CLUSTAL format seed alignment for MF_00328

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KGUA_BUCBP      ----------------------------------------------------MAKGLLFI
KGUA_ECOLI      ----------------------------------------------------MAQGTLYI
KGUA_BLOFL      --------------------------------------------------MKKYSGLLGI
KGUA_RICPR      -------------------------------------------------MKFKNKGLIII
KGUA_WIGBR      ----------------------------------------------------MKKNMYYA
KGUA_RHIME      ----------------------------------------MKPATVSPIK-IARRGLMLV
KGUA_RHOPA      ----------------------------------------MSDGTAGSYSGVERRGLMFV
KGUA_CAUVC      ----------------------------------------------MNKSHHPHRGLLLM
KGUA_PSESM      --------------------------------------------------MTHITGTLYI
KGUA_COXBU      ----------------------------------------------------MNKANLFI
KGUA_NITEU      ------------------------------------------------------MSCLFV
KGUA_BORPE      ---------------------------------------------MSFLSMSAPSGNVFM
KGUA_CHRVO      --------------------------------------------------MNQPIGNIYI
KGUA_XYLFT      -----------------------------------------------------MRGTLYI
KGUA_NEIMB      -------------------------------------------------MSAYRKGNIFI
KGUA_GEOSL      ---------------------------------------------------MKREGVLYI
KGUA_CAMJE      ---------------------------------------------------MKLQGFVLL
KGUA_HELHP      ----------------------------------------------------MSKGAVLI
KGUA_HELPJ      ---------------------------------------------------MNNDFNLLI
KGUA_WOLSU      --------------------------------------------------MERSKGAILV
KGUA_THEMA      -----------------------------------------------------MKGQLFV
KGUA_BDEBA      -----------------------------------------------------MKTRMII
KGUA_MYCTU      -----------------------------------MSVGEGPDTKPTARGQPAAVGRVVV
KGUA_COREF      -----------------------------------MS-GDKP------------HGRLVI
KGUA_BIFLO      ------------------------------------------------MTENTHAGRLIV
KGUA_STRAW      ---------------------------------------MAVTPRGTSPVPPDARPRLTV
KGUA_TROWT      --------------------------------------------MQLFDLWTDLLDLLTI
KGUA_SYNY3      ----------------------------------------------MAPDQTSVKGQLIV
KGUA_SYNPX      ------------------------------------------------------MGTLTV
KGUA_THEEB      -----------------------------------------------MTSATPQPGQLIV
KGUA_GLOVI      ---------------------------------------MPFYRRSAGSPAGHPLSRLLV
