CLUSTAL format seed alignment for MF_00331

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ISCS_CLOBJ       -------------MNKQVYMDYSATTYTKPEVLEEMLPFFT--ENFGNPSS-LYSFSDKT
ISCS_METTE       MAIHNCEGENVSTENKAVYMDNSATTPVRKEVVEAMLPYMT--ENFGNPSS-IYEIGKTS
ISCS_DICTD       -------------MKREVYLDYAATTPLRKEVYEAMKPFLK--EKFGNPSS-IHHFGRET
ISCS_RUMFL       ------------MEKRFIYADNAATTAVSEEVLSAMLPYFR--TAYGNASS-IYKLGRDA
ISCS2_ARCFU      ----------------MAYFDYTSAKPVDERVLEAMLPYMT--ESFGNPSS-VHSYGFKA
ISCS1_ARCFU      ----------------MPYFDYASTKPVDERVVEAMLPYMT--EHFGNPSS-VHSYGFKA
ISCS_ECO57       -------------MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQA
ISCS_PECCP       -------------MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQA
ISCS_EDWI9       -------------MKLPIYMDYSATTPADPRVAEKMMQYLTLDGTFGNPASRSHRFGWQA
ISCS_PHOLL       -------------MKLPIYLDYSATTPVDPRVAEKMMNYLTRDGIFGNPASRSHRFGWQA
ISCS_PROMH       -------------MKLPIYLDYSATTPVDPRVAEKMMQCLTIDGIFGNPASRSHRFGWQA
ISCS_ERWT9       -------------MKLPIYLDYSATTPADPRVAAKMMQYLTQDGTFGNPASRSHRFGWQA
ISCS_BUCAT       -------------MKTPIYLDYAATTPVEFEVAKKMMNYLTIDGVFGNSASRSHKFGWKA
ISCS_BUCAP       -------------MKNPIYLDYAATTPVEFKVAKKMMNYLTIDGIFGNPASRSHKFGWEA
ISCS_BUCBP       -------------MKFPIYLDYAATTPVEFEVMKEMMNYLTLEGEFGNPASRSHKFGWKA
ISCS_HAEPS       -------------MKLPIYLDYAATTPVDERVAKKMMEYMTKDGVFGNPASRSHKFGWEA
ISCS_HAEDU       -------------MKLPIYLDYAATTPMDERVVQKMMQYMTKDGIFGNPASRSHKFGWEA
ISCS_PASMU       -------------MKLPIYLDYAATCPVDERVAKKMMEYLTVEGNFGNPASRSHKFGWQA
ISCS_HISS2       -------------MKLPIYLDYAATCPVDERVVKKMMEFLSIDGNFGNPASRSHKFGWQA
ISCS_ACTSZ       -------------MKLPIYLDYAATCPVDERVAEKMMNYLTIDGVFGNPASRSHKFGWQA
ISCS_MANSM       -------------MKFPIYLDYAATCPADDRVAEKMMQYLTRDGIFGNPASRSHKFGWQA
ISCS_HAEIE       -------------MKLPIYLDYAATCPVDERVAKKMMAFLTIDGTFGNPASRSHKFGWQA
ISCS_COLP3       -------------MKLPIYFDYSATTPVDKRVAEKMMQYMTNDGHFGNPASRSHKFGWQA
ISCS_PSEHT       -------------MKLPIYLDYAATTPVDERVAKEMMQCLTMDGNFGNPASRSHRFGWQA
ISCS_VIBPA       -------------MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQA
ISCS_VIBTL       -------------MKLPIYFDYSATCPVDPRVAEKMVQCMTMDGNFGNPASRSHRYGWQA
ISCS_VIBVY       -------------MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQA
ISCS_VIBCM       -------------MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQA
ISCS_PHOPR       -------------MKLPIYFDYSATCPVDPRVAEKMMQCLTMDGNFGNPASRSHRFGWQA
ISCS_SHEDO       -------------MKLPIYLDYAATTPVDPRVAEKMMQHMTMDGVFGNPASRSHKYGWQA
ISCS_SHEFN       -------------MKLPIYLDYAATTPVDPRVAEKMMQHMTMDGVFGNPASRSHRYGWQA
ISCS_SHESW       -------------MKLPIYLDYAATTPVDPRVAEKMFQYMTMDGIFGNPASRSHRYGWQA
ISCS_SHEAM       -------------MKLPIYFDYAATTPVDPRVAQKMMQYMTMDGIFGNPASRSHRYGWQA
ISCS_SHEWM       -------------MKLPIYLDYAATTPVDPRVAEKMMQCMTMDGIFGNPASRSHRYGWQA
ISCS_SHEPW       -------------MKLPIYLDYAATTPVDPRVAEKMMQCMTMDGIFGNPASRSHRYGWQA
ISCS_SHELP       -------------MKLPIYLDYAATTPVDPRVAEKMMQYMTMDGIFGNPASRSHRYGWQA
ISCS_AERS4       -------------MKLPIYLDYSATCPVDPRVAEKMMQCLTMDGLFGNPASRSHRFGWQA
ISCS_TOLAT       -------------MKLPIYLDYSATCPVDPRAAEKMMQCLTLDGNFGNPASRSHRFGWQA
ISCS_PSYIN       -------------MKLPIYLDYSSTTPVDPRVAEKMMQYLTPGGEFGNPASRSHRFGWHA
