CLUSTAL format seed alignment for MF_00323

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HEMH_NOSS1      -------------------------MGRVGVLLLNLGGPD--KLEDVAPFLFNLFSDPEI
HEMH_SYNY3      -------------------------MGRVGVLLLNLGGPE--KLEDVRPFLFNLFADPEI
HEMH_AQUAE      --------------------------MKKGVILINLGGPD--SLEAVEPFLYNLFSDPDI
HEMH_RICCN      ------------------------MKKRIAIVLFNLGGPK--NLKSVKPFLFNLFYDKAI
HEMH_RICPR      ------------------------MNKRIAIVLFNLGGPE--DIEYVKPFLFNLFYDKAI
HEMH_CAUVC      ------------------------MTQKLAVVLFNLGGPD--GPDAVRPFLFNLFRDPAI
HEMH_HELPY      --------MDLINEKLNNLENNATKSPKEAVILLNMGGPN--SLYEVGVFLKNMFDDPFI
HEMH_HELPJ      --------MNLINEKLNNLENSATKSPKEAVVLLNMGGPN--SLYEVGVFLKNMFDDPFI
HEMH_CAMJE      ---------------------------MKLVLFLNMGGAT--NLQDCEVFLKNMFNDPYI
HEMH_NEIMA      -----------MLPFLPEPSLSYTQQNRTAVLLLNLGTPDAPTAQAVRPYLKSFLTDRRV
HEMH_NEIMB      -----------MLPFFPEPSLSYTQQNRTAVLLLNLGTPDAPTAQAVRPYLKSFLTDRRV
HEMH_RALSO      ------------MPFLPEPLFQHGQPDRTAILLVNLGTPDGTSPREVGRYLRQFLSDPRV
HEMH_ECOLI      -----------------------MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRV
HEMH_ECO57      -----------------------MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRV
HEMH_SALTI      -----------------------MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRV
HEMH_SALTY      -----------------------MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRV
HEMH_YEREN      -----------------------MKQSKLGVLMVNLGTPDAPTPQAVKRYLAEFLSDRRV
HEMH_YERPE      -----------------------MMQSKPGVLMVNLGTPDAPTSKAIKRYLAEFLSDRRV
HEMH_VIBCH      ----------------------MNNHKKLGILLANLGTPQAPTSQAVKAFLSQFLHDQRV
HEMH_HAEIN      ----------------------MTKPAKIGVLLANLGTPDSPTPKSISRYLWQFLTDPRV
HEMH_PASMU      -----------------------MNKAKTGVLLVNLGTPESPTPKAISRYLWQFLTDPRV
HEMH_XYLFA      ----------------------MNHTSDTALLIVNLGTPEAPTAAAVRRYLGEFLSDRRV
HEMH_BRUME      -MSGTDKVRVNVSQTAQTPLHTSAKLPKVGVLLVNLGTPDGTSYGPMRRYLAEFLSDRRV
HEMH_RHIME      --------------MDANTEHPAVGYGKLGVLLVNLGTPDGTDVTSMRRYLREFLSDRRV
HEMH_RHILO      MTSAIAVDPKAAKPVGVTAGHAPAGAGKVGVLLVNLGTPDGTEFKPMWRYLREFLSDPRV
HEMH_BRADU      --------MSTAAPNETTQPTVQSGQKRVGVLLVNLGTPDTADAPGVRVYLKEFLSDARV
HEMH_RHOCA      ------MTIANRILPHAPADHPPVPVPRVGVLLANLGTPDATDYWSMRRYLNEFLSDRRV
HEMH_ZYMMO      ---------------MTESNNPLPISEKIGVLLVNLGTPDAPNAKALRRYLGQFLSDQRV
HEMH_PSEAE      -------------------------MTENALLLLNLGSPDSTRVEDVRRYLDQFLMDPYV
HEMH_PSEFC      -------------------------MTDHALLLVNLGSPASTSVADVRSYLNQFLMDPYV
HEMH_LACLA      ------------------------MDKKKGILLVALGTPRSCEADDVRDYLKEFLGDPLV
HEMH_CHLMU      ---------------------------MTVYLLANFGGPR--ISQEIPSFLHALLTDQDV
HEMH_CHLTR      ---------------------------MVTYLLANFGGPR--TSQEIVSFLQALLTDRDV
HEMH_CHLPN      -------------------------MTTPAYLLANFGGPR--HAKDLQEFLISLLTDRDV
HEMH_BACHD      -----------------------MTKKKIGLLVMAYGTPR--TKEEIEPYYTHIRHGRKP
HEMH_BACSU      -----------------------MSRKKMGLLVMAYGTPY--KEEDIERYYTHIRRGRKP
HEMH_LISIN      ------------------------MTKKVGLLVMAYGTPY--KDEDIERYYTDIRHGHKP
HEMH_LISMO      ------------------------MTKKVGLLVMAYGTPY--KDEDIERYYTDIRHGHKP
HEMH_STAAM      ------------------------MTKKMGLLVMAYGTPY--KESDIEPYYTDIRHGKRP
HEMH_STRPN      ------------------------MKKAILMMTFGSPEEI--IFEGVADFFTNIRRGVRP
HEMH_DEIRA      -------------------MTTLTNQKPLGVLFMAYGGPE--NLGEMPGYLADIRAGRVT
HEMH_MYCLE      -------------------------MLFDAALLLSFGGPD--GPEQVRPFLENVTRGCNV
HEMH_MYCTU      -------------------------MQFDAVLLLSFGGPE--GPEQVRPFLENVTRGRGV
HEMH_MYCAV      -------------------------MDFDAVLLLSFGGPE--GPSRFGRSWRTSPGAAAC
HEMH_PROFF      ------------------------MTSFDALLVAGFGGPE--SMAEVPDFLQRVSGGH-I