KGUA_DEIRA      -------------------------------------MMASAPQDRPAGTPPQGRGLLIV
KGUA_FUSNN      ----------------------------------------------------MSLGALYV
KGUA_RHOBA      ----------------------------------------MNDPSCSSADETAHPGRLVI
KGUA_MYCPN      -MQSRLAWSKGNWTGLVGSLISLTSSSTSHALVGNNSILICGKIKIILNIEMVDTGRIFV
KGUA_MYCGE      MIQVSICSSIGKLTASVGLLIKALSSKTSQVLVGWKVIDKNSKVKIILTIEVNNQGRIFV
KGUA_MYCGA      --------------------------------------------MVVIYIMSNKQGLIIL
KGUA_MYCPU      ----------------------------------------------MINIHKRN---IVL
KGUA_UREPA      ----------------------------------------------------MKRGKLIV
KGUA_MYCPE      ------------------------------------------------MEEKNKKGKIII
KGUA_ENTFA      -------------------------------------------------MS--ERGLLIV
KGUA_LACJO      -------------------------------------------------MA--HQGLLLV
KGUA_STAES      -------------------------------------------------MDK-EKGLLIV
KGUA_ONYPE      -------------------------------------------------MKLNKKGLLIV
KGUA_CALS4      -------------------------------------------------MSIKKQGLLIV
KGUA_PROMP      ---------------------------------------------------MKNLKKLII
KGUA_BACTN      --------------------------------------MSTFSVFNFQFSIKQMTGKLII
KGUA_PORGI      ------------------------------------------------------MTKLII
KGUA_CHLTE      --------------------------------------MSAEQVLD--------QGRLIV
KGUA_CHLTR      --------------------------------------MSVKVISPFSQDGVQCFPKLFI
KGUA_CHLCV      --------------------------------------MKDKVRVPFSPDHPSCAPKLFT
                                                                            

KGUA_BUCBP      VSAPSGTGKSSLIQALVNTH------PLYSIKVSVSHTTRIIRPGECHGKHYYFISNTEF
KGUA_ECOLI      VSAPSGAGKSSLIQALLKTQ------PLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEF
KGUA_BLOFL      ISAPSGAGKSTLINALQKND------SILQIKLSISYTTRKKRPGEVHGKDYYFISIEEF
KGUA_RICPR      LSSPSGTGKSSLAKELLK--------IDNNLRLSISVTTRKPRLGEVDGINYYFKSDREF
KGUA_WIGBR      ISAPSGTGKSSLIKTFLNTN------LGMNFRLSISHTTRNIRSEEIEGKDYFFISKEKF
KGUA_RHIME      ISSPSGAGKSTIARNLLEAD--------PDLSISVSVTTRSRRPSEIEGRHYFFKSIREF
KGUA_RHOPA      LSSPSGAGKTTLSRMLVEQM--------PGLQMSVSATTRPMRPGEVDGRDYYFVDRPKF
KGUA_CAUVC      VVAPSGVGKTSLTRRLVSDH--------GDLHLSISATTRDPRPGEHDGRDYHFVSRDKF
KGUA_PSESM      ISAPSGAGKTSLVKALMDAQQEPQHGAQAKIRVSVSHTTRAMRPGEVDGVNYNFVDRAEF
KGUA_COXBU      ISAPSGAGKTSLVRALVKAL--------AEIKISISHTTRPKRPGDQEGVDYFFIDETRF
