTAELLNE-HGISATVINARFAKP
DXS_BACHD       GSWE-VLQE----------GTDACILTFGTMIPVAEQASKELSQ-QGYSIRLINARSVKP
DXS_BACSU       GTWE-VLRP----------GNDAVILTFGTTIEMAIEAAEELQK-EGLSVRVVNARFIKP
DXS_LISIN       GEWE-TIIQ----------PVDAVILTFGPTLEQALKAAEQLED-LGQRVGVINARFIKP
DXS_CLOAB       GKWE-ILKD----------GKDVAIVAVGKMVQRAMVVRDELLK-YGIDCAIINATFIKP
DXS_CLOPE       GKWE-KVQE----------GEKIAIVATGKMVQHAMIAAQKIKEEKNIDILIINATFIKP
DXS_CALS4       GKGE-VLLE----------GEKIAVFALGRMVSKSIDAAEILKG-HGINPFVVNLRFVKP
DXS_BUCAI       GKSL-IKRR----------GKKIAILNFGILLHNAYCAAEKL------DATLVDMRFVKP
DXS_WIGBR       GKGI-VLRK----------GKKIAILNFGVLLIQANIVAKEL------DATLVDMRFVKP
DXS_ECOL6       GKGI-VKRR----------GEKLAILNFGTLMPEAAKVAESL------NATLVDMRFVKP
DXS_ECO57       GKGI-VKRR----------GEKLAILNFGTLMPEAAKVAESL------NATLVDMRFVKP
DXS_ECOLI       GKGI-VKRR----------GEKLAILNFGTLMPEAAKVAESL------NATLVDMRFVKP
DXS_SALTI       GKGL-VKRH----------GEKLAILNFGTLMPEAAKVAEAL------NATLVDMRFVKP
DXS_SALTY       GKGL-VKRH----------GEKLAILNFGTLMPEAAKVAEAL------NATLVDMRFVKP
DXS_YERPE       GKGV-LRRE----------GEKIAILCFGTLLAQAQLAAENL------NATLVDMRFVKP
DXS_VIBCH       GKGR-LMRESTA-----CEGEKVAILSFGTLLPNALQAAEKL------NATVADMRFVKP
DXS_VIBVU       GKGR-LVRQ----------GEKVAILSFGTFLANALEAAEAL------NATVADMRFVKP
DXS_HAEIN       GKSR-LIRK----------GQKIAILNFGTLLPSALELSEKL------NATVVDMRFVKP
DXS_PASMU       GKSN-LIRE----------GEKIAILNFGTLLPTAINVAEKL------NATVIDMRFVKP
DXS_SHEON       GKGV-IKRL----------GKRIALLNFGTTLAAALTAAESL------DATVVDMRFVKP
DXS_NEIMA       GKGI-IRRE----------GEKTAFIAFGSMVAPALAVAGKL------NATVADMRFVKP
DXS_NEIMB       GKGI-IRRE----------GEKTAFIAFGSMVAPALAVAEKL------NATVADMRFVKP
DXS_XANAC       GKAQ-LRHS----------GTRIALLGFGATVDAAEAVGREL------GLTVVNMRFVKP
DXS_XANCP       GKAQ-LRHS----------GARIALLGFGATVDAAEAVGREL------GLTVVNMRFVKP
DXS_XYLFA       GVAQ-LRHS----------GTRIALLGFGVCVAPAEQVGRRL------GLTVVNMRFIKP
DXS_PSEAE       GKGV-VRRR----------GGRVALLVFGVQLAEAMKVAESL------DATVVDMRFVKP
DXS_RALSO       GKAE-VRRASTA-----PAGQRVVILAFGSMVAPAAAAAERL------DATVVNMRFVKP
