CLUSTAL format seed alignment for MF_00318

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ENO_HELPY         ------------------------------------------------------------
ENO_HELPJ         ------------------------------------------------------------
ENO_CAMJE         ------------------------------------------------------------
ENO_NOSS1         -----------------------------------------------------------M
ENO_SYNY3         -----------------------------------------------------------M
ENO_DEIRA         ------------------------------------------------------------
ENO_BRUME         ------------------------------------------------------------
ENO_RHILO         ------------------------------------------------------------
ENO_RHIME         ------------------------------------------------------------
ENO_CAUVC         ------------------------------------------------------------
ENO_ZYMMO         ------------------------------------------------------------
ENO_MYCLE         ------------------------------------------------------------
ENO_MYCTU         ------------------------------------------------------------
ENO_CHLMU         ------------------------------------------------------------
ENO_CHLTR         ------------------------------------------------------------
ENO_CHLPN         ------------------------------------------------------------
ENO_AQUAE         ------------------------------------------------------------
ENO_THEMA         ------------------------------------------------------------
ENO_BACHD         ------------------------------------------------------------
ENO_BACSU         ------------------------------------------------------------
ENO_LISMO         ------------------------------------------------------------
ENO_STRIT         ------------------------------------------------------------
ENO_STRPN         ------------------------------------------------------------
ENO_STRP1         ------------------------------------------------------------
ENO1_LACLA        ------------------------------------------------------------
ENO_STAAM         ------------------------------------------------------------
ENO_STAAU         ------------------------------------------------------------
ENO_ENTFA         ------------------------------------------------------------
ENO_BORBU         ------------------------------------------------------------
ENO_NEIMA         ------------------------------------------------------------
ENO_NEIMB         ------------------------------------------------------------
ENO_NITEU         ------------------------------------------------------------
ENO_RALSO         ------------------------------------------------------------
ENO_ECOLI         ------------------------------------------------------------
ENO_SALTY         ------------------------------------------------------------
ENO_YERPE         ------------------------------------------------------------
ENO_VIBCH         ------------------------------------------------------------
ENO_HAEIN         ------------------------------------------------------------
ENO_PASMU         ------------------------------------------------------------
ENO_BUCAI         ------------------------------------------------------------
ENO_PSEAE         ------------------------------------------------------------
ENO_XYLFA         ------------------------------------------------------------
ENO_DESVM         ------------------------------------------------------------
ENO_TREPA         ------------------------------------------------------------
ENO_MYCGE         --------------------------------------------------------MGSS
ENO_MYCPN         --------------------------------------------------------MSAQ
ENO_UREPA         ------------------------------------------------------------
ENO_PELUB         ------------------------------------------------------------
ENO_MYCPU         ------------------------------------------------------------
ENO2_LACLA        ------------------------------------------------------------
ENO_STRTR         ------------------------------------------------------------
ENO_NEOSM         ------------------------------------------------------------
ENO_PYRAB         ------------------------------------------------------------
ENO_PYRHO         ------------------------------------------------------------
ENO_METJA         ------------------------------------------------------------
ENO_COCLU         ------------------------------------------------------------
G0VDS4_NAUCC      --------------------------------------MLIQSYSKFFLRPQAIHCIKSI
J6EZG7_TRIAS      --------------------------------------------------MSVITKVHAR
D8RLY3_SELML      MAACGTRLLPKSSFLSSANSSSFLGGSSVPCASSPSSSSSKLGSSRCITVRAVVASPTKV
D0A1Y2_TRYB9      ------------------------------------------------------------
B7GEF2_PHATC      ------------------MLFKPSTLLALFAVAGTTLAFAPRSTTTSLTSTTRGSASSSV
G4YKG3_PHYSP      ---------------------------------MATEVRSSFTNWRIKPQFKKQPLPLHP
D8LWD6_BLAHO      ---------------------------------MAPEA----------------------
F0ZJC2_DICPU      ------------------------------------------------------------
ENO3_ARATH        ---------------------MSVQEYLDKHMLSRKIEDAVNAAVRAKTSDPVLFIANHL
M4DPD7_BRARP      ---------------------MSVQEYLDKHTLSRKIEDAVNAAVRAKTSDPVLFIANHM
Q5KG11_CRYNJ      ------------------------------------------------------------
F8N224_NEUT8      ------------------------------------------------------------
Q8SUA4_ENCCU      ------------------------------------------------------------
A2E269_TRIVA      --------MSVQQVLKVGLKSGLITLFVAMNAENDAIIKAAIAEAAKSEDPIGTLSVLLK
D2V522_NAEGR      --------MDRQPISEYLQNNNLQKLV------EDALNECYNANASDVHSFLGNFFLSRG
A1WLU9_VEREI      ------------------------------------------MTTTSATASTSTTTTATS
B1MFL1_MYCA9      ------------------------------------------------------------
C5C344_BEUC1      ------------------------------------------------------------
B8IXI8_METNO      ------------------------------------------------------------
ENO_SACS2         ------------------------------------------------------------
ENO_SULTO         ------------------------------------------------------------
ENO_AERPE         ------------------------------------------------------------
ENO_THEAC         ------------------------------------------------------------
ENO_THEVO         ------------------------------------------------------------
ENO_PICTO         ------------------------------------------------------------
ENO_PYRAE         ------------------------------------------------------------
A1RTI8_PYRIL      ------------------------------------------------------------
A3MS45_PYRCJ      ------------------------------------------------------------
A8MAB4_CALMQ      ------------------------------------------------------------
ENO_METTH         ------------------------------------------------------------
ENO_HALMA         ------------------------------------------------------------
ENO_HALSA         ------------------------------------------------------------
ENO3_METHJ        ------------------------------------------------------------
ENO_METLZ         ------------------------------------------------------------
ENO_ARCFU         ------------------------------------------------------------
A0RY13_CENSY      ------------------------------------------------------------
A9A429_NITMS      ------------------------------------------------------------
K0IE56_NITGG      ------------------------------------------------------------
                                                                              

ENO_HELPY         ----MLTIKDIHALEVMDSRGNPTIQASVVLSDN-----TKASAIVPSGASTGKREALEL
ENO_HELPJ         ----MLTIKDIHALEVMDSRGNPTIQASVILSDN-----TKASAIVPSGASTGKREALEL
ENO_CAMJE         ----MLVIEDVRAYEVLDSRGNPTVKAEVTLSDG-----SVGAAIVPSGASTGSKEALEL
ENO_NOSS1         NNIVDTAIEAIVAREILDSRGRPTIEAEVHLLSG-----AVGLAQVPSGASTGTFEAHEL
ENO_SYNY3         LSKVPATIEEIAAREILDSRGRPTIEAEVRLESG-----AHGIAQVPSGASTGSFEAHEL
ENO_DEIRA         -----MNIEKVIAREVLDSRGNPTVEAEVHLDSG-----FSGRAIVPSGASTGSHEALEL
ENO_BRUME         ----MTAIIDIVGREILDSRGNPTVEVDVVLEDG-----SFGRAAVPSGASTGAHEAVEL
ENO_RHILO         ----MTAIIDIVGREILDSRGNPTVEVDVVLEDG-----SMGRAAVPSGASTGAHEAVEL
ENO_RHIME         ----MTAIIDIIGREILDSRGNPTVEVDVHLEDG-----SFGRAAVPSGASTGAHEAVEL
ENO_CAUVC         ----MTEIVDIIAREILDSRGNPTVEVDVILEDG-----AFGRAAVPSGASTGAHEANEK
ENO_ZYMMO         ----MTAIVSIHGRQVVDSRGNPTVEVDVTLEDG-----SFGRAAVPSGASTGVHEAVEL
ENO_MYCLE         ----MPVIEQVGAREILDSRGNPTVEVEVVLIDG-----TFARAAVPSGASTGEYEAVEL
ENO_MYCTU         ----MPIIEQVRAREILDSRGNPTVEVEVALIDG-----TFARAAVPSGASTGEHEAVEL
ENO_CHLMU         --MFDVVISDIEAREILDSRGYPTLYVKVITNTG-----IFGEACVPSGASTGIKEALEL
ENO_CHLTR         --MFDVVISDIEAREILDSRGYPTLCVKVITNTG-----TFGEACVPSGASTGIKEALEL
ENO_CHLPN         --MFEAVIADIQAREILDSRGYPTLHVKVTTSTG-----SVGEARVPSGASTGKKEALEF
ENO_AQUAE         ----MSRIKRVHGREVLDSRGNPTVEVEVELESG-----ALGRAIVPSGASTGEREALEL
ENO_THEMA         ---MYVEIVDVRAREVLDSRGNPTVEAEVVLEDG-----TMGRAIVPSGASTGKFEALEI
ENO_BACHD         ----MTIITDVYAREVLDSRGNPTVEVEVYLESG-----AMGRALVPSGASTGEYEAVEL
ENO_BACSU         ----MPYIVDVYAREVLDSRGNPTVEVEVYTETG-----AFGRALVPSGASTGEYEAVEL
ENO_LISMO         ----MSIITEVYAREVLDSRGNPTVEVEVYTEAG-----AFGRALVPSGASTGEYEAVEL
ENO_STRIT         ----MSIITDVYAREVLDSRGNPTLEVEVYTESG-----AFGRGMVPSGASTGEHEAVEL
ENO_STRPN         ----MSIITDVYAREVLDSRGNPTLEVEVYTESG-----AFGRGMVPSGASTGEHEAVEL
ENO_STRP1         ----MSIITDVYAREVLDSRGNPTLEVEVYTESG-----AFGRGMVPSGASTGEHEAVEL
ENO1_LACLA        ----MSIITDIYAREVLDSRGNPTLEVEVYTEDG-----AFGRGMVPSGASTGEHEAVEL
ENO_STAAM         ----MPIITDVYAREVLDSRGNPTVEVEVLTESG-----AFGRALVPSGASTGEHEAVEL
ENO_STAAU         ----MPIITDVYAREVLDSRGNPTVEVEVLTESG-----AFGRALVPSGASTGEHEAVEL
ENO_ENTFA         ----MSIITDIYAREVLDSRGNPTIEVEVYTESG-----AFGRGMVPSGASTGEYEAVEL
ENO_BORBU         ---MGFHIYEIKARQIIDSRGNPTVEADVILEDG-----TYGRAAVPSGASTGINEAVEL
ENO_NEIMA         ----MSAIVDIFAREILDSRGNPTVECDVLLESG-----VMGRAAVPSGASTGQKEALEL
ENO_NEIMB         ----MSAIVDIFAREILDSRGNPTVECDVLLESG-----VMGRAAVPSGASTGQKEALEL
ENO_NITEU         ----MSAIVDVIAREIIDSRGNPTIEADVLLESG-----VLGRASVPSGASVGTREAVEL
ENO_RALSO         ----MSAIVDIIGREVLDSRGNPTVECDVLLESG-----VMGRAAVPSGASTGSREAIEL
ENO_ECOLI         ----MSKIVKIIGREIIDSRGNPTVEAEVHLEGG-----FVGMAAAPSGASTGSREALEL
ENO_SALTY         ----MSKIVKVIGREIIDSRGNPTVEAEVHLEGG-----FVGMAAAPSGASTGSREALEL
ENO_YERPE         ----MSKIVKVIGREIIDSRGNPTVEAEVHLEGG-----FVGLAAAPSGASTGSREALEL
ENO_VIBCH         ----MSKIVKVLGREIIDSRGNPTVEAEVHLEGG-----FVGMAAAPSGASTGSREALEL
ENO_HAEIN         ----MAKIVKVIGREIIDSRGNPTVEAEVHLXGG-----FVGLAAAPSGASTGSREALEL
ENO_PASMU         ----MAKIVKVIGREIIDSRGNPTVEAEVHLEGG-----FVGLAAAPSGASTGSREALEL
ENO_BUCAI         ----MSKITKIIAREIIDSRGNPTVESEVHLEGG-----FVGLASSPSGASTGSLEALEL
ENO_PSEAE         ----MAKIVDIKGREVLDSRGNPTVEADVILDNG-----IVGSACAPSGASTGSREALEL
ENO_XYLFA         ----MTAIAKIYAREILDSRGNPTLEAEVTLENA-----VCGRAAVPSGASTGTKEAVEL
ENO_DESVM         ----MSTIVSVWAREILDSRGNPTVEVEVSLESG-----HTGRAAVPSGASTGSREALEM
ENO_TREPA         ----MSDIACIEAREIIDSRGNPTVEVDVSLSDG-----SFGRACVPSGASTGEFEALEM
ENO_MYCGE         NLNINSKITDIFAYQVFDSRGVPTVACVVKLASG-----HVGEAMVPSGASTGEKEAIEL
ENO_MYCPN         TGTDLFKIADLFAYQVFDSRGFPTVACVVKLASG-----HTGEAMVPSGASTGEKEAIEL
ENO_UREPA         -----MKIINLLAYQILDSRGQPTVAVKLFLEND-----QSVIAMVPSGASTGAKEALEL
ENO_PELUB         ----MSKILKIKARQVFDSRGNPTIEAEVYSKK------LSASAICPSGASTGTYEAFEK
ENO_MYCPU         ----MSEIVKIKALEVLDSRGNPTIQVEVHTISG-----AYGKALVPSGASTGSREALEL
ENO2_LACLA        ---MTVTIENIHAREIFDSRGNPTVEVDVRLTDG-----TLGRAAVPSGASTGDREAVEL
ENO_STRTR         ---MTVTIENIHAREIFDSRGNPTVEVDVRLTDG-----TLGRAAVPSGASTGDREAVEL
ENO_NEOSM         ----MQQIQKVKAREIFNSRGWPTIEVEVTTSCG-----RVGCAIAPSGASKGVLEACEL
ENO_PYRAB         -MENPYEIVAVIAREILDSRGNPTVEVDVHTP------ISMGRAAVPSGASTGTHEAVEL
ENO_PYRHO         -MENPYEITAIVAREILDSRGNPTVEVDVHTP------IAMGRAAVPSGASTGTHEAVEL
ENO_METJA         -MDERFEIKDIVAREVIDSRGNPTVEVEVITKG-----NGYGSAIVPSGASTGTHEALEL
ENO_COCLU         -----MAITKIHARSVYDSRGNPTVEVDIVT------ETGLHRAIVPSGASTGSHEACEL
G0VDS4_NAUCC      HTQSIMAVSKVYARSVYDSRGNPTVEVEITT------ENGVFRAMVPSGASTGIHEALEM
J6EZG7_TRIAS      QVSTPLHLLRIVSGPIYSDVARLALRSTIVTLR---NAQSRFRAQVPSGASTGAHEAVEL
D8RLY3_SELML      HAEPATKIKSIKARQIIDSRGNPTVEVDLVT-------DRVYRSAVPSGASTGIYEALEL
D0A1Y2_TRYB9      -----MTIQKVHGREVLDSRGNPTVEVEVTT------ERGVFRSAVPSGASTGVYEACEL
B7GEF2_PHATC      TTLAMSGITGVLAREILDSRGNPTVEVEVTT------ADGVFRASVPSGASTGAYEAVEL
G4YKG3_PHYSP      SISTMVSIVAIKARQIFDSRGNPTVEVDLTT------ELGQYRAAVPSGASTGEFEALEM
D8LWD6_BLAHO      -----TTIKSIYARQIYDSRGNPTVEVDLKT------ELGLFRAAVPSGASTGIYEALEL
F0ZJC2_DICPU      ----MSTIKSIKAREILDSRGNPTLEVELFTN-----KGQTFIAKVPSGASTGINEAFEL
ENO3_ARATH        KKAVSSVITKVKARQILDSRGIPTVEVDLHT------NKGVFRASVPSGDSSGTYEAIEL
M4DPD7_BRARP      KKAVPSVITKVKARQILDSRGIPTVEVDLHT------NKGVFRASVPSGDSSGTYEAIEL
Q5KG11_CRYNJ      -----MSFQSVRASQIFDSRGNPTVEVVVET------LQGRFVAGVPSGASTGSHEAVEL
F8N224_NEUT8      ------MLLDVKASQRLDSRGNPTIQVEVRT------AHGTFRALVPSGASTGAHEAVEL
Q8SUA4_ENCCU      -MKVKDALLDIKPRMILTSRGRPTVEVDLIT------SRGVHRSSCPSGASKGSKEAVEL
A2E269_TRIVA      KKAPKALIEKVVGREVLDSRGNPTVEVDVYVKYLG-RITLAARSSAPSGASTGVGEALEL
D2V522_NAEGR      KKSS-GQIDKIVGREILDSRGNPTVEVDVYVN--G-QKRPIATASAPSGASTGSNEAHEL
A1WLU9_VEREI      ASSATERIAALHGRRVWDSRGRPTVEVEITTAGG-----QRGRAIAPAGASRGSAEASDL
B1MFL1_MYCA9      --MTGTRISRVHARRVWDSRGRPTIEAELLLSDG-----STGRAIAPAGASRGSGEVTDL
C5C344_BEUC1      --MTDMSIRTVTAWEALDSRGRPTVACRVDLADG-----ARAVARVPSGASTGSHEAPEL
B8IXI8_METNO      --MTCTRLRRLHARQILDSRGRPTVEAEISLDNG-----IQVRASVPSGASTGKAEAVEL
ENO_SACS2         -MINRFSIEKVKGLEIVDSRGNPTIRVFIRTSDG-----VESFGDAPAGASKGTREAVEV
ENO_SULTO         -MNDYFRIKKIKGYQILDSRGNKTIRVKIETYGG-----ISETGDAPAGASKGSREAIEL
ENO_AERPE         MGVNDFAIERVWGLQVLDSRGNPTVKAYVKLAGG-----SLGWGIAPSGASRGEREAVEL
ENO_THEAC         ---MELPIEEIKVRKVLDSRGNFTVEADVTVPNG------FGRTSAPAGASTGETEVIAF
ENO_THEVO         ---MELPIEDVRVRKVLDSRGNFTVEADVYIPGG------FGRTSAPAGASTGETEVIAF
ENO_PICTO         ---MNFEIKDTNIRKIFDSRGNFSAEVTVILENA------SGTASAPAGASTGKTEVIAY
ENO_PYRAE         -----MQISDAWIRKVFTGRGDVTVEVELTVEDSVTGDVLVTRAAAPAGASRGAHEVLYF
A1RTI8_PYRIL      -----MQIEDVWIRKVFTGRGDVTVEVELTAEDPTTGEVVITRAAAPAGASRGTHEVAYF
A3MS45_PYRCJ      -----MEIKDVAIRKIFTGRGDLTVEVEVATED------FVAKAAAPAGASRGANEVVYF
A8MAB4_CALMQ      ---MGTRISRLGIRKVFTGRGDLTVEVEVHLDDG------WGRAIAPAGASRGKHEVKYF
ENO_METTH         ---MESIIEDVRVRKILDSRGNPTVEVDVITWNG------FGRAAAPSGASTGSREVAAF
ENO_HALMA         ----MTLITDIRLRRVLDSRGNATVEADVLTESGG-----FGRGKAPSGASTGEYEAIEL
ENO_HALSA         ----MTRIEAVRYRPILDSRGNKTVEAEVTTDDGG-----FGRAAAPSGASTGEHEAVEL
ENO3_METHJ        ----MTITRAITLRTILDSRGRKTVEAEVRT-EHG-----FGRAAAPGGASTGIHEAAVR
ENO_METLZ         ----MTEISDILLRTILDSRGNPTVEAEISTISGG-----FGRACAPSGASTGIYEAKVR
ENO_ARCFU         -----MIIEDVHYRVVFDSRGNETVECEVVA-GEV-----VAKAMAPSGASTGSGEAVVV
A0RY13_CENSY      ----MSRITSVRGRIVYNSRGSRTVEVDVISDGK-----FLGRACAPSGASVGIHEVRNF
A9A429_NITMS      ----MAKITSIEGRILYNSRGSKTIEVDVESEGK-----FVGRVCAPSGASVGKYEAVSF
K0IE56_NITGG      ----MPSITAVRGRIVFNSRGSKTIEIDVVTDNK-----FIGRACAPSGASVGRLEAQSF
                                    . .  :    :                 *.* * *  *.   