HEMH_STRCO      ------------------MPDVLDASPYDALLLLSFGGPE--GPDDVVPFLENVTRGRGI
HEMH_THEAC      --------------------------MKSALLLLSYGSPE--RIEDLDEYLKNIFNGKPV
HEMH_THEVO      --------------------------MKTAVLLLSYGSPE--KMSDIDEYLSKIFGGKPV
                                               :                            

HEMH_NOSS1      IRLPF-RWLQKPLAWFIASRRTKTSQENYKQIGGGS------PLRRITEAQGEALKEQLH
HEMH_SYNY3      IRLPF-PWLQKPLAWLISTLRAKKSQANYAEIGGGS------PLLQITEAQASALTTRLE
HEMH_AQUAE      FSLPF----QKVLAKIIAKLRAKKTRHYYELMGGKS------PQYEQTLEQAKALQER--
HEMH_RICCN      INLPN-P-LRYIIAKIISITREKKSQKIYSLIGGKS------SLLQETEEQKLALTEKLK
HEMH_RICPR      INLPN-P-LRYIIAKIISITREKKSQKIYSLIGSKS------YLIQETEKQKLAITEKLK
HEMH_CAUVC      IGAPA-L-IRYPLAALISTTREKSAKANYAIMGGGS------PLLPETEKQARALEAALA
HEMH_HELPY      LTIKN-NFMRKMVGKMIVNSRIEKSKKIYEKLGGKS------PLTPITFALTERLNKL--
HEMH_HELPJ      LTIKN-NFMRKMVGKMIVNSRIEKSKKIYEKLGGKS------PLTPITFALTERLNEL--
HEMH_CAMJE      LGIKN-RFLRKFVAWIITKARVKAMQENYKKMGGKS------PLNELTQSLCDKLNLK--
HEMH_NEIMA      VELPK-WLWYPILHGLVLTLRPKKSAHAYEKIWFKE----GSPLEVYTARQAAALAKRMP
HEMH_NEIMB      VELPK-WLWYPILHGLVLTLRPKKSAHAYEKIWFKE----GSPLEVYTARQAAALAKRMP
HEMH_RALSO      VEIPR-AAWWFILNVLILPLRSRASAHKYETVWLREANMTGSPLLVYSERQAHALQQLLD
HEMH_ECOLI      VDTSR-LLWWPLLRGVILPLRSPRVAKLYASVWMEG----GSPLMVYSRQQQQALAQRLP
HEMH_ECO57      VDTSR-LLWWPLLRGVILPLRSPRVAKLYASVWMEG----GSPLMVYSRQQQQALAQRLP
HEMH_SALTI      VDTPR-LLWWPLLRGVILPLRSPRVAKLYQSIWMDG----GSPLMVYSREQQQALAARLP
HEMH_SALTY      VDTPR-LLWWPLLRGVILPLRSPRVAKLYQSIWMDG----GSPLMVYSREQQQALAARLP
HEMH_YEREN      VDTSP-WLWWPLLRGVILPIRSPRVAKLYQSVWMDE----GSPLLVYSRRQQKALAERMP
HEMH_YERPE      VDTSP-LLWWPLLHGVILPLRSPRVAKLYQSVWMEE----GSPLLVYSRRQQKALAARMP
HEMH_VIBCH      VDMSR-WLWCPLLHGIILPTRSPKVAKLYQSIWMDE----GSPLMVYSRRQ-RDKLAELS
HEMH_HAEIN      VDLPR-CKWYPLLKAIILPLRSKRIAKNYQAIWTEQ----GSPLLAISRQQKDALQAYLD
HEMH_PASMU      VDLPR-YKWFPLLKGIILPLRAKRVAKNYASIWTEQ----GSPLLTITREQQHALQTYFK
HEMH_XYLFA      VSIPP-LFWKPLLHMVILPIRGPRSASKYAKVWLQE----GSPLSVYTRRIAEGLTQHLP
HEMH_BRUME      IEWSR-LIWYPILYGIVLNTRPRRSGRLYDRIWNHENN--ESPLRTYTRAQGEKLAKALS
HEMH_RHIME      IEWSR-LFWYPILYGIVLNTRPRKVGKAYELIWNKDLN--ESWLRTYTRNQAALMAEAFG
HEMH_RHILO      IELNK-AIWYPILYGLVLTTRPKKSGANYARIWNQERN--ESPLRTYTRAQSEKLAEALG
HEMH_BRADU      IEDQG-LVWKVVLNGIILRSRPRTKALDYQKIWNNEKN--ESPLKTITRSQSDKLAAALS
HEMH_RHOCA      IDYPI-WKWQPLLQLIILSKRPFTSGNNYRSIWNEERD--ESPLMTITRDQVRKLRAAVE
HEMH_ZYMMO      IELPA-VFWQIILRGIILPFRAPRSARAYQKIWTNE----GSPLAAITKKQAQGLQKRMP
HEMH_PSEAE      VDLP--WPLRRLLVSLILIKRPAESAHAYSSIWWDE----GSPLIVLSRRLQEAMKPHWP
HEMH_PSEFC      IDLP--WPVRRLLVSLILIKRPAQSAHAYASIWWDE----GSPLVVLSRRLQQQMTAQWT
HEMH_LACLA      IQKPR-WLWLPILNGIILKVRPQKSAEMYKKIWTDE----GSPLMIYTVAQAKQLQDMRE
HEMH_CHLMU      TGGRIPPWLHRPLFSYIAKRRAHRVAEQYAYLGGRS------PIFQDTEKLAQNLSQEL-
HEMH_CHLTR      TGGMIPSMLHRPLFSYIAKRRAPHVARQYAYLGGGS------PIFQDTERLAQNLSQEL-
HEMH_CHLPN      TGTFLPRVLHRHLFTFIAKKRVPKVLPQYQSLQNWS------PIYFDTETLAKTLSEIL-
HEMH_BACHD      SQELL-----------------DDLTERYEAIGGVS------PLAKITDDQAIALEQKLN
HEMH_BACSU      EPEML-----------------QDLKDRYEAIGGIS------PLAQITEQQAHNLEQHLN
HEMH_LISIN      SEEMI-----------------ADLRGRYHAIGGLS------PLAKITEAQAYGLEKALN
HEMH_LISMO      SEEMI-----------------ADLRGRYHAIGGLS------PLAKITEAQAYGLEKALN
HEMH_STAAM      SEEEL-----------------QDLKDRYEFIGGLS------PLAGTTDDQADALVSALN
HEMH_STRPN      QDHEI-----------------QTLYDNYVRIGGTP------LQKITRQEVALVEARLGS
HEMH_DEIRA      SQAIL-----------------DEITNNYRLIGGKS------PLPEFTRAQVEATMEQLA
HEMH_MYCLE      PPERL-----------------DEVTKHYLHFGGVS------PINGINLALVNELQVE--
HEMH_MYCTU      PAERL-----------------DAVAEHYLHFGGVS------PINGINRTLIAELEAQ--
HEMH_MYCAV      RGTSR-----------------PRRRTLPAFRRGVA------DQRHQPRADRAAAGRP--
