CLUSTAL format seed alignment for MF_00320

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOD_PYRHO      -----MVKIKILKKTEDSITFILE-GVSVAFANALRRTILGEVPTFAVDEVEFYENDS--
RPOD_PYRAB      -----MVEIKILKKTDDSITFILE-GVDVAFANALRRTILGEVPTFAVDEVEFYENDS--
RPOD_METJA      -----MITIKEKRKTRIGEEFIFSLKAPISFSNAIRRIMISEVPTFAIEDVYIYENSS--
RPOD_ARCFU      ----MMPEIEILEEKDFKIKFILK-NASPALANSFRRAMKAEVPAMAVDYVDIYLNSS--
RPOD_METTH      ------MDIALKEKTDTEMVFVVS-GVTVPFINAIRRICMMEVPKLAIEYVNMYRNDA--
RPOD_SULAC      ------MPISLIERNGLRLRLVLE-NYPLEFVNSIRRASILYVPVMAVDEVYFIENNS--
RPOD_SACS2      ------MSINLLHKDDTRIDLVFE-GYPLEFVNAIRRASMLYVPIMAVDDVYFIENNS--
RPOD_AERPE      MAETGDRSVEVVELDSLRVRLRIR-GYPVVFVNAIRRTVLSDVPTMAVDYAYIFDNTT--
RPOD_HALSA      -MSSQDFDVEFVDRDDREARFVVR-NITPAFANGIRRAILVDVPTLSIDTVRFVENSS--
RPOD_HALMA      --MTQDYEVEFVERGEREARILVR-GITPAFANGIRRAMVADVPTFSIDTVRVIENTS--
RPOD_THEAC      ------MDVKIFKLSDKYIRFEID-GITPSQANALRRTLINDIPKLAIENVTFHHGEIRD
                        :           : .         *.:**     :* :::: . .  .    

RPOD_PYRHO      ----------ALFDEIIAHRLAMIPLKTP---------TDRFELDALELDDYTVTLSLEA
RPOD_PYRAB      ----------ALFDEIIAHRLAMIPLKTP---------VDRFELDALELDDYTVTLSLEA
RPOD_METJA      ----------SMDDEILAHRLGLIPIK-----------------GKPLLENEVITFTLEK
RPOD_ARCFU      ----------YFYDEVIAHRLAMLPIKT---YLDRFNMQSECSCGGEGCPNCQISFRLNV
RPOD_METTH      ----------KMFDEVLAHRLGLVPLAADPEFAESLKMPEECDCE-EYCSECSVSLTLRK
RPOD_SULAC      ----------PLYDEILAHRLALVPFVSD-EALEHYRPPEECAECKENCDGCYNRVYLDV
RPOD_SACS2      ----------PLYDEILAHRLALIPFMSE-EALDTYRWPEECIECTENCEKCYTKIYIEA
RPOD_AERPE      ----------AVYDEMVAHRLGLVVLDSN-EAVEKYRRPEECAGKEPSEEDCFVEVSLEA
RPOD_HALSA      ----------VMFDEQLGLRLGLVPLTTP----------------EDYAAGEAVTLALDV
RPOD_HALMA      ----------VMFNEQIGLRLGLVPLTTDL---------------DDFEIGDEVTLSLSV
RPOD_THEAC      SEGNVYDSSLPLFDEMVAHRLGLIPLKTD----LTMNFRDQCSCGGKGCSLCTVTYSINK
                           . :* :. **.:: :                               :  

RPOD_PYRHO      EG------PGIVYSGDLKS-DDPDVKPVTPDIPIVKLAKGQRLVFNAYAKLGRGKDHAKW
RPOD_PYRAB      EG------PGIVYSGDLKS-DDPDVKPANPDIPIVKLAKGQRLVFNAFAKLGRGKDHAKW
RPOD_METJA      EG------PCTVYSSDLKS-ENGEV--AFKNIPIVKLGKGQRIQIECEAIPGIGKVHAKW
RPOD_ARCFU      EG------PKVVYSGDFIS-DDPDVVFAIDNIPVLELFEGQQLMLEAVARLGTGREHAKF
RPOD_METTH      KG------PGVVYSGDLVS-ETPAVKPVYPDIPLVKLGDDDELELEAVAQLGVGREHAKW
RPOD_SULAC      EAKDQP---LMIYSRDLKS-EDQMITPVSGAIPIVLLGSKQKISLEARLRLGYGKEHIKY
RPOD_SACS2      EAPNEP---RMIYSKDIKS-EDPSVVPISGDIPIVLLGTNQKISLEARLRLGYGKEHAKF
RPOD_AERPE      EVDAEGETGRYITAGDLSI-SDPQVKPVYPETPLIYVAPGQRIHVQAFARLGRGKEHTKW
RPOD_HALSA      EG------PGTAYSGDLVS-NDPEVEAADENIPIIELKDDQRLELEADAVMGHGRDHAKH
RPOD_HALMA      DG------PSTAYSSDLVS-SDPMVEAADDNIPIIDLKEGQRLEVEADAVLDTGREHAKH
RPOD_THEAC      LG------PSTVFSSDLQAVSHPDLIPVDGEIPIVKLGPKQAILITAEAILGTAKEHAKW
                             : *:   .   :       *:: :   : : . .    . .: * * 