ENO_HELPY         RDNDKTR----FLGKGVLRACENVNSVIKHHLIG--LEAI-NQAFVDERLRA-LDGTPN-
ENO_HELPJ         RDNDKTR----FLGKGVLRACENVNSVIKHHLIG--LEAT-NQAFVDERLRA-LDGTPN-
ENO_CAMJE         RDND-ER----FGGKGVLKAVANVNETIADEILG--LDAF-NQTQLDDTLRE-LDGTNN-
ENO_NOSS1         RDKDKSR----YGGKGVLKAVHNVNEILAPKLID--LDAL-NQELIDRTMIA-LDGSGN-
ENO_SYNY3         RDGDPKR----YDGKGVEKAVRNVTEKIAPVVEG--LDAF-DQMAVDQAMID-RDGTDN-
ENO_DEIRA         RDGG-ER----YMGKGVERAVQNVREALGPALIG--MDAS-EQAAIDKALMD-VDGTSN-
ENO_BRUME         RDGG-SR----YLGKGVEKAVEVVNGKIFDAIAG--MDAE-SQLLIDQTLID-LDGSAN-
ENO_RHILO         RDGG-AR----YLGKGVLKAVEAVNGELFEAIGG--MEAE-NQIHIDQTMIE-LDGTPN-
ENO_RHIME         RDGG-TR----YLGKGVERAVDAVNGEIFEAIGG--LDAE-NQIQIDRTMIE-LDGTPN-
ENO_CAUVC         RDGDKAR----YLGKGVQQAVDAVNGEIFDALSG--VDAE-DQRRVDNLMIE-LDGTPN-
ENO_ZYMMO         RDGDKTR----WGGKGVTKAVHAVNNEIANAIIG--LEAE-DQELIDQTMIK-LDGTPN-
ENO_MYCLE         RDGD-GR----YGGKGVKRAVDAVLDEIGPVVIG--LNAN-DQRLIDQELLD-LDGTPD-
ENO_MYCTU         RDGG-DR----YGGKGVQKAVQAVLDEIGPAVIG--LNAD-DQRLVDQALVD-LDGTPD-
ENO_CHLMU         RDQDPKR----YQGKGVLQAVANVEKVLLPALQG--FSVF-DQITADAIMID-ADGTSN-
ENO_CHLTR         RDKDPKR----YQGKGVLQAISNVEKVLMPALQG--FSVF-DQITADAIMID-ADGTPN-
ENO_CHLPN         RDTDSPR----YQGKGVLQAVKNVKEILFPLVKG--CSVY-EQSLIDSLMMD-SDGSPN-
ENO_AQUAE         RDGDPKR----YLGKGVLKAVDNVNGVIAKALVG--LEPY-NQREIDQILIE-LDGTEN-
ENO_THEMA         RDKDKKR----YLGKGVLKAVENVNETIAPALIG--MNAF-DQPLVDKTLIE-LDGTEN-
ENO_BACHD         RDGG-ER----FLGKGVLKAVENVNEVIAPELIG--FDAL-DQIGIDQHMIE-LDGTEN-
ENO_BACSU         RDGDKDR----YLGKGVLTAVNNVNEIIAPELLG--FDVT-EQNAIDQLLIE-LDGTEN-
ENO_LISMO         RDGDKAR----YLGKGVLKAVENVNDIIADKIIG--FDVT-DQIGIDKAMIE-LDGTPN-
ENO_STRIT         RDGDKSR----YGGLGTQKAVDNVNNIIAEAVIG--YDVR-DQQAIDRAMIA-LDGTPN-
ENO_STRPN         RDGDKSR----YGGLGTQKAVDNVNNIIAEAIIG--YDVR-DQQAIDRAMIA-LDGTPN-
ENO_STRP1         RDGDKSR----YLGLGTQKAVDNVNNIIAEAIIG--YDVR-DQQAIDRAMIA-LDGTPN-
ENO1_LACLA        RDGDKSR----YNGLGTQKAVDNVNNIIAEAIIG--YEVT-DQQAIDRAMIA-LDGTEN-
ENO_STAAM         RDGDKSR----YLGKGVTKAVENVNEIIAPEIIEGEFSVL-DQVSIDKMMIA-LDGTPN-
ENO_STAAU         RDGDKSR----YLGKGVTKAVENVNEIIAPEIIEGEFSVL-DQVSIDKMMIA-LDGTPN-
ENO_ENTFA         RDGDKAR----YLGKGVTKAVDNVNNIIAEAIIG--YDVR-DQMAIDKAMID-LDGTPN-
ENO_BORBU         RDGDKSV----YMGKGVLKAIENIKNIIAPELEG--MSAL-NQVAIDRKMLE-LDGTPT-
ENO_NEIMA         RDGDKSR----YSGKGVLKAVEHVNNQIAQALIG--IDAN-EQSYIDQIMIE-LDGTEN-
ENO_NEIMB         RDGDKSR----YSGKGVLKAVEHVNNQIAQALIG--IDAN-EQSYIDQIMIE-LDGTEN-
ENO_NITEU         RDGDAQR----YYGKGVLKAVESVNGEISETIMG--LDAM-EQCFIDKTLIE-LDGSEN-
ENO_RALSO         RDGDKGR----YLGKGVLKAVEHINTEISEAIMG--LDAS-EQAFLDRTLID-LDGTEN-
ENO_ECOLI         RDGDKSR----FLGKGVTKAVAAVNGPIAQALIG--KDAK-DQAGIDKIMID-LDGTEN-
ENO_SALTY         RDGDKSR----FLGKGVTKAVGAVNGPIAQAILG--KDAK-DQAGIDKIMID-LDGTEN-
ENO_YERPE         RDGDKSR----FLGKGVLKAVAAVNGPIAQAVIG--KDAK-DQANIDKIMID-LDGTEN-
ENO_VIBCH         RDGDKSR----FLGKGVLKALAAVNGPIADALVG--KDAK-DQATIDQIMID-LDGTEN-
ENO_HAEIN         RDGDKSR----FLGKGVLKAVAAVNNEIAQAIVG--KDAT-NQAEIDQIMID-LDGTEN-
ENO_PASMU         RDGDKAR----FLGKGVLKAVAAVNNEIAQALVG--KDAT-NQAEIDQIMID-LDGTEN-
ENO_BUCAI         RDENKDR----FMGKGVEKAVSLINEKISIALKN--KNAR-NQSDIDHIMID-LDGTIN-
ENO_PSEAE         RDGDKSR----YLGKGVLKAVANINGPIRDLLLG--KDAA-DQKALDHAMIE-LDGTEN-
ENO_XYLFA         RDGDKTR----YLGKGVRAAVDNVNGVIAAALVG--FDGA-DQTGLDHRLIN-LDGTEN-
ENO_DESVM         RDGDKGR----YKGKGVEKAVDNVMGEIAEAIVG--LDSL-RQVQVDNTLLD-LDGTDN-
ENO_TREPA         RDGDKER----YNGKGVLKAVGTVNTLIADTLEG--MDAL-NQGEIDHAMRN-LDGTDN-
ENO_MYCGE         RDNDPKN----YFGKGVNEAVDNVNKVIAPKLIG--LNAF-DQLTVDQAMIK-LDNTPN-
ENO_MYCPN         RDGDPKA----YFGKGVSQAVQNVNQTIAPKLIG--LNAT-DQAAIDALMIQ-LDGTPN-
ENO_UREPA         RDGDVNY----FFNKSVKLAIQNINNIIRPHLIN--KNVL-NFFELDNLLIN-LDGTEN-
ENO_PELUB         RDDNNKK----YLGKSVLGTVNLVNTKISKKLIG--TNIH-DQTRIDTILIN-LDGTRQ-
ENO_MYCPU         RDESTKYKDNWYASKGVQKAVDNVNNKIADLLIG--QNVL-DQRNIDNIMIE-ADGTEN-
ENO2_LACLA        RDGGDR-----LQGKGVSKAVANVNGEIYEALKG--QSPF-NQAKLDHLMIE-LDGTKN-
ENO_STRTR         RDGGAR-----LQGKGVSKAVANVNGEIYEALKG--QSPF-NQAKLDHLMIE-LDGTEN-
ENO_NEOSM         LDGDKAR----LSGRGVLRAVENVHTIIAPALMG--KSVA-AQAEIDSLLIQ-LDGTTN-
ENO_PYRAB         RDGGK-R----YHGKGVRRAVENVNKIIAPELVGMDVRWQ---REIDRLLIE-LDGTEN-
ENO_PYRHO         RDGGK-R----YHGKGVRRAVENVNKIIAPELIGMDVRWQ---REIDKLLIE-LDGTEN-
ENO_METJA         RDKEK-R----FGGKGVLMAVENVNSIIRPEILGYDARMQ---REIDTIMIE-LDGTPN-
ENO_COCLU         RDGDKTK----WGGKGVTKAVANVNDIIAPALIKEKLDVK-DQSAVDAFLNK-LDGTEN-
G0VDS4_NAUCC      RDGDKSK----WLGKGVLNAVANVNNVIAPAFVKANLDVK-NQQAVDDFLIN-LDGTAN-
J6EZG7_TRIAS      RDGG-DA----YVGKGVTKAVENVNNVIGPALIEAKIPVT-SQKEIDDLMIK-LDGTPN-
D8RLY3_SELML      RDGDKTV----FGGKGVLQAIANINDVIAPKLV--GVDTR-NQKDVDNIMLE-LDGTPN-
D0A1Y2_TRYB9      RDGDKKR----YVGKGCLQAVKNVNEVIGPALIG--RDEL-KQEELDTLMLR-LDGTPN-
B7GEF2_PHATC      RDGGD-R----YMGKGVLQAVQNVNDILGPAVMG--MDPV-GQGSVDDVMLE-LDGTPN-
G4YKG3_PHYSP      RDGGK-A----YMGKGVLNAVKNVNEIIAPALIG--KDVT-KQGELDRYMVEELDGTQNE
D8LWD6_BLAHO      RDGIKSE----HHGKGVMKAVHNVNSIIAPALIG--KDPL-NQEEIDKFMVEQLDGTKTE
F0ZJC2_DICPU      RDGDKSR----YLGKGVLNAVRNVEDIISKALFG--KDVL-NQVEIDNTMIK-LDGTKN-
ENO3_ARATH        RDGDKGM----YLGNSVAKAVKNINEKISEALIGMDPKLQ---GQIDQAMID-LDKTEK-
M4DPD7_BRARP      RDGDKGM----YLGNSVAKAVKNINERISEALIGMDPKLQ---AQIDHAMID-LDKTEK-
Q5KG11_CRYNJ      RDKGD-A----YGGKGVSKAVKAVNEVLGPALIQSGIKAS-EQAKIDQLLIQ-LDGTDN-
F8N224_NEUT8      RDHDKRK----YGGKGVLTAVNNVNEIIGPALVKEGYSSRRDLKQIDGFMRE-LDGTPN-
Q8SUA4_ENCCU      LDGGE-F----YNGRGVETVINNINQLVVKKMCELECNVG-DQQAIDNYLLG-LDGTKN-
A2E269_TRIVA      RDGDKAR----YGGKGTLKAAANVTEKLSPALKGMCFCDL---PALDKKICD-TDGTVL-
D2V522_NAEGR      RDGDKSR----FLGKGVLKAVKNVNETLSKAVEGKSLDSL---AEVDQALID-ADGDEL-
A1WLU9_VEREI      RDGGTRL-----GGYDVLTALDRVRSIIAPALIG--MAVT-DQAAIDATLDR-LDPSPT-
B1MFL1_MYCA9      RDGGGPF-----AGYDVTAAVAAARGL-AHHLVD--VDAA-NQQAVDAALTA-ADQSAE-
C5C344_BEUC1      RDGGTRY-----GGFGVRTAVAGLRDHLAPAVVG--LPAD-ETAAVDRALAD-AYARHG-
B8IXI8_METNO      RDGGEAW-----GGLGVSRAVSNIRGEIAALLEG--CDVL-DQVGLDNRIRE-ADGTHN-
ENO_SACS2         RD---------ENGLTVKRAVDIVNYIIDPALHG--IDVR-EQGIIDKLLKD-IDSTEN-
ENO_SULTO         RD---------KDG-GVTRAVELVNTLINDSLRD--FDVR-NQLGIDQTLIR-MDGTPN-
ENO_AERPE         RDGGGK-----WRGKGVSRAVSLLNTVVAPRLEG--VDAR-RQAQIDRLLIE-LDGTPN-
ENO_THEAC         SKS------------GIDASIQFFESKVKRSLIG--FNAL-DQSGFDKLLTD-IDGSGN-
ENO_THEVO         SKK------------GIDESIKFFETNVRRSIIG--FNAL-DQKGFDALITD-LDGSGN-
ENO_PICTO         PDN------------NIDNGIDFFYRHVKKALKG--FNSI-NQEGLDRMLHE-IDGTDN-
ENO_PYRAE         PEG------------GVDAALAAFEKLVAPEIVG--LDVT-EPYSTDGKLEE-VDGTQR-
A1RTI8_PYRIL      PEG------------GVDAALAAFEKLVAPEIVG--LDVS-EAYVVDGKLEE-VDGTPR-
A3MS45_PYRCJ      PEE------------GIDAAIAAFERLVAPEVVG--LDVS-EPYVVDGKLEE-VDGTAR-
A8MAB4_CALMQ      PDE------------GVDAAIDVFKRWVEPGLIG--MDAV-NQVAVDKKLEE-IDGTWD-
ENO_METTH         PSG------------GVDEIITEVEDIISSELIG--MDAV-DLQDIDLVLKE-IDGTEN-
ENO_HALMA         P---------------ANEAIAKAREEALPRLIG--EVHAGNQRDVDAALHA-ADGTDD-
ENO_HALSA         P---------------VGEAIAAGRERIAPRLEG--REFAGDQRGVDAALHA-ADDTTD-
ENO3_METHJ        D---------------PLLAIADAQGQVIPHLIG--IDSS-DQIGVDSLLHE-IDGTDN-
ENO_METLZ         P---------------CDEAVADAYINLIPKLIE--LDSA-DQRGFDDTLHE-VDGTSD-
ENO_ARCFU         S---------------PYR-YEEIEEEVSKAIIG--MSVF-DQESVDEALRE-LDGTDN-
A0RY13_CENSY      PDG------------GPEASLAAITG-SAGRFKG--LNPG-DSGAVHAAVRE-MDDTPD-
A9A429_NITMS      RNG------------RPEDSLQVLKE-NSQKFIG--LESS-DLKGIHDTLKS-FDNSSN-
K0IE56_NITGG      PEN------------KPEKALAAFNT-NAKKFIG--LQAE-NPQAVFDTLRS-IDKTDN-
                                                 .                 :          