KGUA_NITEU      ISAPSGAGKTSVIRTLLQTD--------INLTLSISYTTRPPRRDEKNGHDYFFVDHATF
KGUA_BORPE      VVAPSGAGKSSLVRALLDRD--------PSLVLSISCTTRAPRPGEQDGREYRFVDQAEF
KGUA_CHRVO      VVAPSGAGKTSLVAALLQAE--------PSVELSISYSTRQARKGEIDGQHYHFIDRAAF
KGUA_XYLFT      VSASSGTGKSSIVNATLERD--------QQIALSISFTSRQPRPNERHAQHYYFVSADEF
KGUA_NEIMB      ISAASGTGKTTLVSRLLANH--------NGLRVSVSHTTRPPREGEANGVHYHFVSKEEF
KGUA_GEOSL      LSAPSGAGKTTLCREIIDIF--------PQLRHSVSYTTRTPRPGEIHGKDYFFVSMDEF
KGUA_CAMJE      ISGPSGAGKSTLLKKLFDEFEDE-------LYFSISSTTRKPREGEKNGIHYHFISHEEF
KGUA_HELHP      ISGPSGCGKSTLTKSLIESIPN--------VYFSISTTTRPMREGETDGVHYHFVSKEHF
KGUA_HELPJ      LSGPSGAGKSTLTKYLQEKIPK--------THFSLSTTTRKPREGEVDGLHYNFVSEEEF
KGUA_WOLSU      LSGPSGSGKSSLCKTLFKEIKN--------AYFSVSTTTRTPREGEIEGKHYHFVSKEKF
KGUA_THEMA      ICGPSGAGKTSIIKEVLKRLDN--------VVFSVSCTTRPKRPHEEDGKDYFFITEEEF
KGUA_BDEBA      VAAPSGAGKSSFVERITREDSR--------LVDIVTFTTRSIRQGETPGLQYNFIDHADF
KGUA_MYCTU      LSGPSAVGKSTVVRCLRERIP--------NLHFSVSATTRAPRPGEVDGVDYHFIDPTRF
KGUA_COREF      LAGPSAVGKSTVVDRLRSDVP--------NLYFSVSMTTRDPRPGEVDGRDYFYVTAQEF
KGUA_BIFLO      LTGPTAVGKGTVEAKLRADHP--------EVWVSVSATTRAPRPGEVDGVNYWFLTEDEF
KGUA_STRAW      LSGPSGVGKSTVVAHMRKEHP--------EVWLSVSATTRKPRPGEKHGVHYFFVSDDEM
KGUA_TROWT      VAGPTAVGKGTVISHLRKCHP--------QVKVSISATTREPRDSERDGIDYYFVTDEVF
KGUA_SYNY3      LTGPSGVGKGTLVQLLLERQP--------HWFLSISATTRSPRAGEVDGQSYYFLTKEEF
KGUA_SYNPX      ITGPSGVGKGTLVQRLLARNP--------SIWVSVSATTRAPREGEREGESYFFHSRERF
KGUA_THEEB      ITGPSGVGKGTLLRQLRQRHP--------ELALSVSATTRPPRPTEVAGVDYYFVSVEEF
KGUA_GLOVI      LSGPSGVGKDTILREVRERHP--------GLYVSVSATTRPPRPGEVDGRDYRFLSAAEF
KGUA_DEIRA      VTGASGVGKGTLRERWLAGQ---------DVFYSTSWTTREPRPGEVNGRDYVFVSPAEF
KGUA_FUSNN      VSGPSGAGKSTVCKLVRER--L-------GINLSISATSRKPRNGEQEGVDYFFITAEEF
KGUA_RHOBA      ISGPSGAGKSTVVKQLMKRCDV-------PLQLSVSATTREPRPGEIHGQDYFFLSHEEF
KGUA_MYCPN      ITGPSGVGKSSLVRCLIDHFKD-------KLRYSISATTRKMRNSETEGVDYFFKDKAEF
KGUA_MYCGE      ITGPSGVGKSTLVKALLDHFKE-------QLFYSISATTRKKRISEKEGIDYFFKDKDEF
KGUA_MYCGA      ISGPSGVGKGTIVSRLLSDNNL-------KLNVSISATTRKKRASEVEGVHYFFKTKEEF
KGUA_MYCPU      LVGPSGVGKGTIEKILFESKTL-------KLSLSRSATTRKKREGEINGIHYFFISKEEF
KGUA_UREPA      FSGPSGVGKHTILSKIINRKDL-------NLAYSISMTTRKKREGEVNGVDYYFVNDEEF
KGUA_MYCPE      ISGPSGVGKKTIIDQVINNVDL-------NLTYSISMTTRLPREHEKNGVDYFFVSEEEF
KGUA_ENTFA      LSGPSGVGKGTVRKAIFDSEEN-------DFQYSISMTTRKQREGEVDGVDYYFRSREEF
KGUA_LACJO      LSGPSGVGKGTVKSAMVKQKAF-------SFEYSVSMTTRKPRPGEVNGKDYYFVSEDRF