HEMH_PROFF      PPDRL-----------------AEVEHHYARFGGVS------PVNAQHRALAAALGEALV
HEMH_STRCO      PKERL-----------------KEVGQHYFLFGGVS------PINDQNRALLDALRKDFA
HEMH_THEAC      PESVR-----------------EENLRKYEMFGGRS------PSNRIIESIARKLHEKIG
HEMH_THEVO      PKGVA-----------------EENYRKYEMFGGLS------PSNRIIQSIRDRLQKRFD
                                                                            

HEMH_NOSS1      Y--LGQEANIYVGMRYWHPYTEEAIALLTQDNLDNLVILPLYPQFSISTSGSSFRLLERL
HEMH_SYNY3      R--LGQDAKVYIGMRYWHPFTEEAVEKIKGDRLQRLVILPLYPHFSISTSGSSFRVLEEM
HEMH_AQUAE      ---LGEDYKVVVGMRYWKPYIKDALSELLKEGINEVILLPLYPQYSKTTTGSAFNEFERS
HEMH_RICCN      QLIKE-DFAIFINMRYSAPFAKEVIGQIKKYNPSEIILLPLYSQFSSTTTGSSVKNFLQN
HEMH_RICPR      EFIKE-DFIIFINMRYSTPFAKEVIGQIKEYNPSEIILLPLYPQFSSTTTGSSVKNFLQN
HEMH_CAUVC      LAMPGVEAKCFIAMRYWHPLTDETARQVAAFAPDQVVLLPLYPQFSTTTTGSSLKAWKKT
HEMH_HELPY      ----DPSRFYTYAMRYTPPYASMVLQDLALKEVESLVFFSMYPQYSSTTTLSSFNDAFNA
HEMH_HELPJ      ----DPSRFYTYAMRYTPPYASMVLQDLALKEIESLVFFSMYPQYSSTTTLSSFNDAFNA
HEMH_CAMJE      ----QDEFKFDFVNLYVPPFATEILQKYTLNASDEIILFPLYPHHSCTTVTSSLEVLQNE
HEMH_NEIMA      ------DLIVRHAMTYGNPSVADVLSELKAQGAGRLLVIPMYPQYAASSSGAAVDKVCEQ
HEMH_NEIMB      ------DLIVRHAMTYGNPSVADVLSELKAQGAGRLLVIPMYPQYAASSSGAAVDKVCEQ
HEMH_RALSO      AQ--GHDVVVACAMRYGNPSIPSVMQTLRKQGVERILVLPMYPQYSGTTTATAFDEVFRV
HEMH_ECOLI      ------EMPVALGMSYGSPSLESAVDELLAEHVDHIVVLPLYPQFSCSTVGAVWDELARI
HEMH_ECO57      ------ETPVALGMSYGSPSLESAVDELLAEHVDHIVVLPLYPQFSCSTVGAVWDELARI
HEMH_SALTI      ------DTPVALGMSYGSPSLESAVDELLASDVDHIVVLPLYPQYSCSTVGAVWDELGRI
HEMH_SALTY      ------DTPVALGMSYGSPSLESAVDELLASDVDHIVVLPLYPQYSCSTVGAVWDELGRI
HEMH_YEREN      ------EIPVELGMSYGSPNLPDAIDKLLAQGVTKLVVLPLYPQYSCSTSAAVWDAVARI
HEMH_YERPE      ------DIPVELGMSYGSPNLPEAIEKLLAQGVTNLVILPLYPQYSCSTSAAVWDAVARV
HEMH_VIBCH      ------QRPVELGMTYGEPSLLEGVRKLQQQGVEQIVVLPLYPQYSATTTAAVFDGLAKA
HEMH_HAEIN      NQ--NIDTQVEIAMTYGNPSMQSAVKNLLKNQVERIIVLPLYPQYSSSTTGAVFDAFANA
HEMH_PASMU      QQ--EKNIVVEVAMTYGEPSIKSAMQRLSTQQVDNLIVFPLYPQYSSSTTGAVFDAFAQV
HEMH_XYLFA      ------DWRVAWAMRYGAPALTKALDALQAQQVRRIVILPLYPQYSTTTTASVQDVVEAW
HEMH_BRUME      DQ---PNVVVDWAMRYGQPSIESITDRLLQQGCERIVIFPLYPQYSATTTATVNDKFFEA
HEMH_RHIME      GQ---PQVVVDWAMRYGQPSIASRIEALQKAGCERILVFPLYPQYAAATTATVNDKAFEA
HEMH_RHILO      DL---PDVTVDWAMRYGNPSTASVAERLVAQGCDRILSFPLYPQYSATTTATANDQLFRA
HEMH_BRADU      DR---DHVVVDWAMRYGNPSIKSGIDALIAEGCDRILAVPLYPQYSASTSATVCDEVFRV
HEMH_RHOCA      TRYGAGNVVVDFCMRYGNPSTRDVLDDMLAQGCERILFLPLYPQYAGATSATANDQFFRA
HEMH_ZYMMO      NI------TVDYAMRYGTPSISSRLEKLIASGCRRILLAPLYPQYSAASTATVQDEAYRY
HEMH_PSEAE      ------HGPVELAMRYGQPAIEKVLLDLARRGIRRVTLAPLYPQFADSTTTTAEQEVRRV
HEMH_PSEFC      ------QGPVELAMRYGEPSIESVLTRLAGQGISKVTLAPLYPQFADSTVTTVIEEARRV
HEMH_LACLA      ------DFDVRFAMTYGEPRIDKVIAEMKESGVEEITVLPLYPQYSLTTVEPVIQQVKKI
HEMH_CHLMU      ------QAPVISFHRYLTETHQDTLAALRE-SAGDIIGIPLFPHYTFAVTGSIIRFFLER
HEMH_CHLTR      ------QASVIPFHRYLPETHRETLQALQE-SQGSIVGIPLFPHYTFAVTGSIIRFFLQH
HEMH_CHLPN      ------RAPVIPFHRYLPSTHEKTLLALRTLHTRHVIGIPLFPHFTYSVTGSIVRFFMKH
HEMH_BACHD      ELYDDIEFKSYLGLKHIDPFIEDAVEQMKEDGVQEAVSIVLAPHFSTFSVKSYNGRAHEE
HEMH_BACSU      EIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEE
HEMH_LISIN      DAQDEVEFKAYIGLKHIEPFIEDAVEAMHKDGIEEAISIVLAPHYSSFSVEAYNKRAKDA
HEMH_LISMO      DSQDEVEFKAYIGLKHIEPFIEDAVEAMHKDGIEEAISIVLAPHYSSFSVEAYNKRAKEA
HEMH_STAAM      KAYADVEFKLYLGLKHISPFIEDAVEQMHNDGITEAITVVLAPHYSSFSVGSYDKRADEE
HEMH_STRPN      ------EYSVYFANKFSSPFIPDVIGQMEADGIEQCICLILEPHYSFYSVMGYEKFLE--
HEMH_DEIRA      ST--GRPLKAYIGMRHWSPWIEDAVREMLDDGIEQAIAIVLAPQYSSLSVAKYQKKIKAA
HEMH_MYCLE      -----LDLPVYFGNRNWEPYIEDSVVTMRDDGIRCAAVFITSAWSGYSSCTRYVEAIARA
HEMH_MYCTU      -----QELPVYFGNRNWEPYVEDAVTAMRDNGVRRAAVFATSAWSGYSSCTQYVEDIARA