ENO_HELPY         ----YANLGANAVLGVSMALARASAKALNLPLYRYLGGANAL---------TLPVPMLNI
ENO_HELPJ         ----YANLGANAVLGVSMALARASAKALNLPLYRYLGGANAL---------TLPVPMLNI
ENO_CAMJE         ----YSNLGANATLGVSMATARAAAAALGMPLYRYLGGANAS---------ILPVPMCNI
ENO_NOSS1         ----KSNLGANAILAVSLAAARAGAESLGIPLYRYLGGPLAN---------LLPVPLMNV
ENO_SYNY3         ----KKELGANAILGVSLATAKAAAAELAIPLYRYLGGPLAN---------VLPVPMMNV
ENO_DEIRA         ----KGNMGGNAILAVSLATARAAAAELDIPLYRYLGGSNAK---------TLPVPMMNV
ENO_BRUME         ----KGNLGANAILGVSLAVAKAAAQASGLPLYRYVGGTNAH---------VLPVPMMNI
ENO_RHILO         ----KSRLGANAILGVSLAVAKAAADAAGLPLYRYVGGTKAH---------ILPVPMMNI
ENO_RHIME         ----KSRLGANAILGVSLAVAKAAAEASGLPLYRYVGGPNAH---------LLPVPMMNI
ENO_CAUVC         ----KARLGANAILGVSLATAKAAAESAGLPLYKYVGGVNAR---------VLPTPMMNI
ENO_ZYMMO         ----KGKFGANAILGVSLAVAKAAAEARGLPLYRYVGGTAAH---------VLPVPMMNI
ENO_MYCLE         ----KSRLGGNAILGVSLAVAKAAADSAELPLFRYIGGSNAH---------ILPVPMMNI
ENO_MYCTU         ----KSRLGGNAILGVSLAVAKAAADSAELPLFRYVGGPNAH---------ILPVPMMNI
ENO_CHLMU         ----KEKLGANAILGVSLALAKAAAATLERPLYRYLGGAFSH---------VLPCPMMNL
ENO_CHLTR         ----KEKLGANAILGVSLALAKAAANTLQRPLYRYLGGSFSH---------VLPCPMMNL
ENO_CHLPN         ----KETLGANAILGVSLATAHAAAATLRRPLYRYLGGCFAC---------SLPCPMMNL
ENO_AQUAE         ----KSKLGANAILGTSMAVARAAANELGIPLYEYLGGKFGY---------RLPVPLMNV
ENO_THEMA         ----KSKLGANAILAVSMAVARAAANYLGLPLYKYLGGVNAK---------VLPVPLMNV
ENO_BACHD         ----KGKLGANAILGVSMAVARAAANALDLPLYVYLGGFNAK---------QLPVPMMNI
ENO_BACSU         ----KGKLGANAILGVSMACARAAADFLQIPLYQYLGGFNSK---------TLPVPMMNI
ENO_LISMO         ----KGKLGANAILGVSLAAARAAADELGVHLYEYLGGVNGK---------VLPVPMMNI
ENO_STRIT         ----KGKLGANAILGVSIAVARAAADYLEIPLYSYLGGFNTK---------VLPTPMMNI
ENO_STRPN         ----KGKLGANAILGVSIAVARAAADYLEIPLYSYLGGFNTK---------VLPTPMMNI
ENO_STRP1         ----KGKLGANAILGVSIAVARAAADYLEVPLYTYLGGFNTK---------VLPTPMMNI
ENO1_LACLA        ----KGKLGANAILGVSIAAARAAADELGVPLYNYLGGFNAK---------VLPTPMMNI
ENO_STAAM         ----KGKLGANAILGVSIAVARAAADLLGQPLYKYLGGFNGK---------QLPVPMMNI
ENO_STAAU         ----KGKLGANAILGVSIAVARAAADLLGQPLYKYLGGFNGK---------QLPVPMMNI
ENO_ENTFA         ----KGKLGANAILGVSIAVARAAADYLEVPLYHYLGGFNTK---------VLPTPMMNI
ENO_BORBU         ----KEKLGANAILAVSMATAKAAAKYLGLRPYQYLGAYKAN---------ILPTPMCNI
ENO_NEIMA         ----KGNLGANATLAVSMAVARAAAEDSGLPLYRYLGGAGPM---------SLPVPMMNV
ENO_NEIMB         ----KGNLGANATLAVSMAVARAAAEDSGLPLYRYLGGAGPM---------SLPVPMMNV
ENO_NITEU         ----KSRLGANAILAVSLAVAKAAAEESGLPLYRYLGGINAK---------WLPVPMMNL
ENO_RALSO         ----KGRLGANATLAVSMAVAKAAAEEAGLPLYRYFGGSGAM---------QMPVPMMNI
ENO_ECOLI         ----KSKFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPG-----KYSMPVPMMNI
ENO_SALTY         ----KSNFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPG-----KYSMPVPMMNI
ENO_YERPE         ----KSQFGANAILAVSLAAAKAAAASKGMPLYEHIAELNGTPG-----KFSMPLPMMNI
ENO_VIBCH         ----KSNFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPG-----VFSMPLPMMNI
ENO_HAEIN         ----KSNFGANAILAVSLANAKAAAASKGLPLYAYIAELNGTAG-----VYSMPLPMMNI
ENO_PASMU         ----KSKFGANAILAVSLANAKAAAAAKGMPLFAWIAELNGTPG-----QYSMPLPMMNI
ENO_BUCAI         ----KSKLGANAILSVSLAVAKAAAASKRMPLYAHIAEINETPG-----VFSMPLPMINI
ENO_PSEAE         ----KAKLGANAILAVSLAAAKAAAQAKGVPLYAHIADLNGTPG-----QYSMPVPMMNI
ENO_XYLFA         ----KGRLGANALLGVSLATAHAVAAARKQPLWMYLSTLGES-------KVSLPVPMMNI
ENO_DESVM         ----KSRLGANAMLGVSLATARAASSFLGLPLYQYLGGVNAK---------VLPVPLMNI
ENO_TREPA         ----KSKLGANAMLGVSMACARAAADFLGVPLYRYLGGVHTF---------RMPVPMANI
ENO_MYCGE         ----KAKLGANAILSVSLAVSKAAAKAQNSSLFQYISNKLIGLNT---TNFVLPVPMLNV
ENO_MYCPN         ----KAKLGANAILAVSLAVAKAAASAQKTSLFKYLANQVMGLNK---TEFILTVPMLNV
ENO_UREPA         ----KSKLGANALLGVSIAIVKAGAIAASKPLYQYIKEDLMHNYD---VNYYAPIPLMNF
ENO_PELUB         ----KTNLGANAILAVSMAAKKLSAKIKNVPLY---KTFLVKN------NYKLPYPLMNI
ENO_MYCPU         ----KSKFGANAILGVSLAAAHAGANFLQIPLYRYIGGINANM---------LPLPMLNV
ENO2_LACLA        ----KSRLGANAILGVSMAISRAAANSEKIPLYRYLGGVDLE----------LPQPFFNV
ENO_STRTR         ----KSCLGANAILGVSMAIFRAAANSEKIPLYRYFGGVDLE----------LPQPFFNV
ENO_NEOSM         ----KSVLGANAIVAVSLAVAKANASVRGVPLCIVFHNLLTSEGDD--FVYVPPVPMLNV
ENO_PYRAB         ----KSNLGANAILAVSLAVAKAAANALELPLYQYLGGV---------NAYVLPVPLSNV
ENO_PYRHO         ----KSNLGANAILAVSLAVAKAAANSLELPLYQYLGGV---------NAYVLPVPLSNV
ENO_METJA         ----KSRLGANAILAVSLAVAKAAAATAKIPLYKYLGGF---------NSYVMPVPMMNV
ENO_COCLU         ----KTKLGANAILGVSMAIAKAAAAEKGVPLYAHISDL---AGTK-K-PYVFRFLSKNV
G0VDS4_NAUCC      ----KSKLGANAILGVSLAAARAAAAEKNVPLYQHLAEI---SAAK-TTPYVLPVPFLNV
J6EZG7_TRIAS      ----KGKLGANAILGVSMAVTEAGAADKGLPLYAYIASL---AGVK-E-PYILPCPSFNV
D8RLY3_SELML      ----KSKLGANAILGVSLSVCRAGAGANGVPLYKHIQSI---AGIK-E--LVMPVPALNV
D0A1Y2_TRYB9      ----KGKLGANAILGCSMAISKAAAAAKGVPLYRYLASL---AGTK---ELRLPVPCFNV
B7GEF2_PHATC      ----KANLGANAILGVSLAVAKAGAAAKKVPLYRHFADL---AGNN-LDTYTMPVPCFNV
G4YKG3_PHYSP      WGWCKKKLGANAILGVSLALCRAGAAAKKQPLWQYIADL---AGNP-TP--CLPVPSFNI
D8LWD6_BLAHO      WGFLKSKLGANSILAVSMAVCRAGAAASHMPLYDYIATL---ADYP-IKPHHLPIPSFNI
F0ZJC2_DICPU      ----KSKLGANAIVGVSMAVARAAACEKGVPLYRYISEL---AGTN-I---RLPVPCFNV
ENO3_ARATH        ----KSELGANAILAVSIAACKAGAAEKEVPLCKHLSDL-----SG-RANMVLPVPAFTV
M4DPD7_BRARP      ----KNELGANAILAVSIAACKAGAAEKEVPLCKHLSDL-----SG-RANMTLPVPAFTV
Q5KG11_CRYNJ      ----KSKYGANAILGISMAAARAGAAEKGLELFEHLADLTFPQRDK-AKPYVLPVPCTNQ
F8N224_NEUT8      ----KAKLGANAILGVSMACARAGAAAANIPLYEFLRR----EGGE-EAPYMVPVPFFNV
Q8SUA4_ENCCU      ----KSRIGGNGITALSTAFCKMGAAYSNMRVDEFISGI------T-TFKRGIPVPHFNV
A2E269_TRIVA      ----KKNIGGNACTATSFALAEAGAAIQEIQLFEYLAKAFYGGADKVPKKFKLPSPFFNI
D2V522_NAEGR      ----KSNLGGNSITAASFALATAGAAVKNEELFLYLANAFHNGKTE-GLKYHLPTPMVNI
A1WLU9_VEREI      ----RQLLGGNATVATSLAALHSAAAVRQMPLWRYLNP---------AGVRHLARPEVQI
B1MFL1_MYCA9      ----FAAIGGNTAVAMSMAAAHAAAASHGIPLWRYLIG---------DKPAAMPLPEIQV
C5C344_BEUC1      ----QQEVGANATLAVSLAALLAAAASRDEPLARMLHP---------EGPLPLPMPMVNI
B8IXI8_METNO      ----LARFGANATLAVSIAAVRASAVATGIPLHRRLAELC-------GTTPSMPMPMVNI
ENO_SACS2         ----KSKLGGNTIIATSIAALKTASKALGLEVFKYISGPRLP---------KIPIPLLNI
ENO_SULTO         ----KSRVGGNTTIATSIAVAKTAAKAMGLEIFQYIGGPRVR---------YLPIPLLNI
ENO_AERPE         ----KSRLGGNTTTALSIAVSRAAAAQARLELFQYLGGAGAR---------RLPIPLLNV
ENO_THEAC         ----FSNLGGNLATALSMSVAKAAAQSLGIPLYRYVGG-IR---------STIPRPMGNV
ENO_THEVO         ----FSNLGGNLSTALSMSVAKAVSAHLGIPLYRYVGG-IN---------HSMPRPIGNV
ENO_PICTO         ----FSNLGGNIATAISIANAKAVSNALGIPMYRYVGG-IN---------YSMPRPIGNV
ENO_PYRAE         ----FEKIGGAVAIATSFAAAEAGAASLGVPLYSFIGGAYA---------RRLPLPLGNV
A1RTI8_PYRIL      ----FERIGGAVAIATSFAAAEAGAASLGVPLFSFIGGAYT---------RKLPLPLGNV
A3MS45_PYRCJ      ----FERIGGAVAIATSFASAEAGAASLGLPLFSFIGGAYA---------RRLPLPLGNV
A8MAB4_CALMQ      ----FSKIGGAVAVATSMANVVAVADSKGLWPYQVIGGSLA---------NVIPYPLGNT
ENO_METTH         ----LSSLGGNTVVAVSMATAKAAASSYNMPLYRFLGGNLA---------TSIPYPLGNM
ENO_HALMA         ----FSGIGANSAVAISMAAAKAGADVLGAPLYQHLGGTFRG--------NEYPTPLGNI
ENO_HALSA         ----FSAVGANVAVATSMAAAKAAADVLGVHTYQHLGGALRG--------RNFPVPLGNV
ENO3_METHJ        ----FSGIGANVAVALSLAMAKAAADATNIPLWQHIGGIFV---------DSAPRPLGNI
ENO_METLZ         ----LSGIGANIAVALSLANAKAAASTLNMELYQYLGGAFI---------SQTPLPLGNV
ENO_ARCFU         ----FSRIGGNFAITASLAVAKAAAEILGLPLYAYVGGVFA---------KELPYPLGNV
A0RY13_CENSY      ----YSIAGGASAFAITIAAAYSAAAAAGVPLYRVLDPNVE---------PRFPYPLGNV
A9A429_NITMS      ----YSEIGGALAFAVTIASMESASKALDQPLFKTLSNESS---------FKFPFPLGNI
K0IE56_NITGG      ----YSTIGGSVAYALSIAAVDSAARALNVPLFKLLKPAKP---------YKFPFPLGNI
                          *.      : :     :                                   