DXS_AQUAE       GTWE-ELLE----------GEDCVILAVGYPVYQALRAAEKLYK-EGIRVGVVNARFVKP
DXS_COREF       GVDI-LAYLEAS--PASEDAPDLLIVAVGERATLALELGERLVA-AGANVTVVDPRWVIP
DXS_CORGL       GVDV-LAYEDATDVESTDDAPSVLIIAVGERATVALDVASRIKQ-HGVNVTVVDPRWIVP
DXS_MYCLE       GVDV-LAV------PATGLAQDVLLVGVGVFASMALAVAKRLHN-QGIGVTVIDPRWVLP
DXS_MYCTU       GVDV-LAA------PADGLNHDVLLVAIGAFAPMALAVAKRLHN-QGIGVTVIDPRWVLP
DXS2_KITGR      GMDV-LRRPEAD---SADEAADVLIVSIGAMAPTCLEAAELLAQ-QGISSTVVDPRWVKP
DXS2_STRCO      GMDV-LRAP-------GTGTPDVLLVSVGALAPMCLEVADLLNK-QGISTTVVDPRWVKP
DXS_STRC1       GLDV-LHRD---------ERPEVLLVAVGVMAQVCLQTAELLRA-RGIGCTVVDPRWVKP
DXS1_STRCO      GLDV-LHTA---------DRSEVLLVAVGVMAPVCLGAAELLEA-RGIGCTVVDPRWVKP
DXS1_KITGR      GVDV-LART--------GPAPDVLLVAVGPMAAACLDAAALLAA-DGITATVVDPCWVKP
DXS_TREPA       GRGV-LITR--------ENECNVLLVCTGGVFPEVTAAANTLAR-KGIFADIYNVRFVKP
DXS_DEIRA       GEWE-RLK----------GGDDVVILAGGKALDYALKAAEDLP-----GVGVVNARFVKP
DXS_THEMA       GWKI-LKR-----------GREAAIIATGTILNEVLKIPLDV--------TVVNALTVKP
DXS_LEPIN       GTFRVFKR-----------GTDVALISIGSMIDEAKKASERLEN-EGLSVTLIDLVWLRP
DXS_FUSNN       GRWKVIKK-----------GSKNLFIATGTMLKIILEIYDKLQN-RGIYCTIISAASVKP
DXS_MYCPE       GSWVYALQTK---------ESKTCIISYGDIINDLKKEIKTK------SIDLINAVFITN
                *                       ..  *                      : .      

DXS_CHLMU       LDTELLQTLLSHHSKVVVLEEHSIHGGLSAEFLLFLNNHN---LKTDVLSLGIPDIFIPH
DXS_CHLTR       LDRKLLQSLLTHHSKVIILEEHSIHGGLGSEFLLFLNQHN---IKADVLSLGVPDMFIPH
DXS_CHLPN       FDNDLFSLLLMSHSKVITIEEHSIRGGLASEFNNFVATFN---FKVDILNFAIPDTFLSH
DXS_HELPY       LDPNLSAIVAPYQKL-YVFSDNYKLGGVASAILEFLSEQN---ILKPVKSFEIIDEFIMH
DXS_HELPJ       LDHNLSAIIAPYQKL-YVFSDNYKLGGVASAILEFLSEQN---ILKPVKSFEITDEFIMH
DXS_CAMJE       LDEELLCELAKKSKIWFIFSENVKIGGIESLINNFLQKYD---LHVKVVSFEYEDKFIEH
DXS_AGRFC       LDLDLIRQLAAHHEVLVTIEE-GSVGGFGAHVLHFMASAGLLDHGPKVRTLTLPDQWVEQ
DXS_RHIME       LDHDLIRQLARHHEVLITIEE-GAVGGFASHVLQFLAEEGLIDGGLKVRPMVMPDIWMEQ
DXS_RHILO       LDEDLIRRLARSHEVLVTVEE-GAIGGFASHVLQFLAHEGLLESGLKVRPLVLPDVFTDH
DXS_BRUME       LDHDLIRRLAREHEVLVMVEE-GAVGGFGSHVLQFLATDGLLDRGFKVRALTLPDIYQDH