ISCS_RUTMC       -------------MSTPTYMDYSATTPVDERVAQKMMQYLTTDGNFGNPASNSHYYGWKA
ISCS_VESOH       -------------MSIPTYMDYSATTPVDERVAQKMIQFLTKDGNFGNSASNSHYYGWQA
ISCS_PSESM       -------------MKLPIYLDYSATTPVDPRVAQKMIECLTVEGNFGNPASRSHVFGWKA
ISCS_PSEF5       -------------MKLPIYLDYSATTPVDPRVAQKMSECLLVDGNFGNPASRSHVFGWKA
ISCS_PSEU5       -------------MKLPIYLDYSATTPVDPRVAEKMIECLTNEGNFGNPASRSHAFGWKA
ISCS_PSEMY       -------------MKLPIYLDYSATTPVDPRVAQKMSECLLVDGNFGNPASRSHVFGWKA
ISCS_AZOVD       -------------MKLPIYLDYSATTPVDPRVAQKMCECLTMEGNFGNPASRSHVFGWKA
ISCS_PSEA7       -------------MKLPIYLDYSATTPVDPRVAQKMSECLLMDGNFGNPASRSHVFGWKA
ISCS_PSEE4       -------------MKLPIYLDYSATTPVDPRVAQKMAECLLVDGNFGNPASRSHVFGWKA
ISCS_ACIBS       -------------MKRPIYLDYAATTPVDPQVAERMMECLTFDGTFGNAASRSHAYGWQA
ISCS_METFK       -----------MTVRTPIYLDYSATTPIDPRVAEKMIPYLT--EHFGNPASRSHAFGWTA
ISCS_DECAR       -----------MTMKLPIYLDYSATTPVDPRVAEKMIPYLC--EHFGNPASRSHSFGWVA
ISCS_METCA       -------------MKLPVYLDYSATTPVDPRVAEKMIPFLT--ENFGNPASRSHTFGWTA
ISCS_NEIMB       -----------MTVKTPVYLDYAATPPVDKRVAEKMIPYLT--ETFGNPASNSHSFGWEA
ISCS_ANAD2       -------------MKIPIYMDYHATTPVDPRVLEAMLPYFT--TEYGNAASKSHAFGWKA
ISCS_ANADF       -------------MKIPIYMDYHATTPVDRRVLEAMLPYFA--EDFGNAASKSHAFGWRA
ISCS_RICAH       ------MNQQLNNLTLPIYMDYQATTPLDPRVMEAMLPYFTT--KFGNPHSRSHSFGWEA
ISCS_RICCK       ------MNPQLHNIILPIYMDYQATTPLDPRVMEAMLPYFTT--KFGNPHSRSHSFGWEA
ISCS_RICTY       ------MNQQLKNLTLPIYMDYQSTTPIDPRVMEAMLPYFTT--KFGNPHSRSHSFGWEA
ISCS_RICBR       ------MNTQLNNLILPIYMDYQATTPLDPRVMEAMLPYFTT--KFGNPHSHSHSFGWEA
ISCS_EHRCR       ------MEQEKRQINLPVFLDYQSTTKTDDRVLEAMMPYFK---QFSNPHSRSHSFGWKA
ISCS_HELPY       -------------MLQRIYLDNNATTRIDPKVKEIMDPFLR--DHYGNPSS-LHQFGTET
ISCS_HELP2       -------------MLQRIYLDNNATTRIDPKVKEIMDPFLR--DHYGNPSS-LHQFGTET
ISCS_HELPJ       -------------MLQRIYLDNNATTRIDPKVKEIMDPFLR--DHYGNPSS-LHQFGTET
                                   : *  ::     ..   *   :     :.*. *  :  .  :

ISCS_CLOBJ       KKAVNLARERVSKALNA-EKNEIFFTSGGSEADNWALKGIAYANK-KKGN-HIITTKIEH
ISCS_METTE       KHAINLARKKAADALGA-EENEIYFTSGGTESDNWAIKGIAFANR-DKGK-HIITSSIEH
ISCS_DICTD       RTAIEEAREKIAKAIGA-KSDEIIFTSGGTESNNMAIKGVAFALS-TKGK-HIITSKVEH
ISCS_RUMFL       QRDVELAREKVAKALGA-EPREIYFTSCGSESDNWAIKGTAELMA-KKGKKHIVTSVFEH
ISCS2_ARCFU      REAVQEAREKVAKLVNG-GGGTVVFTSGATEANNLAIIGYAMRNA-RKGK-HILVSAVEH
ISCS1_ARCFU      REVIEEARGKISELING-GGGDIVFTSGATESNNLALIGYAMRNA-RKGK-HVLVSSIEH
ISCS_ECO57       EEAVDIARNQIADLVGA-DPREIVFTSGATESDNLAIKGAANFYQ-KKGK-HIITSKTEH
ISCS_PECCP       EEAVDIARNQIAELVGA-DPREIVFTSGATEADNLAIKGVANFYQ-KKGK-HIITSKTEH
ISCS_EDWI9       EEAVDVARNNIAELVGS-DPREIVFTSGATEADNLAIKGAANFYQ-KKGK-HIITCKTEH
ISCS_PHOLL       EEAVDIARNQIADLVGA-DPREIVFTSGATESDNLAIKGAANFYQ-KKGK-HIITSKTEH
ISCS_PROMH       EEAIDIARNQIADLIGA-DPREIVFTSGATEADNLALKGVANFYQ-KKGK-HIITSKTEH
ISCS_ERWT9       EEAVDVARNQIAELVGA-DPREIVFTSGATEANNLAIKGAASFYR-EKGR-HIVTCATEH
ISCS_BUCAT       EEVVDIARNQISELIGA-DSREIVFTSGATESNNLAIKGIASFHQ-NKGK-HIVTSKTEH
ISCS_BUCAP       EEVIDIARNEISELIGS-DSREIVFTSGATEANNLAIKGIAFFHR-KKGN-HIITSKTEH
ISCS_BUCBP       EEAVDIARNQIAELIHA-DSREIIFTSGATESNNLAIKGIAEFYK-KKGN-HIITCSTEH
ISCS_HAEPS       EEAVDVARNQIADLIGA-DAREIVFTSGATESDNLAIKGAAHFYQ-TKGK-HIITVKTEH