HEMH_MYCAV      -----EPARLLRQPQLGALRRRHGEGHTRQRDSACRGVHHLRLERLLQLHAVRRGHRPGA
HEMH_PROFF      AR--GIDVPIANANRHSMPYMDQALADLQSRGIRRVLTLVPTPYASYSGCRAYREELLAG
HEMH_STRCO      EH--GLDLPVYWGNRNWAPYLTDTLREMVGDGRRRILVLATSAYASYSGCRQYRENLADA
HEMH_THEAC      D-----DMDVILAYKHWNPSIEEAVKGL--GSYDNIVAIPLFSFYSQNVKDSYLNPLESA
HEMH_THEVO      QS---GDVDVFTAFKHWYPSIGEVVPDL--KGYDNIVSIPLFSFFSENVKASYYKPLAEA
                                                                            

HEMH_NOSS1      WQEDPKL--QRLEYTVIPSWYKEPGYLQAMAELIRQEIEQFP---HPDQVHVFFSAHGVP
HEMH_SYNY3      WHNDPSL--RQLDYSLIPSWYDHPGYLQAMADLIAQELKKFP---NPDQAHIFFSAHGVP
HEMH_AQUAE      KK-ALKA--DHIKVKKIEHFYDHPLYIKAWAEQIKQSVEK------PEEYHFLFSAHSLP
HEMH_RICCN      LD-------IDIPIKTICCYPLEKDFIKAHVSLIKEKL-------YDKNFRILFSAHGLP
HEMH_RICPR      ID-------IDIPIKTICCYPIEEDFIKAHVSIIKEKL-------YDKNFRILFSAHGLP
HEMH_CAUVC      YK-------GSGVQTTVGCYPTEGGLIEAHARMIRESWEKAG---SPTNIRLLFSAHGLP
HEMH_HELPY      LKSL-ET--FRPKVRVIERFYASKKLNKIILNTILNTLNNR----KSQDFVLIFSVHGLP
HEMH_HELPJ      LKSL-ET--FRPKVRVIERFYADKKLNEIILNTILSALNNC----KSQDFVLIFSVHGLP
HEMH_CAMJE      ISK--QK--IQAKVKTIDIFYKNELYNEMIVSHILAKKS------KFDAKILIFSAHSLP
HEMH_NEIMA      LLLQRN----QMSVRTVSRFYDDTGYIDAMKNHILRYWAEHG-----RGKKLMLSFHGVP
HEMH_NEIMB      LLLQRN----QMSVRTVSRFYDDTGYIDAMKNHILRYWAEHG-----RGKKLMLSFHGVP
HEMH_RALSO      MGQMRN----QPELRLVKHFHDHPAYINALHQQVGAYWAQHGAPDFARGDKLLLSFHGVP
HEMH_ECOLI      LARKRS----IPGISFIRDYADNHDYINALANSVRASFAKHG-----EPDLLLLSYHGIP
HEMH_ECO57      LARKRS----IPGISFIRDYADNHDYINALANSVRASFAKHG-----EPDLLLLSYHGIP
HEMH_SALTI      LARKRR----IPGISFIRDYADDGAYIDALAKSARESFARHG-----EPDLLLLSYHGIP
HEMH_SALTY      LARKRR----IPGISFIRDYADDGAYIDALAKSARESFARHG-----EPDVLLLSYHGIP
HEMH_YEREN      LKGYRR----LPSISFIRDYAEHPAYISALKQSVENSFVQHG-----KPDRLVLSFHGIP
HEMH_YERPE      LKGYRR----LPSISFIRDYAEHPAYISALKQSVERSFAEHG-----QPDRLVMSFHGIP
HEMH_VIBCH      LRQLPV----VPELHFIRDYHDHPLYIQALAKSVRASWQQHG-----QGDLLLCSYHGIP
HEMH_HAEIN      LKEERG----LLPFDFIHSYHIDENYINALADSIKVRLKSD--------EFLLFSYHGIP
HEMH_PASMU      LKTQRG----VLPFDFIHSYHTNEDYIAALVTTIQEHFQPD--------EFLLFSFHGIP
HEMH_XYLFA      CKRTP-----QVQVECIQDYAEDSAWVAAVAASIRRHWQAHG-----RSEKLMFSFHGLP
HEMH_BRUME      LMKKRF----MPAIRTVPSYEAEPVYIDALARSVEKHLATLSFK----PEVILTSYHGIP
HEMH_RHIME      LLKMRW----QPALRTVPPYHDDPVYIDALATSINKHLATLDWE----PELVLASFHGIP
HEMH_RHILO      LMKLRR----APAIRSVPPYYAEPVYIEALASSIERHLATLDFE----PEVVITSYHGIP
HEMH_BRADU      LARLRA----QPTLRVTPPYYEDEAYIEALAVSIETHLATLPFK----PELIVASFHGMP
HEMH_RHOCA      LMQVKR----QPAARTVPEYFARPSYIEALASSVERVYATLDTR----PDVLVASYHGMP
HEMH_ZYMMO      LQKIRW----QPNLRSLEPYYTHPAYIQTLKKNIEDQIKALDFK----PDSLLLSYHGMP
HEMH_PSEAE      IAAHRL----GLEVSTLPPFYDQPVYLDALVESVRPYLQQPH-------DHLLLSFHGLP
HEMH_PSEFC      VRDKQL----DLQFSILQPFYDQPEYLDALVASARPHLQQDY-------DHLLFSFHGLP
HEMH_LACLA      DDKIK----------VIRDFHKVESYSDLLAESIREKWQAND------YDKLVLSYHGIP
HEMH_CHLMU      IP--------EKPMAWITHFGVHPQFISCMREHIQDCLIAQGIV--AEDCFFLFSVHGLP
HEMH_CHLTR      LP--------EKPISWITQFGVHPEFVSCMQQHIRDCLAAQQIA--VEDCYFLFSVHGLP
HEMH_CHLPN      VP--------EIPISWIPQFGSDSKFVSLITCHIRDFLQKLGIL--EKECCFLFSVHGLP
HEMH_BACHD      -SKKI----GGPRIQSVESWYDEPLFIQYWVDQVNDTMAKIED---KDKACVIFSAHSLP
HEMH_BACSU      -AEKL----GGLTITSVESWYDEPKFVTYWVDRVKETYASMPED-ERENAMLIVSAHSLP
HEMH_LISIN      -ADKL----GGIHIQAINDWYKQPKFIQMWADRINETAKQIPAE-ELIDTVLIVSAHSLP
HEMH_LISMO      -ADKL----GGPRINAINDWYKQPKFIQMWADRINETAKQIPAD-ELLDTVLIVSAHSLP
HEMH_STAAM      -AAKY----G-IQLTHVKHYYEQPKFIEYWTNKVNETLAQIPEE-EHKDTVLVVSAHSLP
HEMH_STRPN      -SKQ-------IQFLVIKDWYQEEALLNYWADEIAKILKEEVK---QDSFKVIFSAHSVP
HEMH_DEIRA      LEMNH----GHIDFAYIDNYHTEPGYITALADRVRIGIQEFPED-ERDDVHVILSAHSLP