ENO_HELPY         INGGTHANN-SIDFQEYMIMPLGFESFKEALRA--SAEVYHTLKKLLDGK-NQLTS-VGD
ENO_HELPJ         INGGTHANN-SIDFQEYMIMPLGFESFKEALRA--SAEVYHTLKKLLDEK-NQLTS-VGD
ENO_CAMJE         INGGAHANN-NVDFQEFMIMPFGFTSFKEALRS--VCEIYAILKKELANS-GHSTA-LGD
ENO_NOSS1         INGGAHASN-NVDFQEFMIVPVGATSFREALRW--GAEVFATLSEVLHDK-GLLTG-VGD
ENO_SYNY3         INGGAHADN-NVDFQEFMIMPVGAETFKEALRW--GAEVFAVLGKVLKER-KLLSGGVGD
ENO_DEIRA         INGGAHADN-SVDFQEFMVMPVGAPSFREALRY--GAETFHHLKKVLSGR-GYNTN-VGD
ENO_BRUME         INGGAHADN-PIDFQEFMILPVGATSIREAVRY--GSEVFHTLKKRLKDA-GHNTN-VGD
ENO_RHILO         INGGAHADN-PIDFQEFMILPVGAPTLREGVRW--GSEIFHTLRKKLKDA-GHNTN-VGD
ENO_RHIME         INGGAHADN-PIDFQEFMIMPVGAETLKDAVRM--GSEVFHTLKKQLAAD-GHNTN-VGD
ENO_CAUVC         INGGAHADN-PIDIQEFMILPTGAKDFREGLRM--GAEIFHALKKALKDA-GHNTN-VGD
ENO_ZYMMO         VNGGMHADN-PIDFQEFMIAPVGASSINEAVRI--GTEVFHTLKKELSAK-GMNTN-VGD
ENO_MYCLE         LNGGAHADT-AVDVQEFMVAPIGAPSFVEALRW--GAEVYHALKSVLKKK-GLSTG-LGD
ENO_MYCTU         LNGGAHADT-AVDIQEFMVAPIGAPSFVEALRW--GAEVYHALKSVLKKE-GLSTG-LGD
ENO_CHLMU         INGGMHATN-GLQFQEFMIRPISAPSLTEAVRM--GAEVFHTLKKILQNR-QLSTG-VGD
ENO_CHLTR         INGGMHATN-GLQFQEFMIRPISAPSLTEAVRM--GAEVFNALKKILQNR-QLATG-VGD
ENO_CHLPN         INGGMHADN-GLGFQEFMIRPIGASSIKEAVNM--GADVFHTLKKLLHER-GLSTG-VGD
ENO_AQUAE         INGGAHADN-NLDIQEFMIVPVCGGAFREALRA--GVETFHHLKKILKEK-GYSTN-VGD
ENO_THEMA         INGGQHADN-NLDLQEFMIVPAGFDSFREALRA--GAEIFHTLKKILHEA-GHVTA-VGD
ENO_BACHD         INGGEHADN-NVDIQEFMIMPVGAESFKEALRT--GTEIFHSLKKVLKSK-GYNTA-VGD
ENO_BACSU         VNGGEHADN-NVDIQEFMIMPVGAPNFREALRM--GAQIFHSLKSVLSAK-GLNTA-VGD
ENO_LISMO         LNGGEHADN-NVDVQEFMVMPVGAPNFKEALRM--GAEILHALKAVLKGK-GLNTG-VGD
ENO_STRIT         INGGSHSDA-PIAFQEFMIVPAGAPTFKEALRW--GAEIFHALKKILKSR-GLATA-VGD
ENO_STRPN         INGGSHSDA-PIAFQEFMILPVGAPTFKEALRY--GAEIFHALKKILKSR-GLETA-VGD
ENO_STRP1         INGGSHSDA-PIAFQEFMIMPVGAPTFKEGLRW--GAEVFHALKKILKER-GLVTA-VGD
ENO1_LACLA        INGGSHSDA-PIAFQEFMIVPVGAPTFKEALRW--GAEIFHALKKILKAR-GLETA-VGD
ENO_STAAM         VNGGSHSDA-PIAFQEFMILPVGATTFKESLRW--GTEIFHNLKSILSKR-GLETA-VGD
ENO_STAAU         VNGGSHSDA-PIAFQEFMILPVGATTFKESLRW--GTEIFHNLKSILSQR-GLETA-VGD
ENO_ENTFA         INGGSHADN-SIDFQEFMIMPVGAPTFKEALRM--GAEVFHALASILKGR-GLATS-VGD
ENO_BORBU         INGGAHSDN-SVDFQEFMIMPIGAKTFSEAIRM--AAEVFHTLKGILSGK-GYATS-VGD
ENO_NEIMA         INGGEHANN-SLNIQEFMIMPVGAKSFREALRC--GAEIFHALKKLCDSK-GFPTT-VGD
ENO_NEIMB         INGGEHANN-SLNIQEFMIMPVGAKSFREALRC--GAEIFHALKKLCDSK-GFPTT-VGD
ENO_NITEU         VNGGVHANN-RLDMQEFMIIPLGLPNLREAVRC--GAEVFSTLRTLLNKR-NLPTT-VGD
ENO_RALSO         VNGGAHANN-SLDIQEFMVMPVGQQSFREALRC--GAEIFHALKKIIADK-GMSTA-VGD
ENO_ECOLI         INGGEHADN-NVDIQEFMIQPVGAKTVKEAIRM--GSEVFHHLAKVLKAK-GMNTA-VGD
ENO_SALTY         INGGEHADN-NVDIQEFMIQPVGAKTVKEAIRM--GSEVFHHLAKVLKGK-GMNTA-VGD
ENO_YERPE         INGGEHADN-NVDIQEFMIQPVGAKTLKEAVRI--GSEVFHHLAKVLKAK-GLNTA-VGD
ENO_VIBCH         INGGEHADN-NVDIQEFMIQPVGAKTLKEAVRM--GAEVFHNLAKVLKSK-GYNTA-VGD
ENO_HAEIN         INGGEHADN-NVDIQEFMIQPVGAKTLREALRI--GAEVFHNLAKVLKAK-GMSTA-VGD
ENO_PASMU         INGGEHADN-NVDIQEFMIQPVGAKTLKEALRI--GAEVFHNLAKVLKGK-GLSTA-VGD
ENO_BUCAI         INGGKHANN-NIDIQEFMIQPISAKTVKESIRI--GCEIFHALGELLKEK-GMSTT-VGD
ENO_PSEAE         INGGEHADN-NVDIQEFMVQPVGAKNFAEALRM--GAEIFHHLKAVLKAR-GLNTA-VGD
ENO_XYLFA         INGGAHADN-NVDFQEFMVLPVGFASFSEALRA--GTEIFHALKSVLKGQ-GLSTA-VGD
ENO_DESVM         INGGAHAPN-NLDIQEFMIMPIGAATFRDALRM--GAETFHTLKALLAAD-GHVTS-VGD
ENO_TREPA         INGGKHSDN-KIDFQEFMVMPIGAASMREAVRM--TAEVFHALKGLLAAD-GKATS-VGD
ENO_MYCGE         INGGAHADN-YIDFQEFMIMPLGAKKMHEALKM--ASETFHALQNLLKKR-GLNTN-KGD
ENO_MYCPN         INGGAHADN-NIDFQEFMIMPLGANSMHQALKM--ASETFHALQKLLKQR-GLNTN-KGD
ENO_UREPA         INGGAHADN-DLDIQEFMIVPLNAISFSQAIQI--GSEIFHQLDKLLKSN-HLSTT-KGD
ENO_PELUB         INGGAHANN-GLRIQEFMIRPDKAKNFSEAMRI--CFVVINNLKKLIIKK-GLSTS-VGD
ENO_MYCPU         INGGEHASN-TIDFQEFMIMPMGAKTFKESLQM--ANKVFHNLAKLLKKA-GHGTQ-VGD
ENO2_LACLA        INGGVHADS-GIDVQEFLITPVKRESFRDGLEK--IANIYHTLKKILADK-GLETA-VGD
ENO_STRTR         INGGVHADS-GIDVQEFLITPVKRDSFRDGLKK--IANIYHTLKKILSDK-GLKTP-VGD
ENO_NEOSM         INGGVHADN-RLAIQEFMICPVGRRSFRESMEK--AADVFHRLKGLLKQY-GKSTN-VGD
ENO_PYRAB         INGGVHAGN-DLDFQEFMIMPIGANSFREAIRW--VSETYHVLKKVIAEKYGKNAVNVGD
ENO_PYRHO         INGGVHAGN-ELDFQEFMIMPIGASSFREAIRW--VSETYHVLKRVIMGKYGKNAVNVGD
ENO_METJA         INGGKHAGN-DLDLQEFMIMPVGATSISEAVRM--GSEVYHVLKNVILEKYGKNAVNVGD
ENO_COCLU         LNGGSHAGG-FLLFQEFMIAP--AKTFAEALRIRQGAEVYQKLKALTKKTYGQSAGNYGD
G0VDS4_NAUCC      LNGGSHAGG-ALALQEFMIAPTGAKTFAEALRM--GSEVYHNLKSLTKKRYGSSAGNVGD
J6EZG7_TRIAS      INGGSHAGN-ALAFQEFMLLPTGASSFTEAMKI--GSETYHVLKKVIVKKYGIDAVNVGD
D8RLY3_SELML      INGGSHAGN-KLAMQEFMILPVGASSFAEAMQM--GCEVYHVLKGIIKKKYGQDACNVGD
D0A1Y2_TRYB9      INGGKHAGN-ALPFQEFMIAPVKATSFSEALRM--GSEVYHSLRGIIKKKYGQDAVNVGD
B7GEF2_PHATC      INGGSHAGN-KLAFQEYFVIPTGAKSFAEAMQI--GCEVYHTLGKIIKAKFGGDATLIGD
G4YKG3_PHYSP      INGGSHAGN-KLAMQEFMILPVGATSFTEAMKI--GSEVYHNLKKVIKGRYGLDATAVGD
D8LWD6_BLAHO      INGGAHSGN-ALAFQEFMILPVGASNFREAMRM--ASEVYQSLKKIIAQRYGTDSVNVGD
F0ZJC2_DICPU      INGGKHAGN-PLPIQEFMLVPLGAPSFAEALRY--GSEIYHVLKEVISKRYGLDATNVGD
ENO3_ARATH        LSGGKHASN-TFAIQEIMILPIGASRFEEALQW--GSETYHHLKAVISEKNGGLGCNVGE
M4DPD7_BRARP      LSGGNHASN-HFAIQEIMILPVGASRFEEALQW--GSETYHHLKAVVTEKNGNMGCNVGE
Q5KG11_CRYNJ      LNGGVHAGN-QLAPQEFMVLPTGATSFEEAMRI--VTECYHSLKSVITEKFGLAGTGIGD
F8N224_NEUT8      LNGGRHSGN-GMAFQELMIAPTGAKTIEEGIQM--ASETYCALKQIISDKFGAIYTGVGD
Q8SUA4_ENCCU      LNGGIHSGN-EMSVQEIMVAYQ-HDSLESNIES--GCVLYESLKRVISEKYGALYTSVGD
A2E269_TRIVA      LNGGKHAGG-NLKFQEFMVTPTRKVPFPDQLRM--VAEVYQKLGGLLVKKYGLSAKNLGD
D2V522_NAEGR      LNGGKHAGG-RLQIQEFMILPKENQSFREKLRC--VAEVYQHLGKILVEAAGPSAKNVGD
A1WLU9_VEREI      IGGGAHAAR-RVDLQDFMLIPLTAATIGDALVH--IAEVHLAVGALFAARG--PAHGVAD
B1MFL1_MYCA9      IGGGAHAAR-RTDVQDFMVVPAAANTIEEGLNW--LAEIHRACGAILSDRG--RLAGVAD
C5C344_BEUC1      VSGGAHAAG-AIDIQDVLVIPEGASTFAEAVEW--AARVRAAAAAVASGRGFAEAALVAD
B8IXI8_METNO      LSGGLHAGR-GMDVQDFLVIPIGASSYSEALDW--ICRVRTAAASICAKRG--ISTLLAD
ENO_SACS2         INGGLHAGN-KLKIQEFIIVPIKFNTFKEALFA--AIDVYRTLKGLITERYGKIYTAVGD
ENO_SULTO         LNGGLHAGN-ELKIQEFIIIPLSFDSFHEALYA--ADEVYKQLKGIITEKYGKLYTMLGD
ENO_AERPE         INGGVHAGN-ELDFQEFMIIPYGFESFTEAMRA--AVETYGELKSLLKDRYGASAVNVGD
ENO_THEAC         IGGGKHARN-GTSIQEFLVSAQGST-FLESAYI--NVLVHRRIGDMLSDKFKDISIGVGD
ENO_THEVO         IGGGKHARN-GTSIQEFLVSAQGKT-FMESAYV--NVLVHRKIGDILSEKMKDISIGVGD
ENO_PICTO         IGGGKHSKN-GTTIQEFLVSAQGKT-VLDSIYY--NILIHRRIGEILSGMFKNQSIGLGD
ENO_PYRAE         IGGGKHSRGLGPDIQEFLAMPLNPPDIYTAVYT--NVEIHKRVLKYILKVDTSFTGGKND
A1RTI8_PYRIL      IGGGRHSRGLGPDIQEFLTIPLNPPDIFTAVYT--NVEIHKRTLKYILKVDSSFTGGKND
A3MS45_PYRCJ      IGGGKHSRGLGPDIQEFLAIPLNPPDIFTAIYT--NVEIHKRALKGILKVDASFTGGKND
A8MAB4_CALMQ      IGGGKHSRGLGPDYQEFLILPYGAPDIYTAVYT--NMEVHREVGRILAKEDPTFAGGRND
ENO_METTH         INGGAHAGKNAPDIQEFLVVPVGAEDITEAVFA--NAAVHKRIRELIQKKDPSFAGGKGD
ENO_HALMA         IGGGEHAAD-ATNIQEFLAAPVGAPSVEEAVFA--NAAVHQEVHDILAD--RDLPAGKGD
ENO_HALSA         LGGGAHAAD-ATAIQEFLVAATGAPSVRQAVFA--NAAVHQRVKDRLDD--DGVPAAKGD
ENO3_METHJ        IGGGAHASH-ATQFQEFLVVPTGCERVRDGIFA--NAQVHKTVYDLLKK--RGIRAGKGD
ENO_METLZ         IGGGAHAVD-ATDIQEFLIVPTGASTAAEAVFT--NALVHKRIKEILIA--RGKGCGKGD
ENO_ARCFU         IGGGRHAEG-STSIQEFLVIPVGAKTFFEAQRA--NAAVHKQLKKIFKE--RGIFAAKGD
A0RY13_CENSY      LGGGAHAGPGSPDIQEILVCATGLRDIREAIEA--NLAVHKELGLVLRKKDRLFAGGKGD
A9A429_NITMS      LGGGAHAGPGTPDIQEILICATGAKTIEESIET--NLAVHKELRSVLEKEDPNFTNGRGD
K0IE56_NITGG      LGGGAHAGPGTPDIQEILACPVGAKGIVEALEM--NFKVHAETRKVIESIDRRFTYGRGD
                  :.** *:       *: :                                         :