ISCS_HAEDU       EEAVDIARNHIADLIGA-DSREIVFTSGATESDNLAIKGAAHFYQ-TKGK-HIITLKTEH
ISCS_PASMU       EEAVDVARNYIADLIGA-DSREIVFTSGATESDNLAIKGAAHFYQ-SKGK-HIITCKTEH
ISCS_HISS2       EEAVDVARNHIADLIGA-DSREIVFTSGATEADNLALKGVMRFYQ-TKGK-HLITCKTEH
ISCS_ACTSZ       EEAVDIARNQIADLIGA-DSREIVFTSGATESDNLAIKGAAHFYQ-TKGK-HIITCKTEH
ISCS_MANSM       EEAVDIARNHIADLIGA-DSREIVFTSGATESDNLAIKGAAHFYQ-TKGK-HIITCKTEH
ISCS_HAEIE       EEAVDIARNQIADLIGA-DSREIVFTSGATESDNLAIKGAAHFYQ-TKGK-HILTCKTEH
ISCS_COLP3       EEAVDIARNQIAELINA-DPREIVFTSGATESNNLAIKGAANFYN-KKGK-HIITCKTEH
ISCS_PSEHT       EEVVDQARTDVADLINA-DPREIVFTSGATESNNLAIKGAAQFYK-KKGK-HIITAKTEH
ISCS_VIBPA       EEAVDTAREQIADLLNA-DPREIVFTSGATESDNLAIKGAAHFYS-KKGK-HVITCKTEH
ISCS_VIBTL       EESVDNAREQIADLLNA-DPREIVFTSGATESDNLAIKGAAHFYE-KKGK-HVITCKTEH
ISCS_VIBVY       EEAVDTAREQIAELLNA-DPREIVFTSGATESDNLAIKGAAHFYS-KQGK-HVITSKTEH
ISCS_VIBCM       EEAVDTAREQIAALLNA-DPREIVFTSGATESDNLAIKGVAHFYN-KQGK-HIITSKTEH
ISCS_PHOPR       EEAVDTAREQVADLMNA-DPREIVFTSGATESDNLAIKGAARFYS-KKGK-HIITCKTEH
ISCS_SHEDO       EEAVDIARNQVADLINA-DHREIVFTSGATESINLAIKGIAHFYH-KKGK-HIITSKTEH
ISCS_SHEFN       EEAVDVARNQVADLINA-DHREIVFTSGATESSNLAIKGIAHFYH-KKGK-HIITSKTEH
ISCS_SHESW       EEAVDIARNQVADLINA-DHREIVFTSGATESNNLAIKGVAHFYN-KKGK-HIITSKTEH
ISCS_SHEAM       EEAVDVARSQVADLINA-DHREIVFTSGATESNNLAIKGVAHFYQ-KKGK-HIITSKTEH
ISCS_SHEWM       EEAVDIARNQVADLINA-DPREIVFTSGATESDNLAIKGVAHFYQ-KKGK-HIITSKTEH
ISCS_SHEPW       EEAVDIARNQIAELINA-DPREIVFTSGATESDNLAIKGVAHFYQ-KKGK-HIITSKTEH
ISCS_SHELP       EEAVDIARNQVAELINA-DPREIVFTSGATESDNLAIKGVAHFYH-KKGK-HIITSKTEH
ISCS_AERS4       EEAVDLARNQVAELLGA-DPREIVFTSGATESNNLAIKGVAHFYA-GKGK-HIITSKTEH
ISCS_TOLAT       EEAVDEARNHVADLIGA-DPREIVFTSGATESNNLAIKGAAHFYV-KQGK-HIITCKTEH
ISCS_PSYIN       EEAVDVAREQIADLISG-DPREIVFTSGATESNNLAIKGAAHFYV-KKGK-HIITAKTEH
ISCS_RUTMC       DEAVKKARHQVADLVGA-DSKEIVWTSGATESDNLAIKGIAHFYH-KKGN-HIITLKTEH
ISCS_VESOH       DEAVKKARQQVANLIDA-DPKEIVWTSGATESNNLAIKGVAHFYH-KKGK-HIITLKTEH
ISCS_PSESM       EEAVENARRQVADLVSA-DPREIVWTSGATESNNLAIKGVAHFYA-SKGK-HLITSKVEH
ISCS_PSEF5       EESVENARRQVADLVNA-DPREIVWTSGATESDNLAIKGVAHFYH-TKGK-HLITSKIEH
ISCS_PSEU5       EEAVENARRQVAELVNA-DPREIVWTSGATESDNLAIKGVAHFYA-SKGK-HIVTTKIEH
ISCS_PSEMY       EEAVENARRQVAELVNA-DPREIVWTSGATESDNLAIKGVAHFYA-SKGK-HIITSKIEH
ISCS_AZOVD       EEAVENARRQVAELVNA-DPREIVWTSGATESDNLAIKGVAHFYA-SKGK-HIITSKIEH
ISCS_PSEA7       EEAVENARRQVAELVNA-DPREIVWTSGATESDNLAIKGVAHFYS-GKGK-HIITSKIEH
ISCS_PSEE4       EEAVENGRRQVAELINA-DPREIVWTSGATESDNLALKGVAHFYQ-TKGK-HIITSKIEH
ISCS_ACIBS       EEKVEYAREQVANLIKA-DPREIVWTSGATESDNLALKGVAQFYA-SKGK-HIITSKIEH
ISCS_METFK       EKAVENAREEVARLVNA-DPREIVWTSGATESNNLAIKGAANFYSPSKGK-HIVTVQTEH
ISCS_DECAR       DAAVEEAREQVAALVNA-DPKEIVWTSGATESNNLAIKGAANFYASTKGK-HIITVKTEH
ISCS_METCA       EQAVENAREEVAKLVNA-DPREIVWTSGATESDNLAIKGAAEFYQ-TKGR-HLITVKTEH
ISCS_NEIMB       EEAVEKARADIAALINA-DSKEIVFTSGATESNNLAIKGAAHFYK-SKGN-HLITVKTEH
ISCS_ANAD2       EEAVEAAREEVAKLIGA-SAKEIVWTSGATESDNLAVKGAAHFYQ-AKGK-HLVTCKTEH
ISCS_ANADF       EEAVEAAREEVARLVGA-SAKEIVWTSGATESDNLAVKGAAQFYQ-SKGK-HLVTCKTEH
ISCS_RICAH       ERAVEEARSRVARLIGA-DTKEIIFTSGATESNNLAIKGVAKFYG-NKKN-HIITVVSEH
ISCS_RICCK       ENAVEEARSRVAKLIGA-DAKEIIFTSGATESNNLAIKGIAKFYG-NKKN-HIITVVSEH