HEMH_MYCLE      RRRAG---TGAPNLVKLRPYFDHPLFVEMFVDAITAAAASLPAA-LRSEARLVFTAHSVP
HEMH_MYCTU      RRAAG---RDAPELVKLRPYFDHPLFVEMFADAITAAAATV-----RGDARLVFTAHSIP
HEMH_MYCAV      HRGRA---GRARTGQAAAVFRPSAVRGDVRRRDADAAAKVP------AGARLVFTAHSVP
HEMH_PROFF      TRIDD-EGRPALQVVKLDPYADLPALVTAQVQLLRAALADHP------DAHLVFTTHSIP
HEMH_STRCO      LAALESEGLELPKIDKLRHYFNHPGFVEPMVDGVVRSLAELPAE-VRDGAHIAFCTHSIP
HEMH_THEAC      LRRYG----FSPRLEFVNGLANSDLFLPMWANIISEDASED--------SFYLFDAHSLP
HEMH_THEVO      LEKND----IRTKMEFVNGISNYDLFIPMWIHLIEEKEKGD--------SFYLFDAHSLP
                                                                        *.:*

HEMH_NOSS1      KSYVEEA---------------------GDPYQQEIEECTALIMQTLN----RPNPHTLA
HEMH_SYNY3      QSYVDEA---------------------GDPYQAEIEACTRLIMRTLD----RPNQYTLA
HEMH_AQUAE      KKLIEE----------------------GDPYQEQTEKTVKLIMENFP----EV-EYTLA
HEMH_RICCN      EKIIKA----------------------GDPYSFQIKETVQAIVKELNI---KDLDYKIT
HEMH_RICPR      KRIIKA----------------------GDPYSFQIKETVNKIVKELNI---KDLDYKIT
HEMH_CAUVC      EKVILA----------------------GDPYQKQVEATAAAVAAHLP----PQIEWTVC
HEMH_HELPY      KSVIDA----------------------GDTYQQECEHHVSLLKELMQQKNTPFKEVLLS
HEMH_HELPJ      KSIVDA----------------------GDTYQQECEHHVSLLKELMQQKNIPFKEVLLS
HEMH_CAMJE      QSIIDK----------------------GDLYEKHVNDHVEILKEKLKD-H--FDEFILA
HEMH_NEIMA      QKHYDLGDP----------------------YPDECRHTAKLLAEALELTE---DQYVVS
HEMH_NEIMB      QKHHDLGDP----------------------YPDECRHTAKLLAEALELTE---DQYVVS
HEMH_RALSO      RRTLELGDP----------------------YHCACLKTGRLLGEALGLQP---GQYLVT
HEMH_ECOLI      QRYADEGDD----------------------YPQRCRTTTRELASALGMAP---EKVMMT
HEMH_ECO57      QRYADEGDD----------------------YPQRCRTTTRELASALGMAP---EKVMMT
HEMH_SALTI      QRYADEGDD----------------------YPQRCRDTTRELVSALGLPP---EKVMMT
HEMH_SALTY      QRYADEGDD----------------------YPQRCRDTTRELVSALGLPP---EKVMMT
HEMH_YEREN      KRYAQLGDD----------------------YPQRCEDTSRALRAEIALPA---EQIMMT
HEMH_YERPE      KRYAQLGDD----------------------YPIRCEDTSRALRAALPLPA---EKIIMT
HEMH_VIBCH      KRYAQNGDI----------------------YPEHCLKTTELLAQALGLPQ---DKVMMT
HEMH_HAEIN      LRYEKMGDY----------------------YREHCKQTTIAVVNKLGLTE---NQWRMT
HEMH_PASMU      VRYENMGDY----------------------YREHCKQTVLAVIDRLGLTE---NQWGLS
HEMH_XYLFA      QRVANNGDP----------------------YPQRCQVSASLIAAALDLNE---SEWVLG
HEMH_BRUME      KSYSDKGDP----------------------YRQQCLETTRLLRERLGLGE---DEMRAT
HEMH_RHIME      KSYFEKGDP----------------------YYCQCQKTARLLREKLGWPQ---DRLQVT
HEMH_RHILO      KPYSDKGDP----------------------YQAHCLETTRLLREKLGWDE---KKLITT
HEMH_BRADU      KSYVDKGDP----------------------YQEHCIATTEALRRRLGVDA---SKLLLT
HEMH_RHOCA      KRYHREGDP----------------------YHCQCQKTSRLLRERLGWGP---DSIDTT
HEMH_ZYMMO      VKTRELGDP----------------------YYFQCQATSQALSSLLDIP------VITS
HEMH_PSEAE      ERHIRKLVKDPAHDLLAENSRNVSPEALALCYRSQCLRTAEAFAERAGLEQ---GRWSVS
HEMH_PSEFC      ERHLNKLNPGHSLEGSGDCCANASPEVRTTCYRGQCFSVARDFAARMGLPD---DKWSVA
HEMH_LACLA      LSYVTKKKD---------------------AYEEQCKETTRLVVSKLGLRE---EEYEHT
HEMH_CHLMU      MRHIRLGDP----------------------YAKQCQDSFNALIGES--------EGVLS
HEMH_CHLTR      QRHIRLGDP----------------------YAQQCQASFEALRGEL--------EGKIA
HEMH_CHLPN      VRYISQGDP----------------------YSKQCYESFSAITTNFKQ-----SENFLC
HEMH_BACHD      EKIVD----------------------YGDPYPQQLKETADLIAKGAGI-----TNYAVG
HEMH_BACSU      EKIKE----------------------FGDPYPDQLHESAKLIAEGAGV-----SEYAVG
HEMH_LISIN      EKIKQ----------------------HNDPYPDQLQETADLIFDKVAV-----PHYALG
HEMH_LISMO      EKIKQ----------------------HNDPYPNQLQETADFIFEKVVV-----PHYALG
HEMH_STAAM      KGLIEK---------------------NNDPYPQELEHTALLIKEQSNI-----EHIAIG
HEMH_STRPN      IFALD----------------------FGDPYIDQIFENSKLVAEKLGLSS---EQYTNT