ENO_HELPY         EGGFAPNFSNNVEPLEVISQAIEKAGYKLG-EE---IALALDVASSELVDENF----NYH
ENO_HELPJ         EGGFAPNFNNNVEPLEIISQAIEKAGYKLG-EE---IALALDVASSELVDEHF----NYH
ENO_CAMJE         EGGFAPNLANNTEPIDLLMTCIKKAGYE---NR---VKIALDVASTEFFKDG-----KYH
ENO_NOSS1         EGGFAPNLESNQVALELLVAAIEKAGYKPGEQ----VALALDVAASEFYKEGQ-----YV
ENO_SYNY3         EGGYAPNLTSNQQALDILIEAIEQAGYKPGSQ----IALAMDIAASEFFKNGQ-----YE
ENO_DEIRA         EGGFAPDLKSNEEALEVLLEAIQQAGYEPGKD----ICIALDPAVTELYKDGQ-----YH
ENO_BRUME         EGGFAPNLKNAQAALDFIMESIEKAGFKPGED----IALGLDCAATEFFKDGN-----YV
ENO_RHILO         EGGFAPNLKSAPVALDFIMESIEKAGFKPGEE----IALGLDCAATEFFKDGN-----YV
ENO_RHIME         EGGFAPGLASAPAALDFIMKSIEKAGYKPGED----MYVALDCASTEFFKDGK-----YV
ENO_CAUVC         EGGFAPNLASAEAALDFIVKAGEKAGYKAGDD----FVLGLDVASTEFFKNGK-----YE
ENO_ZYMMO         EGGFAPSLDSASSALDFIVDSISKAGYKPGED----VFIALDAASSEFYNKDQNI---YD
ENO_MYCLE         EGGFAPEVAGTTAALDLVTLAIEAAGFKPGAD----VALALDAAATEFYTDGIG----YH
ENO_MYCTU         EGGFAPDVAGTTAALDLISRAIESAGLRPGAD----VALALDAAATEFFTDGTG----YV
ENO_CHLMU         EGGFAPQLASNSEALDLLLAAIEKAGFIPGED----ISLALDCAASSFYNTQDKT---YD
ENO_CHLTR         EGGFAPNLASNAEALDLLLTAIETAGFTPRED----ISLALDCAASSFYNTQDKT---YD
ENO_CHLPN         EGGFAPNLASNEEALELLLLAIEKAGFTPGKD----ISLALDCAASSFYNVKTGT---YD
ENO_AQUAE         EGGFAPNLNSSEEALDILMQAIEKAGYKPGED----ILLALDVASSEFY--ENG---VYK
ENO_THEMA         EGGFAPNLSSNEEAIKVLIEAIEKAGYKPGEE----VFIALDCAASSFYDEEKG---VYY
ENO_BACHD         EGGFAPNLSSNEEALQTIIEAIEQAGYTPGEQ----VKLAMDVASSELYNKEDG---KYH
ENO_BACSU         EGGFAPNLGSNEEALQTIVEAIEKAGFKPGEE----VKLAMDAASSEFYNKEDG---KYH
ENO_LISMO         EGGFAPNLKSNEEALETIMQAIKDAGYKPGEE----VKLAMDAASSEFYNRETG---KYE
ENO_STRIT         EGGFAPRFDGTEDGVETILAAIEAAGYVPGKD----VFLGFDCASSEFYDKERK---VYD
ENO_STRPN         EGGFAPRFEGTEDGVETILAAIEAAGYVPGKD----VFIGFDCASSEFYDKERK---VYD
ENO_STRP1         EGGFAPKFEGTEDGVETILKAIEAAGYEAGENG---IMIGFDCASSEFYDKERK---VYD
ENO1_LACLA        EGGFAPKFDGTEDGVETILKAIEAAGYKAGEDG---VMIGFDCASSEFY--ENG---VYD
ENO_STAAM         EGGFAPKFEGTEDAVETIIQAIEAAGYKPGEE----VFLGFDCASSEFY--ENG---VYD
ENO_STAAU         EGGFAPKFEGTEDAVETIIQAIEAAGYKPGEE----VFLGFDCASSEFY--ENG---VYD
ENO_ENTFA         EGGFAPNLGSNEEGFEVIIEAIEKAGYVPGKD----VVLAMDAASSEFYDKEKG---VYV
ENO_BORBU         EGGFAPNLKSNEEACEVIIEAIKKAGYEPGKD----IAIALDPATSELYDPKTK---KYV
ENO_NEIMA         EGGFAPNLNSHKEALQLMVEATEAAGYKAGED----VLFALDCASSEFYKDGK-----YH
ENO_NEIMB         EGGFAPNLNSHKEALQLMVEATEAAGYKAGED----VLFALDCASSEFYKDGK-----YH
ENO_NITEU         EGGFAPSFARNEEALALIVQAIDEAGYQPGSE----VAIGVDCASSEFFREGK-----YH
ENO_RALSO         EGGFAPNFASNEECLNTILSAIEKAGYRPGED----VLLALDCAASEFYRDGK-----YH
ENO_ECOLI         EGGYAPNLGSNAEALAVIAEAVKAAGYELGKD----ITLAMDCAASEFYKDGK-----YV
ENO_SALTY         EGGYAPNLGSNAEALAVIAEAVKAAGYELGKD----ITLAMDCAASEFYKDGK-----YV
ENO_YERPE         EGGYAPNLGSNAEALAVIAEAVKAAGYELGKD----ITLAMDCAASEFYKDGK-----YV
ENO_VIBCH         EGGFAPNLKSNAEALEVIAEAVAAAGYKLGTD----ITLAMDCAASEFYDAEKK---EYN
ENO_HAEIN         EGGFAPNLASNADALACIKEAVEKAGYVLGKD----VTLAMDCASSEFYNKENG---MYE
ENO_PASMU         EGGFAPNLESNAAALACIKEAVEKAGYVLGKD----VTLAMDCASSEFYNKENG---MYE
ENO_BUCAI         EGGYAPNLKSNEEALNIIQDAIQKTKYKLGQD----IRLAIDCAASELYNKNEK---KYN
ENO_PSEAE         EGGFAPNLSSNEDALAAIAEAVEKAGYKLGDD----VTLALDCASSEFFKDGK-----YD
ENO_XYLFA         EGGFAPDLRSNVEALDAILEAIGRAGYIAGED----VLLGLDVASSEFRDNGK-----YN
ENO_DESVM         EGGFAPNLKNHDEAFRYIMKAIEEAGYIPGAE----IALAIDAAASEFHKDG-----KYV
ENO_TREPA         EGGFAPDLDN-EQALEYIMKAIAKAGLAPRKD----VCIALDCASSELFDEGDRRGYKFW
ENO_MYCGE         EGGFAPNLKLAEDALDIMVEAIKLAGYKPWDD----IAIAIDVAASEFYDEDKKL---YV
ENO_MYCPN         EGGFAPNLKLAEEALDLMVEAIKAAGYQPGSD----IAIALDVAASEFYDDTTKR---YV
ENO_UREPA         EGGFAPMLKNNYVTLELLVHAIKKAHYLPSKTQ--GVCLALDVAASELYENGK-----YF
ENO_PELUB         EGGFAPMISNNEKALDLVVAAINKSGFKNGKD----VSICLDVAANELMKKDK-----YS
ENO_MYCPU         EGGFAPNLKNHEEVLDFLMQAIEVAGFVASTSKEKGIAIAIDAASSELYDQSTGK---YT
ENO2_LACLA        EGGFAPKLGSTENAIATLYQAIESAGYVPGEE----IAIAIDPASSEFYDDKEK---VYR
ENO_STRTR         EGGFAPKLGTTENAIAILYQPIDSAGYFPGEK----IAIAIDSSSIEFYDDKKK---FYR
ENO_NEOSM         EGGFAPDLSSTEETLGLLSEAIGD----SKES----VKIALDAASSTFYKDGK-----YS
ENO_PYRAB         EGGFAPPMKEVTEPLDVLIKAIEEAGYKPGEE----IALALDAASSEFYK---DG--KYI
ENO_PYRHO         EGGFAPPMKEVTEPLDALIKAIEEAGYKPGDE----IALAIDAASSEFFK---DG--KYI
ENO_METJA         EGGFAPPLKTSREALDLLTESVKKAGYE--DE----VVFALDAAASEFYK---DG--YYY
ENO_COCLU         EGGVAPDIQTAEEALDLIVDAIEAAGHTGQIK----IAM--DVASSEFFK-DDEK--KYD
G0VDS4_NAUCC      EGGVAPNIQTAEEALDLIVDSIKAAGHEGKIQ----IGL--DCASSEFFK-DG----KYD
J6EZG7_TRIAS      EGGFAPNVSGAEEALELLTEAIKAAGYTGKIQ----IGL--DVASSEFYK-DG----KYD
D8RLY3_SELML      EGGFAPNIQDNREGLVLLVDAIEKAGYTGKVK----LGM--DVAASEFYK-SG----KYD
D0A1Y2_TRYB9      EGGFAPPIKDINEPLPILMEAIEEAGHRGKFA----ICM--DCAASETYD-EKKQ--QYN
B7GEF2_PHATC      EGGFAPPCDN-REGCELIMEAISKAGYDGKCK----IGL--DVAASEFKV-KGKD--EYD
G4YKG3_PHYSP      EGGFAPNIQSNGEAIDLIEEAIKAAGYTNQVR----LGM--DVAASEFYTGAEDA--RYN
D8LWD6_BLAHO      EGGFAPNI-TNCESGHACHPAMHSVGYEGKVK----IAL--DVAASEFYD-RESK--RYN
F0ZJC2_DICPU      EGGFAPPILDIKDAFDILVNAIDLAGYTGKVK----IGF--DSAASEFLD-QKTN--NYD
ENO3_ARATH        DGGLAPDISSLKEGLELVKEAINRTGYNDKIK----IAI--DIAATNFC---LGT--KYD
M4DPD7_BRARP      DGGLTPDISSLKEGLELVKEAINRTGYGDKIK----IAI--DVAATNFC---IGT--KYD
Q5KG11_CRYNJ      EGGFAPPVDSIDQALDLLVEASAKAGHSNNVH----FAI--DPASSEFF---KDG--VYD
F8N224_NEUT8      EGGFAPPITQPEEALDLLTEAVAKAGYTDKIK----FGI--DAASSEFFN-PENG--TYD
Q8SUA4_ENCCU      EGGFAPPIKKLEEGLDLILEASRRCNRTD-MK----IAI--DFAANGFM---RDG--KYE
A2E269_TRIVA      EGGFAPNLNDPEEALSVIEEAIKAAGYEAGKD----IMIGMDVASSEFYD-EEKK--LYE
D2V522_NAEGR      EGGFAPNLETADEALNYIEQAIVKAGYKVGED----VFLALDAASSEFYD-SETK--KYE
A1WLU9_VEREI      EGGHWPALARNEQALELLTLGIERAGFRPGID----LGISLDIAASEFER-----GGSYH
B1MFL1_MYCA9      EGGWWPMVDSNEDALELLVASIERAGLQPGTQ----ATIALDIASTEFGS-----GGRYR
C5C344_BEUC1      EGGLGLRLGTNEAALQLVAEAVDAAGLGLGTD----VTIAIDAAATEFAS-----DGRYA
B8IXI8_METNO      EGGLSPGFATSEEALSLMVEAFEQAGLEPGVQ----AAIALDVASSSLASA----NGAYA
ENO_SACS2         EGGFSPPLEDTREALDLIYTSINNAGYE--GK----IYMGMDAAGSDFYDSKK---EKYI
ENO_SULTO         EGGVAPPLSKTEDALDLVYTAIKNSGYE--DK----IVMGIDAASSDFFNG-----SQYE
ENO_AERPE         EGGFAPPMRSAEEALKTLVDAVEKAGYQPGSE----IALGIDAAASQLYSN-----GRYS
ENO_THEAC         ERTWSVNLSD-EEAFEILNEAVKEISSEKKVK----IYTGVDFAADSLYENG-----KYV
ENO_THEVO         ERAWSVNISD-EEAFEVLNQAVNEVSSETKVK----IYTGLDFAADSLYENG-----KYV
ENO_PICTO         EKAWTCDISD-EDAIEIIKNASKDISSEYKIK----VLNGVDFAADSFYDGN-----YYI
ENO_PYRAE         EGAWTPRISS-TTALKILREAAREVSGELGVE----VGIGVDVAASSLWNGE-----KYV
A1RTI8_PYRIL      EGAWTPRISS-HTALKILREVAKEVEKELGVE----VGVGVDVAASSLWDGK-----KYV
A3MS45_PYRCJ      EGAWTPRISS-RTALRILKETAEEVGKEVGVE----VGIGVDVAASSLWNGE-----RYV
A8MAB4_CALMQ      EGAWTAKIST-DKALEVLSSAVKEVSRRLGVE----IGLGIDAASSSMWNGK-----AYV
ENO_METTH         EGGWVPSLSN-GDALEIQATACEEVTDELGVE----VRPSLDLAASEFWDPEIE---KYV
ENO_HALMA         EGAWAPSVSD-DEAFEIMDEAVETVADDFGFA----ISFGLDVAGAELYDDEAD---GYV
ENO_HALSA         EGAWAPSIDD-ATAFDVVAGAAAEVADEFGFD----VRLGLDLAAAERYD--GD---EYV
ENO3_METHJ        EGAWAPPISD-PEAFRILAEAISLVSDETGFE----ISPGIDAAASQLYDPESG---MYR
ENO_METLZ         EGGWAPHIAD-LEAFEIVNEATTKVFDETGIE----VRMGLDVAASEMWDAASG---RYV
ENO_ARCFU         EGAWAAQISD-EQAFEILSEAIQRVEDELGVK----VRMGIDVAATELWD--GE---RYV
A0RY13_CENSY      EGGWAPRACS-AEALEMAAEACENLGYALGKE----VSLGVDFAASTQWDREKG---AYS
A9A429_NITMS      EGGWAPKLEN-QKALEVSAMACENLGFTLGKE----VSLGVDFASSTQWNEEKS---KYV
K0IE56_NITGG      EGAWAPNVNN-DQALEIVEKAVRNCGYTLGKD----MAIGIDFASSSFWDEKNN---VYN
                  :                                        * :              : 