DXS_BRUSU       LDHDLIRRLAREHEVLVMVEE-GAVGGFGSHVLQFLATDGLLDRGLKVRALTLPDIYQDH
DXS_CAUVC       LDLDLLLRLAREHEAIITVEE-GSMGGFGAFVLQALAQHGALDRGLKIRTLCLPDVFQDQ
DXS_RHOCA       LDTDLIDRLIEGHAALITLEQ-GAMGGFGAMVLHYLARTGQLEKGRAIRTMTLPDCYIDH
DXS_CHLTE       LDTEIIDMAASRCTHIVTIEENSIIGGFGSNVVNYLHHA---HPGIKCISFGLPDAFVTH
DXS_NOSS1       LDTELIVPLAQKIGRVVTLEEGCVMGGFGSAVAEALLDAD---VVVPVKRIGIPDVLVEH
DXS_THEEB       LDTELILPLAKQIGRVVTLEEGCLMGGFGSAVLEALQEAD---ILVPVLRLGVPDILVEH
DXS_SYNY3       LDTELILPLAERIGKVVTMEEGCLMGGFGSAVAEALMDNN---VLVPLKRLGVPDILVDH
DXS_SYNP6       LDEELIVPLARQIGKVVTFEEGCLPGGFGSAIMESLQAHD---LQVPVLPIGVPDLLVEH
DXS_SYNE7       LDEELIVPLARQIGKVVTFEEGCLPGGFGSAIMESLQAHD---LQVPVLPIGVPDLLVEH
DXS_BACHD       LDEAMLHEIAKSGRPVLTLEETAVQGSFGSAVLEFFHDHGY--HNVVTQRMGIPDRFIEH
DXS_BACSU       IDEKMMKSILKEGLPILTIEEAVLEGGFGSSILEFAHDQGE--YHTPIDRMGIPDRFIEH
DXS_LISIN       LDEALLHRIFKQKIPILTVEESLLKGGFGASVLEFMEENNY--TDVTIHRIGLPDEFIGH
DXS_CLOAB       IDKDTLNRFARDNYKFVVIEDNVLHGGIGSLILEHLNDMK---FKNDVLNLGFKDEFITH
DXS_CLOPE       IDKELLNSLSKDGFKIVTIEDNIKKGGFGEGVLEYLNEIG---HKEKIVTLAFNDKFIEH
DXS_CALS4       LDEELILEISNKVDLVVTVEDNVIAGGVGSAILELLNDKK---VYRPVLRLGFPDKFIEH
DXS_BUCAI       LDKSMILKLSSQNKFFITLEEGVISGGAGSAVNEFIMVNK---IFLPVLNIGLPDTFIPQ
DXS_WIGBR       LDNLLLIRMAKTHKALITIEENVIMGGAGSAVNEFIMYNK---LLVPVLNIGIPDNFVSH
DXS_ECOL6       LDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHR---KPVPVLNIGLPDFFIPQ
DXS_ECO57       LDETLILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHR---KPVPVLNIGLPDFFIPQ
DXS_ECOLI       LDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHR---KPVPVLNIGLPDFFIPQ
DXS_SALTI       LDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHR---KPVPVLNIGLPDFFIPQ
DXS_SALTY       LDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHR---KPVPVLNIGLPDFFIPQ
DXS_YERPE       LDEELVLEMAAKHQVLVTVEENAIMGGAGSGVNELLMAKR---RWVPVLNIGLPDLFVPQ
DXS_VIBCH       LDEALIKQLAQTHDVLVTLEENAIAGGAGAGVIEFLMKEK---QLKPVLNLGLPDQFIVQ
DXS_VIBVU       LDEALLRQLANEHDVLITIEENAIAGGAGAGVIEFMMQEK---IMKPVLNLGLPDKFIHQ
DXS_HAEIN       IDIEMINVLAQTHDYLVTLEENAIQGGAGSAVAEVLNSSG---KSTALLQLGLPDYFIPQ