HEMH_DEIRA      VRIIK----------------------EGDPYADQLHETARLVAAQAGLTD---EQWSWS
HEMH_MYCLE      VATDRRCGP--------------------ALYSRQVGYAARLVAAGAGYA-----DYDLT
HEMH_MYCTU      TAADRRCGP--------------------NLYSRQVAYATRLVAAAAGYC-----DFDLA
HEMH_MYCAV      VAADERLGP--------------------RLYSRQVAYAARLVAAAAGYA-----EHDLV
HEMH_PROFF      TAMAETSGP-------------HGNAYIPQHLALIDAVM-AELAALGLRP-----SWELA
HEMH_STRCO      TSAADGSGPVEEHG--------DGGAYVRQHLDVARLIADAVRERTGVDH-----PWQLV
HEMH_THEAC      APDRE------------------------EDYLFWLRYSTYKISQILGLS-----RSDFG
HEMH_THEVO      HPENE------------------------EDYLFWLRYSTYKITQIMGLR-----SSDFG
                                                                            

HEMH_NOSS1      YQSRVG--PVEWLQPYTEDALKELGAQGV-KDLVVVPISFVSEHIETLQEIDIEYREIAE
HEMH_SYNY3      YQSRVG--PVEWLKPYTEEALQKLGAEGI-DDLLVVPISFVSEHIETLQEIDIEYREIAE
HEMH_AQUAE      YQSKVG--FGKWLEPSTDEVIRNLIKKEV-KKLLVIPISFVSEHSETLYELDKQYRELAQ
HEMH_RICCN      YQSRVG--PIEWLKPNTEDEIELAGKLK--KDIIIVPISFVSEHVETLVELDIEYKLIAD
HEMH_RICPR      YQSRVG--PIEWLKPNTEDEIELAGKLK--KDIIIVPISFVSEHVETLVELDIEYKLIAD
HEMH_CAUVC      YQSRVG--PLKWIGPSTDDEIRRAGGED--KGVMITPIAFVSEHVETLVELDHEYAELAE
HEMH_HELPY      YQSKLG--PMKWLEPSTEELIEKHRKSH----IIIYPLAFTIDNSETLYELDMQYRLMAE
HEMH_HELPJ      YQSKLG--PMKWLEPSTEELIEKHRKSN----IIIYPLAFTIDNSETLYELDMQYRLMAE
HEMH_CAMJE      YQSKLG--PVKWLEPNTSDVLANL-NDK----ALIYPISFCIDCSETIFELGMEYK----
HEMH_NEIMA      FQSQFG--RAKWVTPSTQDLFGKLPKQGV-TELDVFCPGFLADCLETMEEIALMGREQFY
HEMH_NEIMB      FQSQFG--RAKWVTPSTQDLFGKLPKQGV-TELDVFCPGFLADCLETMEEIALMGREQFY
HEMH_RALSO      FQSRFG--RAEWLQPYTAPTLEELGRVGT-GRVDVFCPGFPADCLETLEEIAMEGQSTFR
HEMH_ECOLI      FQSRFG--REPWLMPYTDETLKMLGEKGV-GHIQVMCPGFAADCLETLEEIAEQNREVFL
HEMH_ECO57      FQSRFG--REPWLMPYTDETLKMLGEKGV-GHIQVMCPGFAADCLETLEEIAEQNREVFL
HEMH_SALTI      FQSRFG--REPWLTPYTDETLKMLGEKGT-GHIQVMCPGFAADCLETLEEIAEQNREIFL
HEMH_SALTY      FQSRFG--REPWLTPYTDETLKMLGEKGT-GHIQVMCPGFAADCLETLEEIAEQNREIFL
HEMH_YEREN      YQSRFG--REPWLTPYTDETLKSLPSQGV-KHIQLICPGFSADCLETLEEIKEQNREVFI
HEMH_YERPE      YQSRFG--REPWLTPYTDETLKSLPSQGV-KHIQLICPGFSADCLETLEEIKEQNREFFL
HEMH_VIBCH      YQSQFG--KEEWLQPYTDKTMEALPRQGI-KKLDVICPAFSVDCLETLEEIAEQNQEIFL
HEMH_HAEIN      FQSRFG--REEWLQPYTDKFLESAAAQNI-QKIAVICPGFSVDCLETIEEIDEENRENFL
HEMH_PASMU      FQSRFG--KEEWLQPYTDQFLAQAPSQNI-QKMAVICPGFAADCLETLEEIEEENKEIFL
HEMH_XYLFA      YQSRFG--AERWLQPYAEPTLWALAESGI-RRFDLVCPGFSVDCLETLEEVALGFSE-TL
HEMH_BRUME      FQSRFG--PEEWLQPYTDETVKELAKNGV-KSVAVLNPGFVADCLETVDEIGNEAAEEFL
HEMH_RHIME      FQSRFG--PEEWLQPYTDATVERLAKEGV-KRIAVINPGFVSDCLETLEEIAGQAAESFH
HEMH_RHILO      FQSRFG--AQEWLQPYTDKTVEKLGKDGV-KSIAIVNPGFSVDCIETLDEIGREAAETFH
HEMH_BRADU      FQSRFG--NDEWLQPYTDKTMERLAKEGV-RRIAVVTPGFAADCLETLEEIAQENAEIFK
HEMH_RHOCA      FQSVFG--TEEWLRPYTVEHVVQLAEAGK-KNIAVISPAFSADCIETLEEINGEIREAFE
HEMH_ZYMMO      FQSRFG--SQKWFTPATDMTLKELPSKNI-RNLAVAMPGFSADCLETLEEIALQGKSTFL
HEMH_PSEAE      FQSRLG--RAKWIEPYTDAKLDELVQRGV-KRLLVMCPAFVADCIETLEEIGMRGREQFI
HEMH_PSEFC      FQSRLG--RAKWIEPYTEARLEALAQQGV-KKLLVMCPAFVADCIETLEEIGDRGLEQFR
HEMH_LACLA      YQSKFG--PEKWLEPATIDRVAELPKENA-KKVLICSPAFVADCLETLFELEIENKEVFV
HEMH_CHLMU      FQSKFG--IGEWLVPSTKEICQSLCTKK--RYIVVVPFGFVSDHIETLYEIDHLYVPMLL
HEMH_CHLTR      FQSKFG--IGKWLDPSTQEVCQSLRTKK--RYIVIVPFGFVSDHIETLHEIDHLYVPILL
HEMH_CHLPN      FQSKFG--PGKWLSPSTAQLCQNIDTDK--PNVIVVPFGFISDHLETLYEIERDYLPLLR
HEMH_BACHD      WQSE-GNTPEPWLGPDVQDLTRDLYETHGYTSMIYCPVGFVADHLEVLYDNDYECKVVTD
HEMH_BACSU      WQSE-GNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTD
HEMH_LISIN      WQSE-GKTGEPWLGPDVQDLTRELYGREKYKHFIYTPVGFVAEHLEVLYDNDYECKVVTD
HEMH_LISMO      WQSE-GKTGEPWLGPDVQDLTRELYGREKYKHFIYTPVGFVAEHLEVLYDNDYECKVVTD
HEMH_STAAM      WQSE-GNTGTPWLGPDVQDLTRDLYEKHQYKNFIYTPVGFVCEHLEVLYDNDYECKVVCD