ENO_HELPY         LKGEN-----------------KILDSHELVAYYKELVAKYP----IVSIEDGLSEDDWE
ENO_HELPJ         LKGEN-----------------KILDSHELVAYYKELVAKYP----IVSIEDGLSEDDWE
ENO_CAMJE         MEG-------------------KAFSSEALIERYVELCAKYP----ICSIEDGLAENDFE
ENO_NOSS1         YD--G-----------------RPHAPTEFIDYLGQLVDQYP----IVSIEDGLHEEDWQ
ENO_SYNY3         YD--G-----------------GSHSPQEFIDYQAKLVSQYP----IVSIEDGLHEDDWE
ENO_DEIRA         LESEG-----------------RVLSSDEMIDFWADWTSRYP----IVSIEDGLAEDDWD
ENO_BRUME         YEGER-----------------KTRDPKAQAKYLAKLASDYP----IVTIEDGMAEDDWE
ENO_RHILO         YEGEK-----------------KTRDPKAQAKYLAKLAADYP----IVSIEDGLAEDDWE
ENO_RHIME         LEGEG-----------------RTLEPGAMAEYLAELAGKYP----IISIEDGMAEDDWD
ENO_CAUVC         LEGEG-----------------KSLDPAAMVDYLAGLVAKFP----ILTIEDGMAEDDFD
ENO_ZYMMO         LKGEG-----------------RKLTSAQLVDYYVELCGKYP----IYSIEDGLAEDDFE
ENO_MYCLE         FEGMT-----------------HTAD--QMTEFYADLLGSYP----LVSIEDPLSEDDWD
ENO_MYCTU         FEGTT-----------------RTAD--QMTEFYAGLLGAYP----LVSIEDPLSEDDWD
ENO_CHLMU         GK-----------------------SAADQVAVLTELCDRYP----IDSIEDGLAEEDFE
ENO_CHLTR         GK-----------------------SYADQVGILAELCEHYP----IDSIEDGLAEEDFE
ENO_CHLPN         GR-----------------------HYEEQIAILSNLCDRYP----IDSIEDGLAEEDYD
ENO_AQUAE         FEGKE-------------------RSAEEMIEFYEKLIQKYP----IISIEDPMSENDWE
ENO_THEMA         VDGEE-------------------KSSEVLMGYYEELVAKYP----IISIEDPFAEEDWD
ENO_BACHD         LSGE-----------------GKVLSSEEMVAFYEELVAKYP----IISIEDGLDENDWE
ENO_BACSU         LSGE-----------------GVVKTSAEMVDWYEELVSKYP----IISIEDGLDENDWE
ENO_LISMO         LKGE-----------------GVTRTSEEMVTWYEEMITKYP----IISIEDGLDENDWD
ENO_STRIT         YTKFEGE-------------GAAVRTADEQIDYLEELVNKYP----IITIEDGMDENDWD
ENO_STRPN         YTKFEGE-------------GAAVRTSAEQIDYLEELVNKYP----IITIEDGMDENDWD
ENO_STRP1         YTKFEGE-------------GAAVRTSAEQVDYLEELVNKYP----IITIEDGMDENDWD
ENO1_LACLA        YTKFEGE-------------GGKKLSASEQVDYLEELVSKYP----IITIEDGMDENDWD
ENO_STAAM         YSKFEGE-------------HGAKRTAAEQVDYLEQLVDKYP----IITIEDGMDENDWD
ENO_STAAU         YSKFEGE-------------HGAKRTAAEQVDYLEQLVDKYP----IITIEDGMDENDWD
ENO_ENTFA         LADS-GE-------------G--EKTTEEMIAFYEELVSKYP----IISIEDGLDENDWD
ENO_BORBU         LKWS----------------TKEKLTSEQMVEYWAKWVEKYP----IISIEDGMAEEDWD
ENO_NEIMA         LEAEG-----------------RSYTNAEFAEYLEGLVNEFP----IISIEDGMDENDWE
ENO_NEIMB         LEAEG-----------------RSYTNAEFAEYLEGLVNEFP----IISIEDGMDENDWE
ENO_NITEU         LDVDG-----------------LGLTSAQFVDYLATWVEKYP----IISIEDGMSEQDWE
ENO_RALSO         LDGEG-----------------LQLSSVDFANYLANLADKFP----IVSIEDGMHESDWD
ENO_ECOLI         LAGEGN----------------KAFTSEEFTHFLEELTKQYP----IVSIEDGLDESDWD
ENO_SALTY         LAGEGN----------------KAFTSEEFTHFLEELTKQYP----IVSIEDGLDESDWD
ENO_YERPE         LAGEGN----------------KAFTSEEFTHFLEDLTKQYP----IVSIEDGLDESDWA
ENO_VIBCH         LKGEG-----------------RIFTSNGFSDFLEELTEKFP----IVSIEDGLDESDWE
ENO_HAEIN         MKGEG-----------------KSFTSQEFTHYLEELCKEYP----IVSIEDGQDESDWE
ENO_PASMU         MKGEG-----------------KSFTSQEFTHYLEELCKEYP----IVSIEDGQDESDWE
ENO_BUCAI         LKGEN-----------------ISFSSKEFTHYLEKLSQKYP----IVSIEDGQDESDWE
ENO_PSEAE         LEGEG-----------------KVFDAAGFADYLAGLTQRYP----IISIEDGMDESDWA
ENO_XYLFA         LVGEN-----------------KRLTSEQFVDFLDDWVTQYP----IISIEDGLAEDDWA
ENO_DESVM         LAGEG-----------------KNLSNSEMVEWLGEFTTRYP----LISIEDGLAEADWD
ENO_TREPA         KSNPG-----------------KLFTAQEMIDLYKKWIATYP----IVSIEDPLDQNDWA
ENO_MYCGE         FKKGIKANILN--------AKDWSLTSKEMIAYLEKLTKKYP----IISIEDGLSENDWE
ENO_MYCPN         FKKGIKAKILD--------EKEWSLTTAQMIAYLKKLTEQYP----IISIEDGLSEHDWE
ENO_UREPA         FKKSSSHNIT---------LEQTSFSSDEWIKYWSKLVSMFP----IISIEDCFEENDWN
ENO_PELUB         IH------------------SKKFVSVDQSIKEYKKIINKYK----IKSIEDPFGENDWM
ENO_MYCPU         FKKLKQAIKTKQPGFENVEKTKLDFTSDELIAYYGELISKYP----IISIEDGFAESDWQ
ENO2_LACLA        FEGQK-------------------LTSKELLTYYENLVEKYPA---LISIEDGFSEHDWE
ENO_STRTR         FEGKN-------------------LTSKELLTYYDNLVEKYPA---LISIEDGFSEHDWE
ENO_NEOSM         IDGKL-------------------LNVNEMVDFYAAIIEKYD----IVSIEDPLYESDWE
ENO_PYRAB         VSGKE-------------------YTREELLELYKELTSTYP----IVSIEDPFHEEDWE
ENO_PYRHO         VGGKE-------------------YTREELLDLYKELVSTYP----IVSIEDPFHEEDWE
ENO_METJA         VEGKK-------------------LTREELLDYYKALVDEYP----IVSIEDPFHEEDFE
ENO_COCLU         LDFKNPDSD-----------KSKWLTYPQLAEMYKSLAEKYP----IVSIEDPFAEDDWE
G0VDS4_NAUCC      LDFKNPESD-----------SSKWLTGPQLADLYHSLMKKYP----IVSIEDPFAEDDWE
J6EZG7_TRIAS      LDFKNPNSD-----------PSKYLTGEQLGDLYHSYCEKYD----ICSIEDPFQEDDFD
D8RLY3_SELML      LDFKDQSSS-----------GKNIYTGEELGNLYMEFVRDFP----IVSIEDPFDQDDWS
D0A1Y2_TRYB9      LTFKSP--------------EPTWVTAEQLRETYCKWAHDYP----IVSIEDPYDQDDFA
B7GEF2_PHATC      LDFKY---------------DGDIVSGEELGNLYQSLAADFP----IVTIEDPFDEDDWE
G4YKG3_PHYSP      LDFKNENAP-----------ESEKISADKLQEVYEGFIAKCAGSSKIVSIEDPFDQDDWA
D8LWD6_BLAHO      LLKKVKGSG-----------EEGKVDAATLLGFYEKLVEEYP----IEVIEDGFDEDDFE
F0ZJC2_DICPU      LDFKKKAAGTG---------KSSLVTPDALADMYSKFIEQYP----IVFIEDPFGEEDWS
ENO3_ARATH        LDIKSPNKSGQN-----------FKSAEDMIDMYKEICNDYP---IVS-IEDPFDKEDWE
M4DPD7_BRARP      LDIKSPNKSGQN-----------FKSAEDMIDMYKELCAEYP---IVF-IEDPFDKEDWE
Q5KG11_CRYNJ      LDFKSTDQLETH--------R--CLSPDQMASLYNDLISKYP---LIL-LEDPFAEDDWD
F8N224_NEUT8      LGFKRIKEGESH--------SDDVRTPAEMMELYKSLIEKYP---IPL-LEDPFAEDDWE
Q8SUA4_ENCCU      LDGETY-------------------TTKSLGERYIEILKEYP---QVYSLEDPFSERDYD
A2E269_TRIVA      VEVGK------------------FLNADQMIDYFDDLLKRHP---AIVSIEDALAELDYE
D2V522_NAEGR      ITQGKD-----------------YYTSEEMVEYYAQLVERHP---AIVSIEDGLEEKDYE
A1WLU9_VEREI      LAAEK-----------------RSFSRTEWLAVVGQWLQAYP----IIAIEDPASEHDPI
B1MFL1_MYCA9      LGLDG-----------------TELDSDAWSEVLIGWIDKYP----IASIEDPLAEDDPA
C5C344_BEUC1      LAAED-----------------RALSAEEMVELYAEWVARYP----IRSIEDPLAEDDWD
B8IXI8_METNO      FARQG-----------------RSFGAREMIELQRQWAASFP----IVSIEDGLGEDDWA
ENO_SACS2         IDGRE-------------------LDPNQLLEFYLDLVKQYP----IVYLEDPFEENSFD
ENO_SULTO         IDGKK-------------------LSPDEMIDYYIQLASRYP----LLYIEDPFNENDFE
ENO_AERPE         VEGKS-------------------LSREELLSLYQRLVEQYP----IVYLEDPFSEDDYE
ENO_THEAC         YKHTTKS-----------------RD--EQIDYAISISKDFG----VYYIEDPMYDTDFD
ENO_THEVO         YKHTVRS-----------------RD--EQIDYAISINKDFG----VYYIEDPMFDTDFE
ENO_PICTO         YKNRKLT-----------------RD--QQIDYAISISRDHG----FYYIEDPLNDQDFD
ENO_PYRAE         YKNEGVE-----------------RDPREQFEFIAKLIEEYD----LVYVEDPFHEEDFQ
A1RTI8_PYRIL      YKNEGAE-----------------RGPREQMEFITKLIEEFD----LVYVEDPFHEEDFQ
A3MS45_PYRCJ      YKNEGVE-----------------RGPREQLEFIAKLIEEFD----LVYVEDPFHEEDFQ
A8MAB4_CALMQ      YTNEGRE-----------------LTPREHFERIKSIIEKYD----LIYIEDPFHEEDFQ
ENO_METTH         YRQENVQ-----------------KDTGEQIEFVKEIIETYD----MYYVEDPLHEGDLE
ENO_HALMA         YD-DGV------------------KSTEEQIEYIAGKVEEYD----LVYVEDPLDENDYE
ENO_HALSA         FG-DDR------------------RSTAAQIEYVAGLVSEYD----LAYVEDPLDENDFE
ENO3_METHJ        YR-DGTV-----------------RSPEDQVTYIADLIDEFD----LIYVEDPLYEEDYE
ENO_METLZ         YK-NAK------------------RTTEEQIAYIADLTEKYN----LIYVEDPIQEEDFE
ENO_ARCFU         YS-DRK------------------LTTEEQIAYMAELADRYD----LLYIEDPLHEKDFE
A0RY13_CENSY      YSRDGFE-----------------NSPGEQIDYAAGIIEKYK----LIYAEDAVHEEEFD
A9A429_NITMS      YDRAGFE-----------------NTTSEQIDFAADIIEKFK----LIYAEDAVHEEAFE
K0IE56_NITGG      YARQGIK-----------------RDTGEQIEFASRLVRDYK----LVYAEDPVHEGDFE
                                                                    **   .    

ENO_HELPY         GWAFLSKEL--GRQIQLVGDDLFVTNASLLQKGIEKNIANAVLIKPNQIGTISETLETIR
ENO_HELPJ         GWAFLSKEL--GRQIQLVGDDLFVTNASILQKGIEKNVANAILIKPNQIGTISETLETIR
ENO_CAMJE         GWIKLTEKL--GNKIQLVGDDLFVTNEDILREGIIKKMANAVLIKPNQIGTITQTMRTVR
ENO_NOSS1         HWQLLTQKV--GSRVQLVGDDLFVTNATRLQKGIQEKAGNAILIKLNQIGSLTETLETID
ENO_SYNY3         SWKGLTTSL--GTKTQLVGDDLMVTNPVRLQKSIDLGVANAILIKLNQIGTLSETLETIS
ENO_DEIRA         GWERLTAKV--GAKTQLVGDDLFVTNPERLQQGIDRKVGNAILVKVNQIGSLTESMDAIE
ENO_BRUME         GWKYLTDLI--GNKCQLVGDDLFVTNSARLRDGIRLGVANSILVKVNQIGSLSETLDAVE
ENO_RHILO         GWKYLTDLI--GKKTQLVGDDLFVTNTARLRDGIRMGVANSILVKVNQIGSLTETLDAVE
ENO_RHIME         GWKSLTDLV--GNKCQLVGDDLFVTNSARLRDGIKMGVANSILVKVNQIGSLSETLDAVE
ENO_CAUVC         GWKLLTDTL--GKKVQLVGDDLFVTNPKRLQMGLDKGLANSILVKVNQIGTLSETIDAVE
ENO_ZYMMO         GWKILTEKL--GDKVQLVGDDLFVTNVKRLSDGIERGIANSLLVKFNQIGSLSETLAAVN
ENO_MYCLE         GWAALTASI--GEQVQIVGDDIFATNPERLEEGIGRGVANALLVKVNQIGTLTETLEAVA
ENO_MYCTU         GWAALTASI--GDRVQIVGDDIFVTNPERLEEGIERGVANALLVKVNQIGTLTETLDAVT
ENO_CHLMU         GWKLLSETL--GDRIQLVGDDLFVTNSALIAEGIAQGLANAVLIKPNQIGTLTETAEAIR
ENO_CHLTR         GWKLLSETL--GDRVQLVGDDLFVTNSALIAEGIAQGLANAVLIKPNQIGTLTETAEAIR
ENO_CHLPN         GWALLTEVL--GEKVQIVGDDLFVTNPELILEGISNGLANSVLIKPNQIGTLTETVYAIK
ENO_AQUAE         GWKEITKRL--GDKVQLVGDDLFTTNPKILRKGIEEGVANAILVKLNQIGTVSETLDTVM
ENO_THEMA         AFVEFTKRV--GNKVQIVGDDLYVTNVKRLSKGIELKATNSILIKLNQIGTVTETLDAVE
ENO_BACHD         GHKMLTDRL--GDKVQLVGDDLFVTNTKKLAQGIEQGVGNSILIKVNQIGTLTETFDAIE
ENO_BACSU         GHKLLTERL--GKKVQLVGDDLFVTNTKKLSEGIKNGVGNSILIKVNQIGTLTETFDAIE