DXS_PASMU       IDVERIHQIAQTHDLIVTLEENVIQGGAGSAVAEVLHSQQ---HQTKLLQLGLPDFFIPQ
DXS_SHEON       LDVDLVKEMAQTHDVLVTVEENAIMGGAGSGVLELLQQLK---MPKPVLQIGLPDEFIKH
DXS_NEIMA       IDEELIVRLARSHDRIVTLEENAEQGGAGSAVLEVLAKHG---ICKPVLLLGVADTVTGH
DXS_NEIMB       IDEELIVRLARSHDRIVTLEENAEQGGAGGAVLEVLAKHG---ICKPVLLLGVADTVTGH
DXS_XANAC       LDKALLLELAKTHDGFVTIEDNVVAGGAGSGVSELLNAEA---ITMPLLHLGLPDSFQHH
DXS_XANCP       LDKAMLLELAKCHEAFVSIEDNVVAGGAGSGVSELLNAEG---VLMPMLHLGLPDSFQHH
DXS_XYLFA       LDRTLLLELARTHEGFVTIEDNVVAGGAGSGVAELLNAEG---IVLPIVHLGLPDAFQQH
DXS_PSEAE       LDEALVRELAGSHELLVTIEENAVMGGAGSAVGEFLASEG---LEVPLLQLGLPDYYVEH
DXS_RALSO       LDAACVLEMARTHDYVVTVEEGCVMGGAGSACLEALAAAG---VATPVLQLGLPDRFVDH
DXS_AQUAE       MDEKMLRDLANRYDTFITVEDNTVVGGFGSGVLEFFAREG---IMKRVINLGVPDRFIEH
DXS_COREF       IPQS-LVALAADHDLVITIEDGVIHGGVGSLLSDALNAAE---VDTPRRQVAVPQKFLDH
DXS_CORGL       IPQS-LVALSDDHDLVITIEDGVIHGGVGSLLSDALNASE---VDTPRRQIAVPQKYLDH
DXS_MYCLE       VCDG-VLELAHTHKLIVTLEDNGVNGGVGAAVSTALRQVE---IDTPCRDVGLPQEFYDH
DXS_MYCTU       VSDG-VRELAVQHKLLVTLEDNGVNGGAGSAVSAALRRAE---IDVPCRDVGLPQEFYEH
DXS2_KITGR      VDAA-LPGLAAQHRLVVTVEDNGRAGGVGSAIAQALRDAD---VDVPLRDFGIPQEFLDH
DXS2_STRCO      VDEA-MAPLAERHRVVVTVEDNSRVGGVGSAVAQALRDAG---VDVPLRDFGIPPRFLDH
DXS_STRC1       VDPV-LPPLAAEHRLVAVVEDNSRAAGVGSAVALALGDAD---VDVPVRRFGIPEQFLAH
DXS1_STRCO      VDPA-LAPLAARHRLVAVVEDNSRAAGVGSAVALALGDAE---VDVPVRRFGIPEQFLAH
DXS1_KITGR      VDPA-LVELAGAHRMVVTVEDNGRTGGVGAALAQAMRDAD---VDTPLRDLGIPQEFLAH
DXS_TREPA       VDEDYFLDLVGRYRSVLFVEDGVKIGGIAEALQALLNTRH---PAPCSDVLAFQDMFYPH
DXS_DEIRA       LDEEMLREVGGRARALITVEDNTVVGGFGGAVLEALNSMN---LHPTVRVLGIPDEFQEH
DXS_THEMA       LDTAVLKEIARDHDLIITVEEAMKIGGFGSFVAQRLQEMG---WQGKIVNLGVEDLFVPH
DXS_LEPIN       LGAEALNEELVNVRCFVILDESYIDSGVTGYLLNRMTREN---LSKYIKTFGFPPEPIHH
DXS_FUSNN       LDENYLLNYIKEYDNIFVLEENYVKNSFGTAILEFFNDNG---IQKPLHRIALKSAIIPH
DXS_MYCPE       YQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENK---LSCNIKKINIRNNKIGF
                                  ...                             .         