HEMH_STRPN      WQSE-SDIGIPWIKPDVLEYLREQTEHP--DHYIFVPISFISEHIEVLFDNDVECYDLCQ
HEMH_DEIRA      YQSA-GRSPEPWLGPQLDEHLRDLNEQG-IKKVVSIAIGFVSDHVEILFDIDIAAQEVAH
HEMH_MYCLE      WQSRSGPPYVPWLAPDVGDQLMTLASAG-TKAVIVCPIGFVADHIEVVWDLDHELRSQAD
HEMH_MYCTU      WQSRSGPPQVPWLEPDVTDQLTGLAGAG-INAVIVCPIGFVADHIEVVWDLDHELRLQAE
HEMH_MYCAV      WQSRSGPPQVRWLEPDVADHLRALAESG-TRAVIVCPIGFVADHIEVVWDLDEELRAQAE
HEMH_PROFF      YQSRSGSPRTPWLEPDINDVITRLAGEG-VRDVICSPIGFLTDHMEVVWDLDTEAAATAA
HEMH_STRCO      YQSRSGAPHIPWLEPDICDHLEERQAAG-VPAVVMAPIGFVSDHMEVLYDLDTEATAKAE
HEMH_THEAC      FQGG----HLGWLGPSIYDVLNR-IDA---SKITVIPISFLYDHLEILYDLDYEFRKAVE
HEMH_THEVO      FQGG----HEGWLGPSIYNVYRK-AKE---KKIIAVPISFLYDHLEILYDLDYEFRKKIE
                :*.        *. *                       .*  :  * : :          

HEMH_NOSS1      EAGIHNFRRVPAPNTHPVFIRALADLVIDALNKPSFKLSQAAQIKKMVKMYPPESWEWGM
HEMH_SYNY3      EAGIDNFQRVPALNTHPVFIDALAQMVMDSLNDPPCTFETVPHPKKNMKMYPQERWEWGL
HEMH_AQUAE      ELGYEEFVRVPTLRTNPYFISALEDLVKNEV-----------------------------
HEMH_RICCN      KY-EIQYIRIPTLGTNKIFINSLTNILLRFINKVDTNLVMSSSSTR---I----------
HEMH_RICPR      KY-KIQYTRIPTLGTNKIFINSLTNILLRFINNTNTNLVMSSSSKR---I----------
HEMH_CAUVC      EVGAAPYLRVSALGTAPEFIDGLAKAVRDSVGKAPGTVSSACGWR---------------
HEMH_HELPY      RLAVKEYLVCPCLNDSIEFAQFIIERVKNLKE----------------------------
HEMH_HELPJ      RLAVKEYLVCPCLNDSIEFAKFIIELVKNLKSE---------------------------
HEMH_CAMJE      HLSKYNYDLISCPNDSDEFMEFILKYLSDLN-----------------------------
HEMH_NEIMA      EAGGKSYRYIPCLNDNPDWIDALVALAEENLGGWR-------------------------
HEMH_NEIMB      EAGGKSYRYIPCLNDNPDWIDALVALAEENLGSWR-------------------------
HEMH_RALSO      VAGGKDFHYIPCLNDSEPWIAGLADIAQAHLQGWPLALPHPHVLEASRTRAQSKGAAA--
HEMH_ECOLI      GAGGKKYEYIPALNATPEHIEMMANLVAAYR-----------------------------
HEMH_ECO57      GAGGKKYEYIPALNATPEHIEMMANLVAAYR-----------------------------
HEMH_SALTI      EAGGKKYAYIQALNATPEHIDMILKLTAPYR-----------------------------
HEMH_SALTY      EAGGKKYAYIPALNATPEHIDMMLKLTAPYR-----------------------------
HEMH_YEREN      HAGGEKFEYIPALNDDKGHIDLLEQLVRDHLSC---------------------------
HEMH_YERPE      HAGGEKFEYIPALNDDEGHIALLEQLIRHNI-----------------------------
HEMH_VIBCH      HSGGEAFHYVPCLNDSQSHIELMAALVKVDC-----------------------------
HEMH_HAEIN      NNGGQSYQYIPALNVEHAHIEMMGKLILEKLT----------------------------
HEMH_PASMU      ANGGISYRYIPALNARPEHIQMMANLILNKLNQTSK------------------------
HEMH_XYLFA      AARGATMRYIPCLNDDPAHVQALAGLAQRALL----------------------------
HEMH_BRUME      ENGGENFSHIPCLNDSEEGMKVIETLVRRELLGWV-------------------------
HEMH_RHIME      HNGGEKFAHIPCLNDSPEGMAVLNHVVRRELEGWL-------------------------
HEMH_RHILO      HAGGKNFAHIPCLNDSAEGMTVIEAMVRRELSGWV-------------------------
HEMH_BRADU      HNGGEQFSAIPCLNDSEPGMDVIRTLVLRELQGWI-------------------------
HEMH_RHOCA      HAGGESFTYVPCLNDDDLHIAALLEVVEENLAGWID------------------------
HEMH_ZYMMO      EAGGENFAALRCLNDSEESLAMLEILVNQGLSGWLKSGE---------------------
HEMH_PSEAE      SAGGEDLVLIPCLNDHPAWVGALAEMSGRLARPL--------------------------
HEMH_PSEFC      EAGGEELVLVPCLNDDPQWAVALNTLCERAPVSL--------------------------
HEMH_LACLA      ENGGETFDFVHPFNDSLDFTRVLSEVVDQNRL----------------------------
HEMH_CHLMU      QR-GYRVVRVPAINTSDRWVSALASIVKSSPHETILEPLLMPKRR---------------
HEMH_CHLTR      QK-GYRVVRIPAINASSRWVSSLAAIVRSSPQETSLEPLLMP------------------
HEMH_CHLPN      SR-GYRALRIPAIYSSPLWVSTLVDIVKENSTVVAEELIKSGKKHTGIR-----------
HEMH_BACHD      EL-GIDYYRPEMPNAKPEFIDCLATVIQKKLAEKE-------------------------
HEMH_BACSU      DI-GASYYRPEMPNAKPEFIDALATVVLKKLGR---------------------------
HEMH_LISIN      EV-GAAYHRPPMPNADPEFLEVLRTVVWDAYTK---------------------------