KGUA_STAES      LSGPSGVGKGTVRKKIFEDPTT-------SYKYSISMTTRHMREGEIDGVDYFFKTKEEF
KGUA_ONYPE      LSGPSGVGKATVRKALFEMTNH-------NFVYSVSATTRKPRPGEQDGKDYHFLTKEEF
KGUA_CALS4      ISGPSGAGKGTICKALIEKEK--------DLKLSISATTRQPRAGEVDGKNYFFKSEEEF
KGUA_PROMP      ITGPSGVGKGTVIKELLDRNK--------DIWLSISATTRNPRVGEKDDLNYYFIGEERF
KGUA_BACTN      FSAPSGSGKSTIINYLLT-QNL-------NLAFSISATSRPPRGTEKHGVEYFFLTPEEF
KGUA_PORGI      ISAPSGTGKSTVIERLLTDREL-------NLHFSISATSRAPRGEEQNGREYYFLSPEEF
KGUA_CHLTE      FSAPSGTGKSTVAKLVME-RLG-------SLEFSVSATTRQMRAGERDGVDYHFLSREEF
KGUA_CHLTR      ISAPAGAGKTTLTHMLQREFPD-------AFEKTVSSTTRSARPGEVHGVDYLFVSEDDF
KGUA_CHLCV      ISAPAGAGKTTLVRMLAQEFPD-------SFQKTLSLTTRAPRPEEVSGIDYWFVSQEEF
                . ..:. ** :.                       : ::*  *  :     * :     :

KGUA_BUCBP      QNMIDKEEFLEYAKVFN--NYYGTSKKQINYGLSTGTDVFLDIDWQGARQIRNKL-PE--
KGUA_ECOLI      KEMISRDAFLEHAEVFG--NYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKM-PH--
KGUA_BLOFL      QNMINQNMFLEYAKVFN--HYYGTEKNSIKLMLNSGVHVILNIDWQGMNQIRNKK-LD--
KGUA_RICPR      KTLVKQNKFLEYAKIYN--DYYGTPKEYVKMLLKQGFDVLFDIDWQGVRSIKKNT-NN--
KGUA_WIGBR      KKMIFEKKFIEYTYSFN--NYYGTSFKEVKNKIKSNFSLFFDVNYKGVKKIKEFI-PK--
KGUA_RHIME      EALRATDSLLEWAEVHG--NYYGTPRDAVEKAMGEGRDMLFDIDWQGAQQLQEKMAGD--
KGUA_RHOPA      DEMVGAGEFLEWANVFD--NRYGTPRAPVEAALAVGRDVLFDIDWQGTQQLRSRAGSD--
KGUA_CAUVC      QGMLAEDAFLEWAEVYG--NFYGSPKAPIMDALSRGESVLFDIDFQGAMKVHKQAGAD--
KGUA_PSESM      VRMIEHGDFLEQAEVFG--NLYGTSQSHLQQTLDEGHDLILEIDWQGARQVRTQM-PQ--
KGUA_COXBU      QAMVKEGAFLEHATIYE--RHYGTEKDWVLRQLKAGRDVLLEIDWQGARQIRELF-PP--
KGUA_NITEU      KDMQARGEFLESAEVHG--NLYGTSRKWIEETMAAEQDVLLEIDCQGAQQIRTVY-PQ--
KGUA_BORPE      ARLRDAQQLLEWAEVHG--NFYGTPRDRIDEATRAGHDVLLEIDWQGARQVKQRY-PE--
KGUA_CHRVO      EEMKDRGDFLEWAEVYG--NCYGTSAPWIRGRLEAGRDILLEIDWQGAEQVRKVF-PD--
KGUA_XYLFT      QRMIEAGDFFEYALVHG--DWKGTARQSVEPQLAAGHDVLLEIDWQGARQVRSKI-PD--
KGUA_NEIMB      ESLIAQEAFLEYADVFG--NYYGTGAEGVNALAAAGYDVILEIDVQGAAQVRDAL-PE--
KGUA_GEOSL      HRMIDADEFAEWAEVHG--NCYGTSIRTLEENRAAGVDLILDIDIQGARQLQERF-AG--
KGUA_CAMJE      QKGIDSDHFLEWARVHE--NFYGTSLKHTQNALDNGKIVVFDIDVQGFKIARKKMADK--
KGUA_HELHP      LQDIHNNVFLEWAEVHT--NFYGTSLKPVQQALEQDKIVLFDVDVQGHHSIKEYFGDF--
KGUA_HELPJ      KQGIEKGQFLEWAIVHN--HYYGTSKIPVEKALKEGKIVIFDIDVQGHEILKKHYPN---
KGUA_WOLSU      LEGIEENFFLEWAEVHG--NYYGTSKESVESALAQGKLVVFDIDIQGHRNIKESYPEL--
KGUA_THEMA      LKRVERGEFLEWARVHG--HLYGTLRSFVESHINEGKDVVLDIDVQGALSVKKKYSN---
KGUA_BDEBA      EQKIKEGFFVEWAKVHT--NFYGTSYSSLETAWNQGKTAIMDIDIQGVATFKSKFPD---