ISCS_RICTY       ENAVENARSMIAKLIGA-DSKEIIFTSGATESNNLVIKGIAKFYG-NKKN-HIITLVSEH
ISCS_RICBR       ENAVEEARGDIAKLIGA-EAKEIIFTSGATESNNLAIKGIAKFYG-NKKN-HIITVVSEH
ISCS_EHRCR       ESAVELARERVASLINA-EAKEVIFTSGATESNNLAIKGVANFYK-NKGN-HIITVRTEH
ISCS_HELPY       HPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGVYFDECLKKGKNHIVTTVAEH
ISCS_HELP2       HPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGVYFDECLKKGKNHIVTTVAEH
ISCS_HELPJ       HPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGVYFDECLKKGKNHIITTVAEH
                    :  .       : .     :  ** .:*: * .: *        : . *::.   **

ISCS_CLOBJ       HAILHTAQFLEKEGFKVTYLPVD-EEGFVSVEDIKNAITDETILVSVMFANNEIGTIEPI
ISCS_METTE       HAVLHTCAWLEGQGFEVTYLPVD-KYGMVSPDELRNAIRDDTILISIMFANNEIGTIQPI
ISCS_DICTD       HAVLEPCHFLEKLGFEITYLPVD-REGFVDPDDLKKALRKDTILISIMHANNEIGTIEPI
ISCS_RUMFL       HAVLHTCEYLEKHGYEVTYVPVN-DKGLIDPEDVRKAVREDTALVTIMYANNEIGTIQPI
ISCS2_ARCFU      MSVINPAKFLQKQGFEVEYIPVG-KYGEVDVSFIDQKLRDDTILVSVQHANNEIGTIQPV
ISCS1_ARCFU      MSVINPAKYLQKQGFEVEFIPVD-KYGTVDLEFIEEKIREDTILVSVQHANNEIGTIQPI
ISCS_ECO57       KAVLDTCRQLEREGFEVTYLAPQ-RNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDI
ISCS_PECCP       KAVLDTCRQLEREGFEVTYLAPQ-RNGIIDLAELEAAMREDTILVSIMHVNNEIGVVQDI
ISCS_EDWI9       KAVLDTCRQLEREGFEVTYMTPQ-PNGLIDLNALEAVMRDDTILVSIMHVNNEIGIIQDI
ISCS_PHOLL       KAVLDTCRQLEREGFEVTYLAPQ-SNGLIDLNDLEAAVRDDTILISIMHVNNEIGVVQDI
ISCS_PROMH       KAILDTCRQLEREGFEVTYLAPK-SDGLIDLKELEAAMRDDTILVSIMHVNNEIGVVQDI
ISCS_ERWT9       KAVLDTCAQLEHEGFSVTYLTPQ-SDGSLTLRQVESALRDDTVLVTIMHVNNEIGVVQDI
ISCS_BUCAT       KSVLDTCRYLENKGFTVTYLTPK-NNGIIDLNNLKKNIKKDTILVSIMHVNNEIGIIQDI
ISCS_BUCAP       KSVLDACRYLESVGFSVTYLTPK-NNGIIDLNDLKKNINKNTILVSIMHVNNETGIIQDI
ISCS_BUCBP       KATLDTCRYLENKGFDITYLNPL-QNGTINIYELQEKIQKNTILVSIMHVNNEIGVIQDI
ISCS_HAEPS       KAVLDTCRQLEREGFEVTYLEPE-TTGLVDIAKLEAAIRPDTILVSVMQVNNEIGVIQPI
ISCS_HAEDU       KAVLDTCRQLEREGFEVTYLEPE-SDGLLDLTKLVEAIRPDTILISIMHVNNEIGVVQDI
ISCS_PASMU       KAVLDTCRQLEREGFEVTYLNPK-SDGLIDLEELKNAMRDDTILVSIMHVNNEIGVIQDI
ISCS_HISS2       KAILDTCRQLEREGFEVTYLDPK-SDGLIDLEELKSVIRDDTVLVSIMHANNEIGVVQDI
ISCS_ACTSZ       KAVLDTCRQLEREGFEVTYLSPK-CDGLIDLDEFKAAIRPDTILASIMHVNNEIGVIQDI
ISCS_MANSM       KAVLDTCRQLEREGFEVTYLAPK-SDGLVDLDEFRAAIRPDTILASIMHVNNEIGVIQDI
ISCS_HAEIE       KAVLDTCRQLEREGFEVTYLSPE-ADGLIDLEKFKAALRPDTILASIMHANNEIGVLQDI
ISCS_COLP3       KAVLDTCRELERQGFEVTYLDPE-ENGLIDLNKLNDAMRDDTILVSIMQVNNEIGVIQDI
ISCS_PSEHT       KAVIDTCRELERQGFEVTYMDVE-ENGLLDLQKLADTMRDDTVLVSIMHVNNELGVIQDI
ISCS_VIBPA       KAVLDPCRQLEREGFEVTYLEPE-SNGLIDLEKLKAAMRDDTVLVSIMHVNNEIGVIQDI
ISCS_VIBTL       KAVLDPCRQLEREGFEVTYLEPE-ANGIIDLDKLQAAMREDTVLVSIMHVNNEIGVIQDI
ISCS_VIBVY       KAVLDTCRQLEREGFEVTYLEPE-SNGLISLSKLEAAMRDDTVLVSIMHVNNEIGVIQDI
ISCS_VIBCM       KAVLDTMRQLEREGFEVTYLDPE-SNGLIDLAKLEAAMRDDTILVSIMHVNNEIGVVQDI
ISCS_PHOPR       KAVLDPCRQLEREGFEVTYLDPE-ANGLIDMAKLRDAIREDTVLMSIMHVNNEIGVIQDI
ISCS_SHEDO       KAVLDTCRQLEREGYEVTYLEPE-ANGLIPLARIEDAMRDDTLLVSIMHVNNEIGVIQDV
ISCS_SHEFN       KATLDTCRQLEREGYEVTYLVPD-ANGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDI
ISCS_SHESW       KAVLDTCRQLEREGFEVTYLEPA-SNGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDI
ISCS_SHEAM       KAVLDTCRQLEREGFEVTYLEPG-VNGIIPMERLEAAMRDDTILLSLMHVNNEIGVVHDI