DXS_CHLMU       GNPETILNMIGLTSDQITLKILAHFNFSAPIPI---------------------------
DXS_CHLTR       GNPETILNLIGLTSDHITQRILSHFKFSTPIPIERFFKA---------------------
DXS_CHLPN       GSKEALTKSIGLDESSMTNRILTHFNFRSKKQTVGDVRV---------------------
DXS_HELPY       GNTALVEKSLGLDTESLTDAILKDLGQER-------------------------------
DXS_HELPJ       GNTALVEKSLGLDTESLTDAILKDLGQER-------------------------------
DXS_CAMJE       GKTSEVEKNLEKDVNSLLTKVLKFYH----------------------------------
DXS_AGRFC       AKPETMYANAGLDRAGIVSTVFNALGQRQ-AGVGFAG-----------------------
DXS_RHIME       AKPEAMYARAGLDRAGIVSTVFKALGQKHGVGLGAAG-----------------------
DXS_RHILO       AKPEKMYADAGLDAAGIVRTVFTALDHTARAQRA--------------------------
DXS_BRUME       GKPDAMYAEAGLDRTGIVRTVFAALHRDELGHEALPTPFRA-------------------
DXS_BRUSU       GKPDAMYAEAGLDRTGIVRTVFAALHRDELGHEALPTPFRA-------------------
DXS_CAUVC       DKPDAMYAQAGLDAEGILRGALSAMGMDNVSAAGAGRRA---------------------
DXS_RHOCA       GSPEEMYAWAGLTANDIRDTALAAARPSKSVRIVHSA-----------------------
DXS_CHLTE       GSMDELYREVGLDAESLSGKILEFYKDKP-------------------------------
DXS_NOSS1       ATPDESKAELGLTSRQIAERVLQAYFQKQPSPVS--------------------------
DXS_THEEB       ASPDESKADLGLTPPQMAETIMQKFGVPQRATVVTAS-----------------------
DXS_SYNY3       ATPEQSTVDLGLTPAQMAQNIMASLFKTETESVVAPGVS---------------------
DXS_SYNP6       ASPDESKQELGLTPRQMADRILEKFGSRQRIGAASA------------------------
DXS_SYNE7       ASPDESKQELGLTPRQMADRILEKFGSRQRIGAASA------------------------
DXS_BACHD       GSVSELLEEIGLTSSQVANQLSKLLPRKQKRA----------------------------
DXS_BACSU       GSVTALLEEIGLTKQQVANRIRLLMPPKTHKGIGS-------------------------
DXS_LISIN       GSVPLILESYGISPTGIVLKINEMLAQSE-------------------------------
DXS_CLOAB       GNIEILYKLYDLDIEGICKRIISFK-----------------------------------
DXS_CLOPE       GKPDILYKINGLDAEGIKNTLIELL-----------------------------------
DXS_CALS4       GDVESLFKKYGLDSQSIADTILQRYKEMRGS-----------------------------
DXS_BUCAI       GTQEEIRHVYKLDSEGIYKQIFYWLRQ---------------------------------
DXS_WIGBR       GSQTEVRSSLGLDSIGIKEKIKNWLNFLV-------------------------------
DXS_ECOL6       GTQEEMRAELGLDATGMEAKIKAWLA----------------------------------
DXS_ECO57       GTQEEMRAELGLDAAGMEAKIKAWLA----------------------------------
DXS_ECOLI       GTQEEMRAELGLDAAGMEAKIKAWLA----------------------------------
DXS_SALTI       GTQEEARAELGLDAAGIEAKIKAWLA----------------------------------
DXS_SALTY       GTQEEARAELGLDAAGIEAKIKAWLA----------------------------------
DXS_YERPE       GEQDEMRSELGLDAAGIQRQIEAWLA----------------------------------
DXS_VIBCH       GTQEEMHAELGLDGAGIERAIRDYLAK---------------------------------
DXS_VIBVU       GTQEELHEELGLDAKGIEQAIRHYLAK---------------------------------
DXS_HAEIN       ATQQEALADLGLDTKGIEEKILNFIAKQGNL-----------------------------
DXS_PASMU       GTQQEILADLHLDEAGIETQIKNFL-----------------------------------
DXS_SHEON       GSPDEVIHDLQLDAEGMLAQINAYLAN---------------------------------
DXS_NEIMA       GDPKKLLDDLGLSAEAVERRVRAWLSDRDAAN----------------------------