ENO_LISMO         GFKLLTERI--GDRVQLVGDDLFVTNTTKLKEGIEKGIANSILIKVNQIGTLTETLDAIE
ENO_STRIT         GWKKLTERL--GKKVQPVGDDFFVTNTSYLEKGINEACANSILIKVNQIGTLTETFDAIE
ENO_STRPN         GWKALTERL--GKKVQLVGDDFFVTNTDYLARGIQEGAANSILIKVNQIGTLTETFEAIE
ENO_STRP1         GWKVLTERL--GKRVQLVGDDFFVTNTEYLARGIKENAANSILIKVNQIGTLTETFEAIE
ENO1_LACLA        GWKILTERL--GKKVQLVGDDFFVTNTKYLERGIRENASNAILIKVNQIGTLTETFEAIE
ENO_STAAM         GWKQLTERI--GDRVQLVGDDLFVTNTEILAKGIENGIGNSILIKVNQIGTLTETFDAIE
ENO_STAAU         GWKQLTERI--GDRVQLVGDDLFVTNTEILAKGIENGIGNSILIKVNQIGTLTETFDAIE
ENO_ENTFA         GFKKLTEVL--GDKVQLVGDDLFVTNTTKLAEGIEKGIANSILIKVNQIGTLTETFEAIE
ENO_BORBU         GWKKLTDKI--GNKIQLVGDDLFVTNTSFLKKGIEMGVANSILIKVNQIGTLTETFEAVE
ENO_NEIMA         GWKLLTEKL--GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVD
ENO_NEIMB         GWKLLTEKL--GGRVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVD
ENO_NITEU         GWGLLTERL--GKTVQLVGDDVFVTNTRILKEGISRNIANSILIKINQIGTLTETLNAIE
ENO_RALSO         GWKVLTEKL--GNKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIE
ENO_ECOLI         GFAYQTKVL--GDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIK
ENO_SALTY         GFAYQTKVL--GDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIK
ENO_YERPE         GFKYQTEVL--GDKIQLVGDDLFVTNTKILKEGIEKGVANSILIKFNQIGSLTETLAAIK
ENO_VIBCH         GFAYQTEKL--GKKIQIVGDDLFVTNTKILKRGIDNGIANSILIKFNQIGSLTETLAAIK
ENO_HAEIN         GFAYQTKVL--GDRVQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIK
ENO_PASMU         GFAYQTKVL--GDKVQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIK
ENO_BUCAI         GFLYQTHVL--GNKIQLVGDDLFVTNKNILKKGIKKGIANSILIKLNQIGTLTETLEAIK
ENO_PSEAE         GWKGLTDKI--GAKVQLVGDDLFVTNTKILKEGIEKGIGNSILIKFNQIGSLTETLEAIQ
ENO_XYLFA         GWKQLTERI--GHKVQLVGDDLFVTNPKVFQEGITSGIANAILIKLNQIGTLTETLESIA
ENO_DESVM         GWRELTYKL--GDTIQLVGDDIFVTNPDILAEGIDEGVANSILIKLNQIGTLTETLDTIE
ENO_TREPA         GYVQLTKEL--GDKVQIVGDDFFVTNTGRLARGIKEGSCNSILIKLNQIGTVTETVDAVR
ENO_MYCGE         GMNQLTKTI--GSHIQIVGDDTYCTNAELAKKGVAQNTTNSILIKLNQIGSISETIQTIE
ENO_MYCPN         GMETLTKTL--GQHIQIVGDDLYCTNPAIAEKGVAHKATNSILIKLNQIGTLTETIKAIN
ENO_UREPA         SFALFLKN---NPHIQVVGDDLYCTNLKYLQKGIDFKATNAILIKPNQIGTISETLDVIK
ENO_PELUB         AWSKLMKN---TNNVQIVGDDLYVTNLERLKKGFLNNSSNSILIKLNQIGTVSETLEVIK
ENO_MYCPU         GFAKFTKIY--GEKLQIVGDDLTVTNSKILERAIKEKSMNSILVKLNQIGSLSETLDTIN
ENO2_LACLA        GFAAQTKAQ--GQKIQLVGDDIFVTNPEIFKEGIKKGVANAILIKLNQIGTVTEAIEAIS
ENO_STRTR         GFAAQTKAR--GQKIQLVGDDIFVTNPTIFKEGIKKNVANAILIKLNQIGTVTETIETIS
ENO_NEOSM         SWQVMTRKL--SDKIHIVGDDIFVTNPKIIKKGIKTGVANAVLVKINQVGTVTETIESIK
ENO_PYRAB         GFVMITRELG--KKVQIVGDDLFVTNPKRLKKGIEMGAANALLLKVNQIGTLTEAMDAAY
ENO_PYRHO         GFVMITNELG--KKIQIVGDDLFVTNPRRLKKGIELGAANALLLKVNQIGTLTEAMDAAY
ENO_METJA         GFAMITKEL----DIQIVGDDLFVTNVERLRKGIEMKAANALLLKVNQIGTLSEAVDAAQ
ENO_COCLU         AWSHF--YKD--GDFQIVGDDLTVTNPEFIKTAIELKSCNALLLKVNQIGTISEAINAAK
G0VDS4_NAUCC      AWSHF--FKT--AGIQIVADDLTVTNPARIATAIEKKAADALLLKVNQIGTLSESIKAAN
J6EZG7_TRIAS      AWTAY--NKT--AKIQIVGDDLLVTNPLRIKTAIEKKACNALLLKINQIGTISESIQAVQ
D8RLY3_SELML      SWKNL--QSQ--CDVQLVGDDLLVTNPKRIAEGISKNACNALLLKVNQVGSVTESIQAAL
D0A1Y2_TRYB9      GFAGI--TEALKGKTQIVGDDLTVTNTERIKMAIEKKACNSLLLKINQIGTISEAIASSK
B7GEF2_PHATC      NWSKF--TTKNGATFQVVGDDLTVTNIEKIERAIDEKACTCLLLKVNQIGSISESIAAVT
G4YKG3_PHYSP      SWVKFTAKVGE--DVQIVGDDLTVTNPTRVKKAIEQKACNALLLKVNQIGSITESIEAVT
D8LWD6_BLAHO      GWRAMREKLGSRIGITIVGDDLTVTNILRIENAIEKGCCNALLLKVNQIGSVTEAIQAVR
F0ZJC2_DICPU      SFKKF----TSVSRVPIIGDDLLCTNPERIKRAIKEKTCNSLLLKINQIGTLSETIEAAN
ENO3_ARATH        HTKYFSS----LGICQVVGDDLLMSNSKRVERAIQESSCNALLLKVNQIGTVTEAIEVVK
M4DPD7_BRARP      HTKYFSN----LGICQVVGDDLLMSNSKRVERAIQESACNALLLKVNQIGTVTEAIEVVK
Q5KG11_CRYNJ      SWTKFMEK--INGRIEVVGDDLLCTQVSRVKMAKKASACDGLLLKINQCGTISEAIEAAQ
F8N224_NEUT8      SWVKFCKD--FYFE-ELVGDDLLVTNVERVRMAESRVACNAMLLKINQIGTVTEAIDAAK
Q8SUA4_ENCCU      GWIWLNAE--VGKKINIVGDDLTVTDPQLVRDAGARRMCNTLLVKPNQVGTVSETVEAIR
A2E269_TRIVA      NWTKLNARLG--QRVQLVGDDLYTTNPITIKKGLEGKWCNALLLKVNQIGTISEGMEAAR
D2V522_NAEGR      GWKKLTERLG--SKIMLVGDDLYTTNTRLIKQGIEEKWANSLLLKVNQIGSITEAMNAAR
A1WLU9_VEREI      GMRAATAA--FAARALIVGDDYLVSDPQRIATAAREGACNTALIKVNQAGTVTRAWQAHA
B1MFL1_MYCA9      ALAAFTQA--VGHRVLVVGDDFTVTDAGRVRRATESGACNGLLVKPNQAGTLSAAKTAHD
C5C344_BEUC1      GWALATRE--LGGRIDLVGDDLFVTQSDRLQRGIAEGCATSILVKVNQNGLVSRAGDVLR
B8IXI8_METNO      NWPALTRA--LGH-LQLVGDDLFATQPDRIRRGIDENIANAALIKVNQNGTLSGTLEAIT
ENO_SACS2         MFSQLQNKLSS---TIITGDDLYTTNIKYLKIGIEKRSTKGVIVKPNQVGTISETFEFTN
ENO_SULTO         RFSILQQKLKK---TIVTGDDLFTTNIEYLKKGIEKSSAKGTIVKPNQIGTLSETFEYIE
ENO_AERPE         GFKAAVDALSTE--TIIVGDDLLVTNPQRVKEASALKAVTGLLVKVNQVGTLTEALEAIQ
ENO_THEAC         GFAEITARI-GDRS-LIVGDDLYTTNPDRIRKGVEKKSTNAVLIKVNQIGTLSAAREAVA
ENO_THEVO         GFAEITKKI-GDKA-MIVGDDLYTTNPDRIRKGIELGSTNAVLIKVNQIGTLTKAQEAAS
ENO_PICTO         GFSEITSKV-GDKS-LIVGDDLYTTNPERIKKGIEKRSTNGVLIKVNQIGTLSDTARSVR
ENO_PYRAE         SFAELRDRF-KDR--LIVGDDLFVTNPERIKKGGKIGAATGVIIKPDQIGTLLRAHQAVS
A1RTI8_PYRIL      SFAELSDRF-RDR--LIVGDDLFVTNSERIKQGGMLKAATGVIIKPDQTGTLLRAYQAVE
A3MS45_PYRCJ      SFAELTDRF-RDR--LIVGDDLFVTNPDRIRHGGRLKAATGVIIKPDQIGTLLRAHTAVS
A8MAB4_CALMQ      SFAELTALF-KDR--LIVGDDLFTTNPDRLAIGIREKATNAVLIKVDQIGTVTRAHETVR
ENO_METTH         GFAELTSLV-GDRC-MICGDDIFVTNREILREGIEMGAANAIIIKPNQIGTLTDTYLTVK
ENO_HALMA         AFADLTAQV-GDQ-TLVCGDDLFVTNVERLQAGINADAGNSILIKPNQIGTLTDAVDAIE
ENO_HALSA         AFAELTDRV-GDE-TLVCGDDLFVTNTERLQRGIDAGAANSILVKPNQIGTLTDAVDAIE
ENO3_METHJ        GFAALNREA-GNR-CLICGDDLFVTNTKRIQEGISHGSANCVLIKPNQIGTLTDTHEAIH
ENO_METLZ         GFARITEEV-SGRDTLICGDDLFVTNASRLEEGIRNDACNCVLIKPNQIGTLTDTFETIS
ENO_ARCFU         GFAELTKQV-KCM---VCGDDIFVTNPEIIKKGIEVGAANTVLIKPNQNGTLSGTAKAVK
A0RY13_CENSY      GMAELTRRF-PGV--LVAGDDLTVTSAAMLRKAVKKGSCNAAILKVNQAGSLYDAMKFAA
A9A429_NITMS      DMSELTAKF-PNT--LITGDDLTVTNKGILSKAIDKKSCNAAILKVNQAGSLYDALEFAN
K0IE56_NITGG      SMAVLTKKN-QKT--LVTGDDMLVTNAGKVREAVRYGACSGAILKVNQAGSLYDAIKFAE
                                    .**   :.      .         ::* :* * :        

ENO_HELPY         LAKHHA-YQCVMSHRSGESEDSFIADFAVALNTGEIKTGSTARSERIAKYNR-LLEIEHE
ENO_HELPJ         LAKHHA-YQCVISHRSGESEDSFIADFAVALNTGEIKTGSTARSERIAKYNR-LLEIEHE
ENO_CAMJE         LAQRNN-YKCVMSHRSGESEDAFIADFAVALNTGQIKTGALARGERTAKYNR-LLEIEFE
ENO_NOSS1         LGTRNG-FRSVISHRSGETEDTTIADLAVATRAGQIKTGSLCRSERVAKYNR-LLRIEDE
ENO_SYNY3         LATRHS-YRSVISHRSGETEDTTIADLAVATRVGQIKTGSLCRSERVAKYNR-LLRIEDE
ENO_DEIRA         LAKRHH-YGTIISHRSGESEDAFIADLAVATNAGQIKTGSASRSDRIAKYNQ-LLRIEDQ
ENO_BRUME         TAHKAG-YTAVMSHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQ-LIRIEEE
ENO_RHILO         TAHKAG-YTAVMSHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRMAKYNQ-LIRIEEE
ENO_RHIME         TAHKAR-YTAVMSHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQ-LIRIEEQ
ENO_CAUVC         LAHRHG-YTSVMSHRSGETEDSTIADLAVALNCGQIKTGSLARSDRTAKYNQ-LLRIQEM
ENO_ZYMMO         MANDAS-YTAVMSHRSGETEDTTIADLAVATNCGQIKTGSLCRSERIAKYNQ-LMRIEEE
ENO_MYCLE         LAHHSG-YRTMISHRSGETEDTMIADLVVALGSGQIKTGAPARSERVAKYNQ-LLRIEEE
ENO_MYCTU         LAHHGG-YRTMISHRSGETEDTMIADLAVAIGSGQIKTGAPARSERVAKYNQ-LLRIEEA
ENO_CHLMU         LATTQG-YATILSHRSGETEDTTIADLAVAFNTGQIKTGSLSRSERIAKYNR-LIAIEEE
ENO_CHLTR         LATIQG-YATILSHRSGETEDTTIADLAVAFNTGQIKTGSLSRSERIAKYNR-LMAIEEE
ENO_CHLPN         LAQMAG-YTTIISHRSGETTDTTIADLAVAFNAGQIKTGSLSRSERVAKYNR-LMEIEEE
ENO_AQUAE         LAKERN-YSAIISHRSGETEDTFISHLAVATNAGQIKTGSASRTDRIAKYNE-LLRIEER
ENO_THEMA         MAQKNN-MTAIISHRSGESEDTFIADLAVATNAGFIKTGSLSRSERIAKYNQ-LLRIEEE
ENO_BACHD         MAKRAG-YTAVISHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQ-LLRIEDE
ENO_BACSU         MAKRAG-YTAVISHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQ-LLRIEDQ
ENO_LISMO         MAKRAG-YTAVISHRSGETEDSTIADIAVATNAGQIKTGAPTRTDRVAKYNQ-LLRIEDN
ENO_STRIT         MAKEAG-YTAVVSHRSGETEDSTIADIAVAANAGQIKTGSLSRTDRIAKYNQ-LLRIEDQ
ENO_STRPN         MAKEAG-YTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQ-LLRIEDQ
ENO_STRP1         MAKEAG-YTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQ-LLRIEDQ
ENO1_LACLA        MAKEAG-FTAIVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRMAKYNQ-LLRIEDQ
ENO_STAAM         MAQKAG-YTAVVSHRSGETEDTTIADIAVATNAGQIKTGSLSRTDRIAKYNQ-LLRIEDE
ENO_STAAU         MAQKAG-YTAVVSHRSGETEDTTIADIAVATNAGQIKTGSLSRTDRIAKYNQ-LLRIEDE
ENO_ENTFA         MAKEAG-YTAVVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRIAKYNQ-LLRIEDQ
ENO_BORBU         MAKKAG-YTAIVSHRSGETEDTTIADLVVALGTGQIKTGSLSRTDRIAKYNQ-LIRIEEE
ENO_NEIMA         LAKRNR-YASVMSHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQ-LLRIEEE
ENO_NEIMB         LAKRNR-YASVMSHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQ-LLRIEEE
ENO_NITEU         MAKCAG-YTAIVSHRSGETEDTTIADIAVATNALQIKTGSLSRSDRLAKYNQ-LLRIEED
ENO_RALSO         MAKRAG-YTAVISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQ-LLRIEED
ENO_ECOLI         MAKDAG-YTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQ-LIRIEEA
ENO_SALTY         MAKDAG-YTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQ-LIRIEEA
ENO_YERPE         MAKDAG-YTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQ-LIRIEEA