ISCS_SHEWM       KAVLDTCRQLEREGFEVTYLAPE-ANGLIPLATIESAMREDTVLVSIMHVNNEIGVIHDI
ISCS_SHEPW       KAVLDTCRQLEREGYEVTYLQPE-ANGLIPVAMIEAAMREDTLLVSIMQVNNEIGVIQDI
ISCS_SHELP       KAVLDTCRQLEREGFEVTYLEPE-SNGIIPIEKLEAAMREDTILLSLMHVNNEIGVIHDI
ISCS_AERS4       KAVLDTCRQLEREGYEVTYLEPM-PNGLFTLEQIEGALRDDTILVSIMHVNNEIGVVQNI
ISCS_TOLAT       KAVLDTCRHLESEGYEVTYLDPQ-SDGLLTLPQIEAAMRPDTILVSIMHVNNEIGVIQDL
ISCS_PSYIN       KAVLDTCRQLEREGYEVTYLDPK-EDGIVTPQQLKEVLRPDTVLVSLMHVNNEIGVIQDI
ISCS_RUTMC       KAVLDTCRQLERENYEATYLDPM-PNGLLDLNVLKKAIREDTILVSIMHVNNEIGVIQDI
ISCS_VESOH       KSVLDTCRQLEREGFEVTYLDPM-SNGLLDLNILRDAMREDTILVSIMHVNNEIGVIQDI
ISCS_PSESM       KAVLDTTRQLEREGFEVTYIEPG-EDGLITPSMIEAALRDDTILVSIMHVNNEIGTINDI
ISCS_PSEF5       KAVLDTMRQLEREGFEVTYIEPG-EDGLITPAMVEAALRDDTILVSIMHVNNEIGTINDI
ISCS_PSEU5       KAVLDTTRQLEREGFEVTYIEPG-DDGIVTPAMVEAALREDTILVSVMHVNNEIGTINDI
ISCS_PSEMY       KAVLDTTRQLEREGFEVTYLEPG-EDGLITPAMVEAALRDDTTLVSVMHVNNEIGTINDI
ISCS_AZOVD       KAVLDTTRQLEREGFEVTYLEPG-EDGLITPAMVAAALREDTILVSVMHVNNEIGTVNDI
ISCS_PSEA7       KAVLDTCRQLEREGFEVTYLEPG-EDGLITPAMVEAALRDDTILVSVMHVNNEIGTINDI
ISCS_PSEE4       KAVLDTARQLEREGFEVTYLEPG-EDGIVTPAMVEAALRDDTILVSLMHVNNEVGSINDI
ISCS_ACIBS       KAVLDPCRELEEQGFEITYLEPEPQTGLITPEMVKAALRPDTILVSLMMVNNEIGTVTDV
ISCS_METFK       KAVIDTVRELERLGYEATYLIPE-PNGLIDLDKFKAALRPDTVLASVMLVNNEIGVIQDI
ISCS_DECAR       KAILDTVREMERQGFEATYLDVK-EDGLLDLEVFKAAIRPDTVLASVMFVNNEVGVIQPI
ISCS_METCA       KAVLDTMRELESSGFEVTYLEPM-ANGLLDLDAFRAAIRPDTVLASVMQVNNEIGVIQDI
ISCS_NEIMB       KAVLDTMRELERQGYEVTYLDVQ-ENGLVDLDVLKAAIREDTILVSVMWVNNEIGVVQDI
ISCS_ANAD2       KAVLDSMHALERQGFEVTFLEPE-RDGRLDPAKVQAALRPDTILVSVMHANNETGVVHPI
ISCS_ANADF       KAVLDSMHALERQGFEVTFLDVE-KDGRLDPARLRAALREDTILVSIMHANNETGVVHPI
ISCS_RICAH       KCVLDACRYLEQEGINITYLPVK-PNGIIALETLKNAITDQTMLVSVMAVNNEIGVVQPL
ISCS_RICCK       KCVLDACRHLEQEGIKITYLPIN-PNGIIDLEILKESITNQTMLVSVMAVNNEIGVIQPL
ISCS_RICTY       KCVLNACRYLEQEGIKITYLPIK-PNGIIDLEILKNAITDQTLLVSVMAVNNEIGVIQPL
ISCS_RICBR       KCVLDACRHLEQEGVKVTYLPIK-PNGIIDLEVLKNAITDQTMLVSVMAVNNEIGVIQPL
ISCS_EHRCR       KCVLDSCRYLETEGFHVTYLDVQ-KNGILDLELLKSSITDKTILVSVMMVNNEIGVIQPI
ISCS_HELPY       PAVRSTCNFLESLGVEVTYLPIN-EHGSITAEQVKEAITEKTALVSVMWANNETGLIFPI
ISCS_HELP2       PAVRSTCNFLESLGVEVTYLPIN-EHGSITAEQVKEAITEKTALVSVMWANNETGLIFPI
ISCS_HELPJ       PAVRSTCNFLESLGVEVTYLPIN-EHGSITADQVKEAITEKTALVSVMWANNETGLIFPI
                  .   .   ::  .    ::      * .    .   :  .* * ::  .*** * :  :

ISCS_CLOBJ       KEIGELCKEKNIYFHTDAVQAIGHVDIDVKDMNIDLLSMSAHKFYGPKGVGALYIKNG--
ISCS_METTE       KEIGEIAKENQIYFHTDAVQAIGHVPIDVKKLNIDLLSLSGHEFEGPKGCGALYIRKG--
ISCS_DICTD       QELSKIAKEYDIYFHTDAVQTVGHIPVNVDELGVDLLSISAHKFYGPKGVGALYIRKG--
ISCS_RUMFL       EEIAAVCREKGVLFHTDAVQAVGHVDIDVHKQGIDMLSLSGHKIHAQKGIGAIYIRKG--
ISCS2_ARCFU      EEISEVLAGK-AALHIDATASVGQIEVDVEKIGADMLTISSNDIYGPKGVGALWIRKE--
ISCS1_ARCFU      KEISEIINGR-AALHVDATASLGQIEVDVEKIGADMLTISSNDIYGPKGVGALWVRQG--
ISCS_ECO57       AAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRK-P
ISCS_PECCP       ETIGEMCRSRGIVFHVDATQSVGKLPIDLNQLKVDLMSFSGHKIYGPKGIGALYVRRK-P
ISCS_EDWI9       ETIGEMCHARGIIFHVDATQSVGKLPIDLSKLKVDLMSFSGHKIYGPKGIGALYVRRK-P
ISCS_PHOLL       AAIGEMCRSRGIVFHVDATQSVGKLPIDLTKLKVDLMSFSAHKIYGPMGIGALYVRRK-P