KGUA_MYCTU      QQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPE---
KGUA_COREF      QEKIDRGEMLEWADIHGGLQRSGTPAEPVRQAREEGRPVLVEVDLVGARNIARLIPE---
KGUA_BIFLO      LAREAAGEFLETAVVHGM-AHYGTLLKPVEEHLAAGVPTILEIDLQGARRVKQRAAEL-D
KGUA_STRAW      DKLIANGELLEWAEFAG--NRYGTPRQAVLERLERGEPVLLEIDLQGARQVRESMPE---
KGUA_TROWT      DCMVRSGQMLEWATVHGL-HKYGTPKEEVERLLHTGQPVILEIDLQGMRKVRKILPA---
KGUA_SYNY3      QTWIGEEKLLEWAEYAG--NYYGTPRQPVEEQIAQGKTVLLEIEVLGARQIKQTFPS---
KGUA_SYNPX      DALVQEGGLLEWAEFAG--NCYGTPRAPVEQQLQAGRPVLLEIELEGARQVRRSFSK---
KGUA_THEEB      KAMIAAGQLLEWAEFAG--HYYGTPRQPLVQLIAQGKTVILEIELQGARQVRQSYPQ---
KGUA_GLOVI      EEWIATDDLLEWACYVG--NYYGTPKTPVLERLAVGEPVVLEIDVQGALQVKNNFPA---
KGUA_DEIRA      LAKAQQNGFLEHAQFVG--NHYGTPIEPIEAALERGQDVVLEIEVEGAMQVKDRMGE---
KGUA_FUSNN      ERKIKNDDFLEYANVH--GNYYGTLKSEVEERLKRGEKVLLEIDVQGGVQV-KNKFP---
KGUA_RHOBA      ERRRKLNDFVECKQVFSMGQWYGTLKDQVATGLNAGKWVILEIDVQGAMAVLDDPHY---
KGUA_MYCPN      EKLIAADAFVEWAMYN--DNYYGTLKSQAEQIIHNGGNLVLEIEYQGALQVKQKY----P
KGUA_MYCGE      ENLIKQDAFIEWACYN--NHYYGTLKSQAEQAIKSGINLMLEIEYQGALQVKSKY----P
KGUA_MYCGA      EQMIANNQLLEYANYV--NNYYGTPLSLVKEILDKNENLILEIEYQGVIQVLRK-----G
KGUA_MYCPU      ESKIENDEFMEWNEHF--DNYYGTLLSEILLIFSQGRIPVLEVETYGAKKILQKYKDKKD
KGUA_UREPA      KKAILNNELIEWAEFV--GNKYGTPRTIVEKLRDEGKNVILEIEVVGALKVLDLYK---N
KGUA_MYCPE      NSAIEKGELLEWAEFA--NNKYGTPIKNLYKLIGENKNVILEIEVQGATKVKDILN---R
KGUA_ENTFA      EAMIEAGEMLEYAEYV--GNYYGTPLTYVNQTLDEGKDVFLEIEVQGAKQVKDK-----V
KGUA_LACJO      QEAIKGNELLEYNEYV--GNHYGTPLAPVQKMLNEGKDVLLEIDVNGAKQVRKL-----M
KGUA_STAES      EALIKDDQFIEYAQYV--GNYYGTPVQYVKDTMEEGHDVFLEIEVEGAKQVRKK-----F
KGUA_ONYPE      EKGIENNCFLEWAKFI--DHYYGTPKKQIQDFLKQGKEVFLEIEVEGATHLRKKR----I
KGUA_CALS4      KRMIEEDAFLEWAKVY--DHYYGTPKEFVLKNLEEGNDVVLEIDIQGALKVKEKF-----
KGUA_PROMP      KDMIDKKEFLEWAQFA--GNYYGTPLSTVNEKIEKGFIVLLEIEVEGAKQIKEKF-----
KGUA_BACTN      RCRIENNEFLEY-EEVYKDRYYGTLKEQVEKQLEKGQNVVFDLDVVGGCNIKKYYGE---
KGUA_PORGI      RRRIEANEFVEY-EEVYRDKYYGTLKSEVERILKEEKNVIFDVDVVGAQSIKKYYGD---
KGUA_CHLTE      EKKIAENGFIEH-EFFFGN-FYGTLLDKTIDAIKAGHNLLFDLDVKGALNLKRIFGD---
KGUA_CHLTR      KQSLDREDFLEWVFLFG--TYYGTSKAEISRVLQKGKHCIAVIDVQGALALKKQMPA---
KGUA_CHLCV      KQRLDSNNFLEWVLLFG--EYYGTSRLEIDEIWKSGKHAVAVIDVEGALSLKSKIPT---
                        : *           *:               .  ::  *             

KGUA_BUCBP      --SKSIFILPPSKEELYRRLCKRGQDSDIIIKKRMNQAVSEMKHYIDYDYLIINDNFNLA