DXS_NEIMB       GDPKKLLDDLGLSAEAVERRVRAWLSDRDAAN----------------------------
DXS_XANAC       ASREDLLAEAGIDQAGIRAALLKRWPQLMISLPPALNAATG-------------------
DXS_XANCP       ASREDLLAEAGIDQAGIRAAVLKRWPQLMAKGQQALNAAAG-------------------
DXS_XYLFA       ASREDLLAEAGIDAAGVYAALLSRWPDLAVQNHPLSAVS---------------------
DXS_PSEAE       AKPSEMLAECGLDAAGIEKAVRQRLDRQ--------------------------------
DXS_RALSO       GDHAALLALCGLDANGILASIRERFAVQPRAVQPRVA-----------------------
DXS_AQUAE       GKQDILRNLVGIDAEGIEKAVRDALKGGRLI-----------------------------
DXS_COREF       ASRGQVLLDHDLDIDSVEKTALGWMDRLFGGGN---------------------------
DXS_CORGL       ASRNEVLADYGLDADGIETTVVGWLDSLFGE-----------------------------
DXS_MYCLE       ASRSEVLADLGLTDQDVARRITGWVVAFGHCGSGDDAGQYGPRSSQTM------------
DXS_MYCTU       ASRSEVLADLGLTDQDVARRITGWVAALGTGVCASDAIPEHLD-----------------
DXS2_KITGR      ASRGEILDEIGLTAPAIAKKIEALVSTRSFARS---------------------------
DXS2_STRCO      ASRAEVLAEIGLTAPDIARQVTGLVARLDGRYDRAGAEVDQVEAARD-------------
DXS_STRC1       ARRGEVLADIGLTPVEIAGRIGASLPVREE-------PAEEQPA----------------
DXS1_STRCO      AKRAEVLADIGLTPVDVAGRIAASLALAEPAGDRAGGPAVEQPGDGRMSGDGRIVMPAQG
DXS1_KITGR      ASRGEILEEIGLTGTGVAAQTAAHARRLLPGTGTRPGAQEYRPRMPLTDWSEPA------
DXS_TREPA       GSRAQVLAAAGLSAPHIAARAEWLLAHSVGQIR---------------------------
DXS_DEIRA       ATAESVHARAGIDAPAIRTVLAELGVDVPIEV----------------------------
DXS_THEMA       GGRKELLSMLGLDSEGLTKTVLTYIKARSREGKV--------------------------
DXS_LEPIN       GERKEVFQKYRLDGESIAEQVAAVLKKNLIKP----------------------------
DXS_FUSNN       GKREELLKEERLKGESLIERIEELIYGRKK------------------------------
DXS_MYCPE       GNKEDIDKKLNIDMNSIFAEIKS-------------------------------------
                                :                                           

DXS_CHLMU       --
DXS_CHLTR       --
DXS_CHLPN       --
DXS_HELPY       --
DXS_HELPJ       --
DXS_CAMJE       --
DXS_AGRFC       --
DXS_RHIME       --
DXS_RHILO       --
DXS_BRUME       --
DXS_BRUSU       --
DXS_CAUVC       --
DXS_RHOCA       --
DXS_CHLTE       --
DXS_NOSS1       --
DXS_THEEB       --
DXS_SYNY3       --
DXS_SYNP6       --
DXS_SYNE7       --
DXS_BACHD       --
DXS_BACSU       --
DXS_LISIN       --
DXS_CLOAB       --
DXS_CLOPE       --
DXS_CALS4       --
DXS_BUCAI       --
DXS_WIGBR       --
DXS_ECOL6       --
DXS_ECO57       --
DXS_ECOLI       --
DXS_SALTI       --
DXS_SALTY       --
DXS_YERPE       --
DXS_VIBCH       --
DXS_VIBVU       --
DXS_HAEIN       --
DXS_PASMU       --
DXS_SHEON       --
DXS_NEIMA       --
DXS_NEIMB       --
DXS_XANAC       --
DXS_XANCP       --
DXS_XYLFA       --
DXS_PSEAE       --
DXS_RALSO       --
DXS_AQUAE       --
DXS_COREF       --
DXS_CORGL       --
DXS_MYCLE       --
DXS_MYCTU       --
DXS2_KITGR      --
DXS2_STRCO      --
DXS_STRC1       --
DXS1_STRCO      EN
DXS1_KITGR      --
DXS_TREPA       --
DXS_DEIRA       --
DXS_THEMA       --
DXS_LEPIN       --
DXS_FUSNN       --
DXS_MYCPE       --