ISCS_PROMH       AAIGELCRSKGIIYHVDATQSVGKLPIDLSKLKVDLLSLSAHKVYGPMGIGALYVRRK-P
ISCS_ERWT9       ASIGELCRARGIIFHVDATQSVGKLPVDLGQLPVDLMSFSAHKIYGPKGIGALYVCRR-P
ISCS_BUCAT       NSISQICRNHGVFFHVDATQSVGKIPIDLKKIPIDLMSFSAHKIYGPKGIGGLYVRRK-P
ISCS_BUCAP       TNISKICRSHDIFFHVDATQSVGKIAINLKNLFVDLMSFSAHKIYGPKGIGGLYVRRK-P
ISCS_BUCBP       HKISKICQSNNILFHVDAAQSIGKININLKQLKIDLMSFSAHKIYGPKGIGGLYIRRK-P
ISCS_HAEPS       EEIGKICRAKKIIFHVDATQSVGKIPVDVQALNVDLMSFSSHKLYGPKGIGGLYVCRK-P
ISCS_HAEDU       KAIGEICRARKIIFHVDATQSVGKLAVNVQELKVDLMSFSSHKLYGPKGIGGLYVCRK-P
ISCS_PASMU       AAIGELCRARKILFHVDATQSVGKLPINLAELKVDLMSMSSHKLYGPKGIGALYVSRK-P
ISCS_HISS2       AKIGEICRERKVLFHTDATQSVGKLPINLSELKVDLLSMSSHKLYGPKGIGALYVCRK-P
ISCS_ACTSZ       RAIGEICRAHKIIFHVDATQSVGKIAINLAELSVDLLSMSGHKLYGPKGVGALYVRRK-P
ISCS_MANSM       EAIGKICREHKVIFHVDATQSVGKLPINLAELPVDLMSMSGHKLYGPKGIGALYVRRK-P
ISCS_HAEIE       KAIGELCRANKTIFHVDATQSVGKVEINLEELAVDLMSMSSHKLYGPKGVGALYVRRK-P
ISCS_COLP3       SEIGEMCRARKIVFHVDAAQSAGKINIDMQALKVDLMSISAHKMYGPKGIGALYVSRK-P
ISCS_PSEHT       ATIGEMCRERKIMFHVDAAQSAGKVLIDVQQLKVDFMSFSGHKVYGPKGVGALYVRRK-P
ISCS_VIBPA       AAIGELCRERKIVFHVDAAQSAGKLPIDVQEMKVDLISLSAHKVYGPKGIGALYVRRK-P
ISCS_VIBTL       GAIGELCRARKIIFHVDAAQSAGKIPLDVKEMKVDLISMSAHKAYGPKGIGALYVRRK-P
ISCS_VIBVY       EAIGELCRSRKIIFHVDAAQSAGKVAIDVQKLKVDLISLSAHKIYGPKGIGALYVRRK-P
ISCS_VIBCM       AAIGELCRSRKVVFHVDAAQSAGKVAIDVQEMKVDLISLSAHKAYGPKGIGALYVRRK-P
ISCS_PHOPR       TAIGELCRENKIVFHVDAAQSIGKLPIDVQAMKVDLISVTSHKIYGPKGIGALYVRRK-P
ISCS_SHEDO       MAIGELCRSKGIIFHMDAAQSAGKLPIDVQQLKVDLISISGHKMYGPKGVGALYVRRK-P
ISCS_SHEFN       NAIGELCRSKGIFFHMDAAQSAGKIPIDVQTTKVDLISISGHKMYGPKGIGALYVRRK-P
ISCS_SHESW       DAIGELCRSKGIIFHMDAAQSAGKLPIDVQATKVDLISISGHKMYGPKGIGALYVRRK-P
ISCS_SHEAM       DAIGELCRSKGIIFHVDAAQSAGKLPIDVQITKVDLMSISGHKMYGPKGIGALYVRRK-P
ISCS_SHEWM       NAIGELCRSKKIIFHVDAAQSAGKLPLDVQETKVDLLSISAHKMYGPKGIGALYVRRK-P
ISCS_SHEPW       DAIGELCRSRKIVFHVDAAQSAGKMPIDVQKTKVDLMSISAHKMYGPKGIGALYVSRK-P
ISCS_SHELP       DAIGELCRAKKVIFHVDAAQSAGKLPIDLQKSKVDLMSISAHKMYGPKGIGALYVRRK-P
ISCS_AERS4       AAIGELCRSRKILLHVDAVQSVGKIPVDVEALKVDLLSVSAHKVYGPKGIGALFVRRK-P
ISCS_TOLAT       AAIGELCRARKILFHVDAAQSAGKVEIDVDAMKIDLLSLSAHKVYGPKGIGALYVRRK-P
ISCS_PSYIN       AGFGELCRANKTIFHVDASQSVGKIEIDTQALKVDLMSFSAHKIYGPKGIGALYVSRK-P
ISCS_RUTMC       EAIGNLCRENKIFFHVDAAQSAGKVTIDLSKLPVDLMSFSAHKIYGPKGMGALYVRRK-P
ISCS_VESOH       ESIGNLCHQNNIFFHVDAAQSAGKVAISLSELSVDLMSFSAHKIYGPKGMGALYVRRK-P
ISCS_PSESM       AAIGELTRSRGVLFHVDGAQSTGKVEIDLASLKVDLMSFSAHKTYGPKGIGALYVSRK-P
ISCS_PSEF5       AAIGELTRSKGVLFHVDGAQSTGKVDIDLQALKVDLMSFSAHKTYGPKGIGALYVSRK-P
ISCS_PSEU5       TAIGELTRARGILFHVDAAQSTGKVEIDLEKIKVDLMSFSAHKTYGPKGVGALYVRRK-P
ISCS_PSEMY       AAIGELTRSRGVLLHVDAAQSTGKVEIDLEKMKVDLMSFSAHKTYGPKGVGALYVRRK-P
ISCS_AZOVD       AAIGELTRSRGVLYHVDAAQSTGKVAIDLERMKVDLMSFSAHKTYGPKGIGALYVRRK-P
ISCS_PSEA7       AAIGELTRSRGVLFHVDAAQSTGKVEIDLDKLKVDLMSFSAHKTYGPKGIGALYVRRK-P
ISCS_PSEE4       AAIGELTRSRGVLFHVDAAQSAGKVEIDVQKLKVDLMSFSAHKVYGPKGIGALYVSRK-P
ISCS_ACIBS       AVIGELTRANKTFFHVDAAQAAGKVDIDLSTMKIDLMSFSAHKIYGPKGIGALYVRRS-P
ISCS_METFK       EAIGNICREQGVIFHVDAAQATGKVHIDLQKLPVDLMSFSAHKTYGPKGIGALYVRRK-P
ISCS_DECAR       AELGEICREKGIIFHVDAAQATGKVDIDLSKLKVDLMSFCAHKTYGPKGIGALYVRRK-P