KGUA_ECOLI      --ARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTA
KGUA_BLOFL      --FYTIFILPPSQKELEKRLRFRGLDTDQVIFDRMKQAMNEISHCKEYDYIIINDDFNIA
KGUA_RICPR      --VITIFILPPSIEILEQRLRNRATDNEETIKLRMQSAQNEISHANEYDYVVINDDFSQT
KGUA_WIGBR      --LISIFILPPSKLDLLKRLYNRYNSNEFELNKRFYKYKKDILNYNKYDFILINRDFNNT
KGUA_RHIME      --VVSIFILPPSMAELQSRLHRRAEDSEEVIATRLANSRAEIEHWREYDYIVVNDDLDRA
KGUA_RHOPA      --VVSVFILPPSVQALEHRLHTRAQDSHEVIRGRMKKAGDEMSHFDAYDYIVVNDNIGVA
KGUA_CAUVC      --SVLVYILPPSLAEMSRRLHTRSQDSEEVIHRRLSRAKDEVAAWEQFDYVILNDDFDRA
KGUA_PSESM      --ARSIFILPPSQQALRQRLTNRGQDSDEIIEARMREAVSEMSHYNEYEYVVVNDDFAGA
KGUA_COXBU      --ALSIFILPPSIEALRERLIKRRQDDTAIIEQRLALAREEMAHYKEFDYLVVNDNFDQA
KGUA_NITEU      --AASIFILPPSMEALKQRLEQRGQDENKVIERRLAAARSEISHVNRFDYVVVNHELETA
KGUA_BORPE      --AIGIFVLPPSIDELESRLKARGQDAPQVIARRLLAAGGEIAHAPECEYVIINQEFSVA
KGUA_CHRVO      --AIGIFIAPPSIEELERRLRGRDTDTEEVILRRLASARAEIDKIAEYDYIVVNDDFERA
KGUA_XYLFT      --AISIFILPPSRAALEERLRKRGQDSEEVIHLRLAAAHEEMAHYDEFDYTIINEHFETA
KGUA_NEIMB      --AVGIFILPPSFDVLAARLNGRGTDSREVIQRRLSKARHEIEQSVLFDFVVVNDDLARA
KGUA_GEOSL      --GVYIFILPPSFEELRRRLNGRSSDSDEVISRRINAAAGEIRESRWYDYIIVNDQFSRA
KGUA_CAMJE      --IVSVFITTKNKDELKKRLIKRNTDTIIQLEKRLQNASDEMKELSEYDYLIINDELKQS
KGUA_HELHP      --AKSVFITTKNKDILRERLISRQTDDLQTIEFRLIQAHNEMQHIHNFDYLIINDDITTA
KGUA_HELPJ      --ACSVFISTKNQEILKERLLLRGTDSKETIEKRLINAYKEMQCLESFDYLIINEDLEKS
KGUA_WOLSU      --TTSVFITTPTQQELRERLVLRGTDDKETIDLRVMHAYTEMKHIKEFDFVIVNRDLKES
KGUA_THEMA      --TVFIYVAPPSYADLRERILKRGTEKEADVLVRLENAKWELMFMDEFDYIVVNENLEDA
KGUA_BDEBA      --AKTVFIHPPSIDELRRRIEKRDGKVPADIEVRMANAEKEIREASKFDYQIVNDVFEKS
KGUA_MYCTU      --AVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESA
KGUA_COREF      --AETIFLAPPSWEVLVERLTGRGTESQDVINRRLETAREELAAQSEFKHVIINDDVDTA
KGUA_BIFLO      LEVVYVFIAPPSFEELERRLIGRGTETAEQQARRLETAKVELAAESEFDVTIVNETVDQA
KGUA_STRAW      --ALLVFLAPPSWEELVRRLTGRGTEPPEVIERRLDAAKVELAAEPEFDVTLVNTSVEDV
KGUA_TROWT      --VRTVILLPPAWDDLICRIKRRGSESQDEIDARLATAKKELEAIGEFDYKIVNADVEIA
KGUA_SYNY3      --ARRIFILPPSVEVLEERLRGRGSDSETAIAKRLAQAQQELQAAAEFDYQVVNDDLDQA
KGUA_SYNPX      --ARQIFLAPPSFEELERRIRGRGTDSEDAIQQRLLRAREELSAQGEFDAVVVNDDLDQA
KGUA_THEEB      --ARHIFILPPSLAELEHRLRSRGQDSEEAIARRLAQAETEIAAAPEFDVQIVNDDLEKS
KGUA_GLOVI      --AMLVFIRPPSLEVLAERLRSRGTDAPEAIERRLARAREELALADRFDHQVVNDKLAAA
KGUA_DEIRA      -QAILVFIMPPSLTELRRRLTGRATETPERIEKRLTRARDEIQAAHDFRYVIVNDNLDRA
KGUA_FUSNN      -EANLIFFKTANKEELEKRLRGRNTDSEEVIQARLKNSLKELEYESKYDRVIINNEIEQA