RPOD_PYRHO      QPGFTYYKYFTRVHISKKINGWEKLAKLAKKRGLPTKENEEEV------IVETIKPFYIP
RPOD_PYRAB      QPGFTYYKYFTRIHISKEIEGWEKLKKLAKKRGLPVKENENEV------IVETIKPFYIP
RPOD_METJA      QPCNAVYK----------------------------------------------------
RPOD_ARCFU      QPVSVCVYKIIPEIVVNEN--CNGCGDCIEACPRNVFEKDGDK----VRVKNVMACSMCG
RPOD_METTH      EPTTACAYKYYPRIEFSED--CDECLECIEACPRDVLGEESGK----PVVVDLENCSMCK
RPOD_SULAC      SPVSVSIVRYYPKVTVLGN-----CEKAVEVCPEGVFAMENNK----LVVKNELSCILCE
RPOD_SACS2      IPVSLSVVRYYPKVEILAN-----CEKAVNVCPEGVFELKDGK----LSVKNELSCTLCE
RPOD_AERPE      SPASLSVLRYTPILIYDSSKAGDECLECLSAYPQVVEALKSGGKGSLVLEGLRRTSGLRY
RPOD_HALSA      QGGVAVGYRHLQRVHVVGDSPEYADDDPQMLRGVIEE-----------DDELVPTDDFDN
RPOD_HALMA      QGGVAVGYRHLQQVEVVGDLGEFEDDDPNILRGVIEEQAAEHAAGDATNGELVATDEFDN
RPOD_THEAC      QVTSGVSYKYHREFHVSKKD-FEDWQKLKGACPKSVMSETDTE-------IVFTDDFGCN
                                                                            

RPOD_PYRHO      KEFEEYEGKEIWEEIVPDTYVFVVETNGELPVEEIVKIALRILMRKADRFINELQRLAG-
RPOD_PYRAB      KEFEEYEGKGIWEEIVPNTYVFVVETNGELPVEEIVKIALKILMRKADRFINELQGLAG-
RPOD_METJA      -------------QIADDEVEFFVETFGQMEAEEILEEAVKILKNKAESFLQQLEMIEQ-
RPOD_ARCFU      ECVEVCEMNAISVN-ETNNFLFTVEGTGALPVREVMKKALEILRSKAEEMNKIIEEIQ--
RPOD_METTH      SCVRACDKRAIDVGYEEGKFIFRIETDGSVDPKDVLLKACDILRDKAEQVITFCEGG---
RPOD_SULAC      ECLKYCA-GSVSIESVENKFILEIESVGSLKPERILIEASKSLLRKLSELKSKLEAGK--
RPOD_SACS2      ECLRYCN-GSIRISFVEDKYILEIESVGSLKPERILLEAGKSIIRKIEELEKKLVEVVK-
RPOD_AERPE      CAETACR-GAVEVRYDSSNLDLEVESTGALRPEKIVELAIRELEEKVKRFAEAVESVGVE
RPOD_HALSA      DLTTRYPGKEVEIEDVDGAFVFHVESDGSMPVEELVLRAVDTLVDRADELEQAVQL----
RPOD_HALMA      DLRNRYPGKDVEVSDVPNAFVFHVETDGSFTTEELVLRAVETLRDRATELKDAVQL----
RPOD_THEAC      DLNVLFESDGVNMIEDDSRFIFQFETDGSLTAKETLLYALNRLKDRWDILVESLSE----
                                 .   : .*  * .  .  :  *   :  :   .          

RPOD_PYRHO      --
RPOD_PYRAB      --
RPOD_METJA      --
RPOD_ARCFU      --
RPOD_METTH      --
RPOD_SULAC      --
RPOD_SACS2      --
RPOD_AERPE      ES
RPOD_HALSA      --
RPOD_HALMA      --
RPOD_THEAC      --