ISCS_METCA       AAIGGICREHGVIFHVDAAQATGKVEIDLEQLPVDLMSFSAHKTYGPKGIGALYVRRK-P
ISCS_NEIMB       PAIGEICRERKIIFHVDAAQACGKVPVDVEAAKVDLLSMSGHKVYGPKGIGALYVRRK-P
ISCS_ANAD2       AEIGRIARGAGVVFHCDAVQSIGKIPFDVEAMNVDLASISAHKMYGPKGMGALYVRRK-P
ISCS_ANADF       EEIGRITRAAGVLFHCDAVQSAGKLPFDVEDANVDLASLSAHKMYGPKGVGALYVRRK-P
ISCS_RICAH       KEIGKICRARGVFFHSDIAQGFGKIPIDVNEFNIDLASISGHKIYGPKGIGGLYVRKK-P
ISCS_RICCK       KEIGKICRERGVFLHSDIAQGFGKIPINVNEFNIDLASISGHKIYGPKGVGALYVRKK-P
ISCS_RICTY       REIGKICRERSVFFHSDIAQGFGKIPINVNEYNIDLASISGHKIYGPKGIGALYIRKK-P
ISCS_RICBR       KEIGKICREKGVFFHSDSAQGFGKVPIDVNECNIDLASISGHKIYGPKGIGALYVRKK-P
ISCS_EHRCR       EKIGKICHEHGIFFHTDAAQAFGKISIDVKKMNIDLLSISGHKIYAPMGIGALYIRKRQP
ISCS_HELPY       EEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANADFLSFSAHKFHGPKGIGGLYIRSG--
ISCS_HELP2       EEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANADFLSFSAHKFHGPKGIGGLYIRSG--
ISCS_HELPJ       EEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANVDFLSFSAHKFHGPKGIGGLYIRSG--
                   :. :        * *     *:: ..      *: :. .:.  .  * *.:::     

ISCS_CLOBJ       -VKIQNLIHGGGQERGKRASTEDTAGIVGLGKAIELAMENMPEENEKLSNLRGRLIRGIE
ISCS_METTE       -VKIDPLLHGGAQERKRRAGTENVPGIVGLGKATELATAEIEESNRTLLKLRDRLIEGL-
ISCS_DICTD       -TKIHPLIHGGSQENNKRAGTENVAGIIGMGKAIELAILEMDKEIERLTELRDYFIREVE
ISCS_RUMFL       -IVLPNLVHGGGQERGKRAGTENVPAIVGLGVAIEAAVRNTAEKAAIIIPRRNRIIDEL-
ISCS2_ARCFU      -AKLQPVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNV-
ISCS1_ARCFU      -VRLQPIILGGGQEKGLRSGSENVPAIVGFGKAAEITAKEWGEEAGRLRRLRDRIIDNV-
ISCS_ECO57       RVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIK
ISCS_PECCP       RIRLEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMTAEMDRLRTLRDRLWNGIN
ISCS_EDWI9       RVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMSTEVLRLRVLRDRLWNGLK
ISCS_PHOLL       RIRIEAQQHGGGHERGMRSGTLPVHQIVGMGEAYRIAKQEMESESQRLRGLRLRLWQGIK
ISCS_PROMH       RIRLEAQMHGGGHERGMRSGTLAVHQIVGMGEAYRILKEEMADETKRLNELRLRLWNGIK
ISCS_ERWT9       HIRLEAQIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKETMADDMTRIGALRRRLWQGIN
ISCS_BUCAT       RVRLLSLIHGGGHERGMRSGTLPVHQIVGMGESFVLAKRKIHDDFIHLTKLKNILWNGIK
ISCS_BUCAP       RVRLSALSHGGGHERGMRAGTLPVHQIVGMGESFKLARKKINDDFIHLTNLRNDLWNGIK
ISCS_BUCBP       RVRLSAQIHGGGHEKGMRSGTLPVHQIVGMGIAYKIAKIKINSDFNYIKHLRNRLWNGIK
ISCS_HAEPS       RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMVTEMPRIKALRDRLYNGFK
ISCS_HAEDU       RIRIEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMPRLKALRDRLYHGFQ
ISCS_PASMU       RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRICKEEMASEMPRLKALRDRLYNGLK
ISCS_HISS2       RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMPRLTALRDRLYNGLK
ISCS_ACTSZ       RIRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRICKEEMATEMPRLKALRDRLYNGLK
ISCS_MANSM       RVRLEAIIHGGGHERGMRSGTLAVHQIVGMGEAYRICKEEMAEEMAHVTKLRDRLYNGLK
ISCS_HAEIE       RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMASEMPRLKALRDRLYNGLK
ISCS_COLP3       RIRLEAQTHGGGHERGMRSGTLATHQIVGMGEACRLAKEEMAQDQAHVTAMRDRLWAGLN
ISCS_PSEHT       RARLEAQMHGGGHERGMRSGTLATHQLVGMGTAFRVAKQDFEKDHAHISALRKRLIDGIM
ISCS_VIBPA       RIRLEAQMHGGGHERGFRSGTLATHQIVGMGEAFRIAKEEMQKDYDHALALRNRLLNGVK