KGUA_RHOBA      -RPVTIFVHPGSMEELERRLRNRGTESESSLTARLETAAAEMQCLSRYQYEIINESVDNA
KGUA_MYCPN      NDVVLIFIKPPSMEELLVRLKKRNDEDAITIQNRLKQAEKECQQIGHFKYVVTNNEFDKT
KGUA_MYCGE      HNVVLIFIKPPSMQELLKRLKKRNDEDETTIKKRLEQAKIEFQQIDNFKYVVTNKEFDKT
KGUA_MYCGA      FRTLSIFVLPPSEDELVARLKKRGTENDEVIKHRLEQAVKEYAHRELYDHTIINDDLEKT
KGUA_MYCPU      FNWITIFVDPPSFEELENRIIKRGTDTKEKIAIRMAKAKEELKDRDLFEFKITNHTPEQA
KGUA_UREPA      DDLISIFLLPPSIDELKKRLLKRNTETLETIKKRIQKATHEITIKDYYQYNIINDNPDHA
KGUA_MYCPE      EDYISIFLIPPSIRELKRRLKIRDTETKEKIKQRIKRAKVELKLQNEYDFIILNDDAKNA
KGUA_ENTFA      PDGVFIFLTPPDLAELKSRIIGRGTDEMSVIEERMAVAREEIEMMALYDYAVVNDEVPLA
KGUA_LACJO      PDGVFIFLTPPDLHELKHRIVNRGTDSDKVIAMRMKQARKEILMMEDYDYAVVNDTVANA
KGUA_STAES      PDALFIFLAPPSLDDLKERLVGRGTESDEKIQSRVNEARKEVEMMNLYDYVVVNDEVELA
KGUA_ONYPE      PNTVFIFLVPPEKKALYDRLKKRGTEQEANIAKRIAKANNEFHLAHKYDYIVVNDEVANA
KGUA_CALS4      PEGVFIFILPPSMEELRNRIKKRGTESEEEIIKRFKSAYEELNYVSKYNYVVINDDVDRA
KGUA_PROMP      PESLSIFLLPPSKEELEKRIRNRGTEKEEAIDRRLSRANYEIASSNQFDFVLTNHDVDET
KGUA_BACTN      -RALSIFVQPPSIEELRCRLTGRGTDEPEVIECRIAKAEYEMTFAPQFDRVIVNDDLEAA
KGUA_PORGI      -RALAIFILPPSIEELRSRLQKRGTDSMETIKQRVDKAEKEIGYAHLFDLRFVNDDLVTC
KGUA_CHLTE      -QALLVFLKPPSMEELARRLQARDSESAEALKSRLERAEMELSHAGEFDFVVVNDDLGRT
KGUA_CHLTR      ---VTIFIQAPSQEELERRLNARDSEKDFQKKERLEHSAVEIAAASEFDYVVVNDDLITA
KGUA_CHLCV      ---VTIFISAPSQEELERRLKYRGSEQDSQRQERLQHSLIEQAASNQFEYVIINDDLQKS
                     : . .     :  *:  *  .       *.     :          . *      

KGUA_BUCBP      VSDLYKIIRVAHLSIKHQIQRNNLLIRNLLNE-------------------
KGUA_ECOLI      LTDLKTIIRAERLRMSRQKQRHDALISKLLAD-------------------
KGUA_BLOFL      LIYLQSVILSKQLKIDYQEYHNSNLINNLLSCL------------------
KGUA_RICPR      LKKIHEIIVAERAKNFAYHEY------------------------------
KGUA_WIGBR      LNKIKTIIISKNKKAINQIDKINETIKKLLKK-------------------
KGUA_RHIME      FSSVRAIVEAERLRRDRRP-GLFEFVNGLLTENPL----------------
KGUA_RHOPA      FESVRSILRAEQLKRERQV-GLDAFVRGMRQQLEG----------------
KGUA_CAUVC      YADLAHIYHAERLKRARNP-WIGDLVSDLLKEEI-----------------
KGUA_PSESM      LEDLKSIFRANRLTQQHQQEQYSELFQELLA--------------------
KGUA_COXBU      VQNLIHIISAERLQRDVQEKKLSRLLAELVEKQ------------------
KGUA_NITEU      ARDVASIVQAERLKTIRQLVRQRSLIAEFS---------------------
KGUA_BORPE      LTELVQIISAARLRFSSQAVRNAQLFSQLGIPAAH----------------
KGUA_CHRVO      RLDLISIVRAQRLRSAPQCRRLADMFRRMGTAGAK----------------
KGUA_XYLFT      VSEMSAIFTASRLRRQTQKIRHANLIQTLLTP-------------------
KGUA_NEIMB      EEDLRHIVNACRLKRSRQLGFIADLLENS----------------------