ENO_VIBCH         MAKDAG-YTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQ-LIRIEEA
ENO_HAEIN         MAKDAG-YTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRIAKYNQ-LIRIEEA
ENO_PASMU         MAKDAG-YTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRIAKYNQ-LIRIEEA
ENO_BUCAI         TAKQAN-YGVIISHRSGETEDASIADLSVGTSSGQIKTGSMSRSDRTSKYNQ-LIRIEEN
ENO_PSEAE         MAKAAG-YTAVISHRSGETEDSTIADLAVGTAAGQIKTGSLCRSDRVSKYNQ-LLRIEEQ
ENO_XYLFA         MAHRAQ-YAAIVSHRSGETEDTSIADIAVATTATQIKTGSLCRSDRVAKYNQ-LLRIEQA
ENO_DESVM         MAKQAA-YTTVISHRSGETEDHFISDLAVGLNAGQIKTGSLCRSDRLAKYNQ-LLRIEED
ENO_TREPA         MAQNAG-YAAVISHRSGETEDAFIADLAVALETGQIKTGSMSRSDRVAKYNQ-LMRIEEE
ENO_MYCGE         VAKKAN-WSQVISHRSGETEDTTIADLAVAAQTGQIKTGSMSRSERIAKYNR-LLYIEIE
ENO_MYCPN         IAKDAN-WSQVISHRSGETEDTTIADLAVAACTGQIKTGSMSRSERIAKYNR-LLQIELE
ENO_UREPA         FAQKNN-INTIISHRSGETEDTFIADLAIGVGAGQIKTGSLSRSERIAKYNR-ILEIEQE
ENO_PELUB         FAQIIG-YKTIISHRSGDSEDTFIADLAVGTNSNQIKTGSLARSERVAKYNQ-LLRIEEE
ENO_MYCPU         MAHKAG-FSAVISHRSGETEDTTIADLAVALNTGQIKTGSLSRTDRIAKYNR-LLEIEDQ
ENO2_LACLA        LARKAG-YKTMISHRSGETVDSYIADFAVAMHAGQIKTGSMARSERVEKYNQ-FLRIEEE
ENO_STRTR         LARKAG-YKTMISHRSGETVDSYIADFSVAMHAGQIKSGSMARSERVEKYNQ-LLRIEED
ENO_NEOSM         LARKAG-YKVVISHRSGETEDLSIAHLAVACGGAFLKAGSLSRSERVAKYNE-VLRLEEV
ENO_PYRAB         MAFRAG-YGVVVSHRSGETEDATIADLAVALNAGQIKTGAPARSDRNAKYNQ-LIRIEEE
ENO_PYRHO         TAFRAG-YSVIVSHRSGETEDTTIADLAVALNAGQIKTGAPARSDRNAKYNQ-LIRIEEE
ENO_METJA         LAFRNG-YGVVVSHRSGETEDTTIADLSVALNSGQIKTGAPARGERTAKYNQ-LIRIEQE
ENO_COCLU         DAFGAG-WGVMVSHRSGETEDVTIADIVVGLRSGQIKTNAPARSERLAKYNQ-ILRIEEE
G0VDS4_NAUCC      DSYAAG-WGVMVSHRSGETEDTFIADLVVGLRTGQIKTGAPARSERLAKLNQ-ILRIEEE
J6EZG7_TRIAS      LSQSNG-WGVMTSHRSGETESTFIADLSIGLRTGQIKTGAPARSERLAKYNQ-LLRIEEE
D8RLY3_SELML      DSKAAG-WGVMVSHRSGETEDTFIADLAVGLASGQIKTGAPCRSERLAKYNQQLLRIEEE
D0A1Y2_TRYB9      LCMENG-WSVMVSHRSGETEDTYIADLVVALGSGQIKTGAPCRGERTAKLNQ-LLRIEEE
B7GEF2_PHATC      KAKKAG-WGVMTSHRSGETEDTYIADLAVGLCTGQIKTGAPCRSERLAKYNQ-LLRIEAE
G4YKG3_PHYSP      MAKKAG-WAIMASHRSGETEDTFIADLAVGLSAGQIKTGAPCRSERLAKYNQ-LLRIEEE
D8LWD6_BLAHO      KCREAGQWSVMASHRSGETEDCFLSHLSVGLHTERIKSGAPCRSERLCKYNE-LMRIEEE
F0ZJC2_DICPU      LAKGAG-WGCLVSHRSGETDDSFIADLVVGLGTGQIKSGAPCRFERLAKYNR-LMKIEET
ENO3_ARATH        MARDAQ-WGVVTSHRCGETEDSFISDLSVGLATGVIKAGAPCRGERTMKYNQ-LLRIEEE
M4DPD7_BRARP      LARDAQ-WGVVTSHRCGETEDSFISDLSVGLATGVIKAGAPCRGERTMKYNQ-LLRIEEE
Q5KG11_CRYNJ      TAYSYG-WSVFVSHRSGETIDDFIGDIVVGLQTGHIKSGAPCRGERLAKYNR-LLQIERL
F8N224_NEUT8      LAKSLG-WGVFVSHRSGETTDDFIADLSVGLCTGHIKSGAPCRGERVAKYNR-LLDIEAE
Q8SUA4_ENCCU      IARKCG-MKIMVSHRSGETDDHFISDLSVGVGAEYIKSGAPCRGERVSKYNQ-LLRLYEY
A2E269_TRIVA      LILNAG-HRVMVSHRSGETCNSVIADLAVAIGAQSIKTGSTARGERIQKYTR-LLQIYDY
D2V522_NAEGR      MIFNVN-QKVIVSHRSGETATNLIADLVVGIGATHIKTGATARGERVSKYNR-LLQIEEY
A1WLU9_VEREI      AARAAG-WATIVSARSGESEDVSVAHLAVGWGADLIKVGAITRGERTAKWNE-MLRIDEE
B1MFL1_MYCA9      TAHDCG-WDTIVSARSGESEDVTIAHLAVGWGAEQLKVGSITRSERTAKWNE-LLRIDEQ
C5C344_BEUC1      AARAAG-YRTVVSARSGETEDSWVADLAVGWSAGQLKVGSTQRSERTAKWNR-VLELEAT
B8IXI8_METNO      TARAAG-YATVISARSGETEDDFLADLAVGVAGRQIKVGSVRNSERLAKYNQ-LLRLEEE
ENO_SACS2         LARRNS-MKLITSHRSGETEDNFIADFAVGIESDFIKVGAPARGERTSKYNK-LLEIEN-
ENO_SULTO         FAKKNS-IKIIVSHRSGETEDSFIADLAVGVQSDFIKTGAPARGERTSKYNR-LLEIEN-
ENO_AERPE         AARDRG-IVHIVSHRSGDTEDTFIADLAVATEALMIKTGAPARGERTSKYNR-LLEIENI
ENO_THEAC         VATFAG-MKNIVSHRSGETTDDFLAHLSVAFGSTFVKTGVIG-GERVAKLNE-IARIEEC
ENO_THEVO         LASSAG-LKNVVSHRSGETTDDFLAHLSVAFSSTFVKTGTIG-GERIAKLNE-LMRIEEC
ENO_PICTO         IATEHG-LKTVVSHRSGETTDDFIAHLAVAFGSPLIKTGTIG-GERLAKLNE-LIRIEEE
ENO_PYRAE         AAREFG-MRVIVSHRSGDTEYKTLAHIAVGFGAEVIKTGIMG-GERTAKLNE-LIRIGDY
A1RTI8_PYRIL      IAKRYG-MRIVVSHRSGDTEYRSLAHIAVGFGADIIKTGIMG-GERTAKLNE-LIRIGDY
A3MS45_PYRCJ      TAREYG-LKIVVSHRSGDTEYKTLAHVAVGFGAEVIKTGIMG-GERTAKLNE-LIRIGEY
A8MAB4_CALMQ      LALNNG-YRIVVSHRSGDTESGLLAHIAVGFKAPIIKTGIMG-SERVAKANE-LLRIWDH
ENO_METTH         LALENR-YTPVVSHRSGETTDDTIAHLAVAFGAPLIKTGAIG-GERIAKLNE-LIRIQEE
ENO_HALMA         LATASG-YESVVSHRSGETEDTTIAHLAVATDAPFIKTGAVG-GERTAKLNE-LIRIEDN
ENO_HALSA         LATRNG-YDAVVSHRSGETEDTTIAHLAVATDAPFIKTGAVG-GERTAKLNE-LIRIADE
ENO3_METHJ        LAKRHG-METVISHRSGETEDTTIAHLGCAFQCIFIKTGVVG-GERTAKLNE-LIRIEES
ENO_METLZ         LAHDYG-YETVMSHRSGETTDNTIAHLATAFGCCFMKSGVVG-GERIAKLNE-LIRIEEH
ENO_ARCFU         IAKDNG-YSVVVSHRSGETEDETLAHLAVAFNAKLIKTGVVG-GERISKLNE-LIRIEEL
A0RY13_CENSY      EATAGG-IRLVTSHRSGETTDAHVTHIGIATGSVMLKVGAVG-GERVAKANE-LIRLSEQ
A9A429_NITMS      LANENN-IRLITSHRSGESTDSQISHIGLATKSKMLKVGVVG-GERVAKLNE-LLRLSEH
K0IE56_NITGG      ECSKNN-IRIITSHRSGESVDSHISHIAIATGSRMIKTGVLG-GERVAKLNE-LVRLTEY
                            . * *.*::    : ..  .     :* .     :*  * .. .  :   

ENO_HELPY         L----KGGIYIGKELFKHG--------
ENO_HELPJ         L----KGGIYIGKELFKHG--------
ENO_CAMJE         ------SDEYLGEKL------------
ENO_NOSS1         L---GDRAVYAGAVGLGPK--------
ENO_SYNY3         L---GDRAVYAPKIGLGPKHS------
ENO_DEIRA         L---GDRAVFPGRKALR----------
ENO_BRUME         L---DKQARYAGRSALKLL--------
ENO_RHILO         L---GKQARYAGKSVIKG---------
ENO_RHIME         L---GPQAQYAGRSVLRG---------
ENO_CAUVC         L---DDQGVYAGRAALKGR--------
ENO_ZYMMO         L---GSVAKYAGRSVLRKAK-------
ENO_MYCLE         L---GDAARYAGDLAFLRYVVETR---
ENO_MYCTU         L---GDAARYAGDLAFPRFACETK---
ENO_CHLMU         I---GPEAVFQDSNPFSKA--------
ENO_CHLTR         M---GPEALFQDSNPFSKA--------
ENO_CHLPN         L---GSEAIFTDSNVFSYEDSEE----
ENO_AQUAE         L---GNGAVFWGREEFYRFTS------
ENO_THEMA         L---GKVAEFRGLKSFYSIKR------
ENO_BACHD         L---GNLAQYNGLQSFYNLKK------
ENO_BACSU         L---AETAQYHGINSFYNLNK------
ENO_LISMO         L---ADLAEYHGNDTFYNLKK------
ENO_STRIT         L---GEVAEYRGLKSFYNLSK------
ENO_STRPN         L---GEVAEYRGLKSFYNLKK------
ENO_STRP1         L---GEVAQYKGIKSFYNLKK------
ENO1_LACLA        L---AEVAQYKGLKAFYNLKK------
ENO_STAAM         L---FETAKYDGIKSFYNLDK------
ENO_STAAU         L---FETAKYDGIKSFYNLDK------
ENO_ENTFA         L---GDVAEYKGLKSFYNLKNK-----
ENO_BORBU         L---ETTAEYHGKSVFYSIKQK-----
ENO_NEIMA         L---AEAADYPSKAAFYQLGK------
ENO_NEIMB         L---AEAADYPSKAAFYQLGK------
ENO_NITEU         L---GEMAQYAGRSAFYQLKP------
ENO_RALSO         L---GDIASYPGKSAFYNLR-------
ENO_ECOLI         L---GEKAPYNGRKEIKGQA-------
ENO_SALTY         L---GEKAPYNGRKEIKGQA-------
ENO_YERPE         L---GDRAPFNGLKEVKGQ--------
ENO_VIBCH         L---GSRAPFNGLKEVKGQA-------
ENO_HAEIN         LERAGTPAAFPGLKAVKGQA-------
ENO_PASMU         L---GDKAPFLGLKAVKGQA-------
ENO_BUCAI         L--GTKYAPFHGLREIKSAF-------
ENO_PSEAE         L---GAKAPYRGRAEFRG---------
ENO_XYLFA         L---GVGARYAGRDAFVSLKS------
ENO_DESVM         L---DDTGIYFGPMMSSHFGFEEEGEE
ENO_TREPA         L---GAQARYYGAKTFERFGC------
ENO_MYCGE         L---GDKGKYLGWNTFTNIKPKNFNI-
ENO_MYCPN         L---GNNAKYLGWNTFKNIKPQKA---
ENO_UREPA         L---KDKLIYEPSKFFKFR--------
ENO_PELUB         L---GKKASMSKIH-------------
ENO_MYCPU         L---EEAAVFPGKKAFWNLKNR-----
ENO2_LACLA        LGKDVALASFPG---------------
ENO_STRTR         LGKDVALAQFPG---------------
ENO_NEOSM         FV-------------------------
ENO_PYRAB         LEGVAVYAGKNFRKVFF----------
ENO_PYRHO         LEGIAVYAGKNFRKVFF----------
ENO_METJA         L-GLSKYAGRNFRCPF-----------
ENO_COCLU         LGDKRLFAGNK-FHTAINLYL------
G0VDS4_NAUCC      LGDKAVFAGAN-FHTGFKL--------
J6EZG7_TRIAS      LGSNAEYAGGRGLAKGLQPPALLSEQ-
D8RLY3_SELML      LGS-VGYAGEN-FRKP-----------
D0A1Y2_TRYB9      LGAHAKFGFPGWS--------------
B7GEF2_PHATC      LEA-GKVTFPGENFRTTAWMGQ-----
G4YKG3_PHYSP      LGAKARYAGEDFRNVEKLGKYASF---
D8LWD6_BLAHO      LLVEKE---EVFFGEKKVESYLE----
F0ZJC2_DICPU      EILSNGNKIKFAGKEFSHF--------
ENO3_ARATH        LGDQ---AVYAGEDWKLSL--------
M4DPD7_BRARP      LGDQ---AVYAGEDWRQTL--------
Q5KG11_CRYNJ      LKERGHPVRYAGVDFRRAATW------
F8N224_NEUT8      LKESWKPWSYAGEKFRKPEAFFI----
Q8SUA4_ENCCU      ---------------------------
A2E269_TRIVA      LKEHDMLAEE-----------------
D2V522_NAEGR      LEQNGLLSQ------------------
A1WLU9_VEREI      L---GGLPLAPFPLR------------
B1MFL1_MYCA9      L---GGAPIRLGRLSLG----------
C5C344_BEUC1      E---STELQHPWPSRTEETAS------
B8IXI8_METNO      G---LAWSGRTGLAPL-----------
ENO_SACS2         ----KFGLEYEGKYFYL----------
ENO_SULTO         ----DYGIEYYGKKIYL----------
ENO_AERPE         L---GYSAEYAGPELRGVMGRR-----
ENO_THEAC         LTS------------------------
ENO_THEVO         LTS------------------------
ENO_PICTO         LI-------------------------
ENO_PYRAE         LGKWATITQIRIH--------------
A1RTI8_PYRIL      LGKWASISHIR----------------
A3MS45_PYRCJ      LGRWGNISRIR----------------
A8MAB4_CALMQ      LSGVARMAKIK----------------
ENO_METTH         IP-YSRMADLPF---------------
ENO_HALMA         AV-------------------------
ENO_HALSA         A--------------------------
ENO3_METHJ        IYERK----------------------
ENO_METLZ         F--------------------------
ENO_ARCFU         MDKPRMVMI------------------
A0RY13_CENSY      GLIHGMAGI------------------
A9A429_NITMS      DLIRGMAEV------------------
K0IE56_NITGG      DLIEGMNNT------------------