HEMH_LISMO      EV-GAAYHRPPMPNSDPEFLEVLRTVVWEKYSN---------------------------
HEMH_STAAM      DI-GANYYRPKMPNTHPLFIGAIVDEIKSIF-----------------------------
HEMH_STRPN      EF-GVNYHRPPMPNTDSRLIDALVNTVRVNENQEFKEFLPEEETFDELVPSDETKNILAE
HEMH_DEIRA      EL-GMTLVRPPALNTDPLFIGTLASVIERKAAEVA-------------------------
HEMH_MYCLE      AA-GVAFARAATPNADRRFARLAASLIDELTHDRVPVRVNGSDPVPGCLASINGVPCDLP
HEMH_MYCTU      AA-GIAYARASTPNADPRFARLARGLIDELRYGRIPARVSGPDPVPGCLSSINGQPCRPP
HEMH_MYCAV      SA-GMLMARASTPNGQPRFGRLAADLIDELRCGRTPARVTGPDQVPGCLASVNGAPCRPP
HEMH_PROFF      EH-SMAFTRVATVGTLPVFIEGLADLIVAALSTKPGT-GPDAPAARHWCTPDCCPNARIA
HEMH_STRCO      EL-GLPVRRSATVGADPRFAAAVRDLVLERAGDERGQEVTPCALGTLGASHNLCPVGCCP
HEMH_THEAC      AK-GMHYRRVRMPNDSAMMVNMIERAARSAITHLSGEKINGSIIGQPRIADTDNGR----
HEMH_THEVO      ED-GYSYERVPMPNDSAIFITLLERIVSSSITHLSGELIGNGKEKSENFI----------
                                                                            

HEMH_NOSS1      TSSAEVWNGRIAMLGFIALIIELVTGQGLLHMIGLLQ----
HEMH_SYNY3      TTAAEVWNGRLAMLGFIALLVELISGQGPLHFVGLL-----
HEMH_AQUAE      -----------------------------------------
HEMH_RICCN      --CPNEFTKCLCKLTS-------------------------
HEMH_RICPR      --CPNKFTKCLCNLTN-------------------------
HEMH_CAUVC      --CGADWSKCPCREGASA-----------------------
HEMH_HELPY      -----------------------------------------
HEMH_HELPJ      -----------------------------------------
HEMH_CAMJE      -----------------------------------------
HEMH_NEIMA      -----------------------------------------
HEMH_NEIMB      -----------------------------------------
HEMH_RALSO      -----------------------------------------
HEMH_ECOLI      -----------------------------------------
HEMH_ECO57      -----------------------------------------
HEMH_SALTI      -----------------------------------------
HEMH_SALTY      -----------------------------------------
HEMH_YEREN      -----------------------------------------
HEMH_YERPE      -----------------------------------------
HEMH_VIBCH      -----------------------------------------
HEMH_HAEIN      -----------------------------------------
HEMH_PASMU      -----------------------------------------
HEMH_XYLFA      -----------------------------------------
HEMH_BRUME      -----------------------------------------
HEMH_RHIME      -----------------------------------------
HEMH_RHILO      -----------------------------------------
HEMH_BRADU      -----------------------------------------
HEMH_RHOCA      -----------------------------------------
HEMH_ZYMMO      -----------------------------------------
HEMH_PSEAE      -----------------------------------------
HEMH_PSEFC      -----------------------------------------
HEMH_LACLA      -----------------------------------------
HEMH_CHLMU      -----------------------------------------
HEMH_CHLTR      -----------------------------------------
HEMH_CHLPN      -----------------------------------------
HEMH_BACHD      -----------------------------------------
HEMH_BACSU      -----------------------------------------
HEMH_LISIN      -----------------------------------------
HEMH_LISMO      -----------------------------------------
HEMH_STAAM      -----------------------------------------
HEMH_STRPN      SQDLQMPEFVKKLIEKKGRENVKMPYLIKKMLEKAGKLPKE
HEMH_DEIRA      -----------------------------------------
HEMH_MYCLE      HCVA-------------------------------------
HEMH_MYCTU      HCVASVSPARPSAGSP-------------------------
HEMH_MYCAV      HCAAQATG---------------------------------
HEMH_PROFF      GRPTIPGFAAGPR----------------------------
HEMH_STRCO      ARAPRPAAAGADSPYA-------------------------
HEMH_THEAC      -----------------------------------------
HEMH_THEVO      -----------------------------------------