KGUA_GEOSL      VEELKSVIIAEQCRTARVLDAVSEIFSMD----------------------
KGUA_CAMJE      YEALRAILIAHKFRTKGQNLGQIQNIWNEGE--------------------
KGUA_HELHP      KEAMVAIARSLKYQQI-ERLSKIIQKW------------------------
KGUA_HELPJ      KEIILSIAKTLVHRLKAFNFEKICKAWKNESL-------------------
KGUA_WOLSU      EKLLLSIARAALSKRILYDVESLVARWKSKETPKTPNSQ------------
KGUA_THEMA      VEMVVSIVRSERAKVTRNQDKIERFKMEVKGWKKL----------------
KGUA_BDEBA      YGEFKKIVEDLLA--------------------------------------
KGUA_MYCTU      CAELVSLLVGTAPGSP-----------------------------------
KGUA_COREF      VSAIKAVLLGT----------------------------------------
KGUA_BIFLO      AADLWSVIAKEYGL-------------------------------------
KGUA_STRAW      ARELLALVDVV----------------------------------------
KGUA_TROWT      ANELWLAMNRV----------------------------------------
KGUA_SYNY3      LHRLVKLIGEEE---------------------------------------
KGUA_SYNPX      LLKLEGLMGLG----------------------------------------
KGUA_THEEB      LIALETAIFSPAP--------------------------------------
KGUA_GLOVI      VEAVERLLFEEIPDEPAGG--------------------------------
KGUA_DEIRA      VSELLAVQQAERAAQKAAEHWTPEEQQARALADTVRSTALSREALQQVVES
KGUA_FUSNN      CNDLISIIENGVK--------------------------------------
KGUA_RHOBA      VTEICQILLDQRKTTPCSKN-------------------------------
KGUA_MYCPN      LAELQAILLAEFN--------------------------------------
KGUA_MYCGE      LNELKSILLSEFI--------------------------------------
KGUA_MYCGA      IEDIKQLILKYNQ--------------------------------------
KGUA_MYCPU      AEEIEKIILKKTMG-------------------------------------
KGUA_UREPA      ANQLAEIILNEIKQS------------------------------------
KGUA_MYCPE      ADKLRHILYEKVLEKK-----------------------------------
KGUA_ENTFA      VQRIKDIIASEHFRVDRVIGKYIKMLEEM----------------------
KGUA_LACJO      VDHIKSIVEAEHVRVPRVINDYRNMVKED----------------------
KGUA_STAES      KNRIQSIVEAEHLKRERIEAKYRKMLLEVKK--------------------
KGUA_ONYPE      ADRIIAIIRAEHAKTKRSIRNYLKILEDNGYAEQ-----------------
KGUA_CALS4      VEKIRAIIIAEKCRVDRNKDLYLKIREESV---------------------
KGUA_PROMP      VKEVLKIIKS-----------------------------------------
KGUA_BACTN      KAETLEVIKEFLNKE------------------------------------
KGUA_PORGI      VEQIRKAIAQFIAK-------------------------------------
KGUA_CHLTE      VDAVATRIAEFLPQP------------------------------------
KGUA_CHLTR      YQVLRSIFIAEEHRMSHG---------------------------------
KGUA_CHLCV      YEILKSIFIAEEHRNVL----------------------------------