ISCS_VIBTL       RIRLEAQMHGGGHERGFRSGTLATHQIVGMGEAFAIAKQDMQKDYDHALALRERLLKGVQ
ISCS_VIBVY       RIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKLDMEKDYQHALALRNRLLDGVK
ISCS_VIBCM       RIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELQQDYDHALKLRNRLLDGIK
ISCS_PHOPR       RIRLEAQMHGGGHERGMRSGTLATHQIVGMGEAFRIAKEEMEQDRVHTLALRTRLLDGLK
ISCS_SHEDO       RIRLESQMHGGGHERGMRSGTLATHQLVGLGEAAAIAKQDMESDNARIRTLRDKLWNGVK
ISCS_SHEFN       RIRLESQMHGGGHERGMRSGTLATHQIVGLGEAAAVAKQDMAADSARITHLRDKLWNGIK
ISCS_SHESW       RIRLEAQMHGGGHERGMRSGTLPTHQIVGLGEAAAIAKAEMATDNERIGRLRDKLWNGIK
ISCS_SHEAM       RIRLESQMHGGGHERGMRSGTLATHQIVGLGEAAAIAKADMESDNARIHALRDRLWNGIK
ISCS_SHEWM       RIRLEAAMHGGGHERGMRSGTLATHQIVGMGEAAAIAKADMEADNARIAGLRDRLWNGVK
ISCS_SHEPW       RIRLEAAMHGGGHERGMRSGTLATHQIVGFGEAAAIAKTDMDSDNERIRRLRDKLWNGIN
ISCS_SHELP       RIRLEATMHGGGHERGMRSGTLATHQIVGMGEAAAIAKADMESDNARIRRLRDRLWDGIK
ISCS_AERS4       RVRLEAQMHGGGHERGMRSGTLPTHQIVGMGEAFRIAKEEMASEGQHIMALRQRLWDGIK
ISCS_TOLAT       RVRLEAQMHGGGHERGMRSGTLPTHQIVGMGEAFRIAKAEMAEENVRIKALRDRLYDGLK
ISCS_PSYIN       RVRLEAQMHGGGHERGMRSGTLPTHQIAAMGEAFRIAKEEMASDEVRILALRTRLLNGVN
ISCS_RUTMC       RVRIEAQMHGGGHERGMRSGTLATHQIVGMGEAFAIAQAEMKEENSKIRQLRDRLLAGFV
ISCS_VESOH       RVRIEAQMHGGGHERGMRSGTLATHQIVGMGEAFAIAQAEMREENTKIRQLRDRLLVGFI
ISCS_PSESM       RVRLEAAMHGGGHERGMRSGTLATHQIVGMGEAFRIAKEEMAAESVRIKALSDRFYKQVE
ISCS_PSEF5       RVRLEATMHGGGHERGMRSGTLATHQIVGMGEAFHVAKEDMAAENLRIKALSDRFYKQVE
ISCS_PSEU5       RVRLEAQMHGGGHERGMRSGTLATHQLVGMGEAFRIAKQEMAQENERIRALRDRFYKQVE
ISCS_PSEMY       RVRLEAQTHGGGHERGMRSGTLATHQCVGMGEAFRIAKEDMAAENQRITALRDRFYRQLE
ISCS_AZOVD       RVRLEAQMHGGGHERGMRSGTLATHQIVGMGEAFRIAREEMAAESRRIAGLSHRFHEQVS
ISCS_PSEA7       RVRIEGQMHGGGHERGMRSGTLATHQIVGMGEAFRIAREEMAQESAHVLALRDRFFAQID
ISCS_PSEE4       RVRLEAIIHGGGHERGMRSGTLPTHQIVGMGEAFAIAKQEMAAENVRIKALSDRFFKQVS
ISCS_ACIBS       RVRLKAQIHGGGHERGMRSGTLATHQIVGMGEAFELAGKTMHAEQERIRKLRDKLWNGLQ
ISCS_METFK       RVRIEAQMHGGGHERGMRSGTLATHQIVGMGEAFRIAREEMDSENVRIRQLRDRLLKGLQ
ISCS_DECAR       RIRLEAQMHGGGHERGFRSGTLPTHQIVGMGECFRLAKEEMAEENKRVGALRDKLLKGLQ
ISCS_METCA       RIRLKAQMHGGGHERGLRSGTLATHQIVGMGEAFRIAREEMAAENERIRRLRDRLLAGLA
ISCS_NEIMB       RVRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELAQDTAHYLKLRDIFLKGIE
ISCS_ANAD2       RVRLVAEMDGGGHERGFRSGTLNVPGIVGMGKAAELARLERDAEAVRVTALRERLRKGLE
ISCS_ANADF       RVRLIAQMDGGGHERGFRSGTLNVPGIVGFGKAAELARLEGAAEAERVLALRERLRKGLD
ISCS_RICAH       RVRVTPLINGGGQERGMRSGTLPTPLIVGLGVAAEIAYSEMEKDTKHVNYLFDRFLNNIH
ISCS_RICCK       RIRVTPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYNEMEKDNKHVSYLFDRFLNNIK
ISCS_RICTY       RVRVTPLINGGGQERGMRSGTLPTPLIVGFGIAAEISYNEMEKDAQHVNYLFDRFLNNIY
ISCS_RICBR       RVRITPLINGGGQERGMRSGTLPTPLIVGLGTAANIAYNEMEKDTKHVNHLFDKFLDAIN
ISCS_EHRCR       RVRLTPMINGGGQERGMRSGTVPTPLAVGLGEAARIAQEVMEEENIRIRELRDILYNEIK
ISCS_HELPY       -VGLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALL
ISCS_HELP2       -VGLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALL
ISCS_HELPJ       -VGLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALL
                    :     ** : .  *:.:  .    .:* .          .          :   . 

ISCS_CLOBJ       ARIPEVKLNGPKDMSRRLPNNVNFSFIGIEGETLLLDLDMNGIFGSTGSACASASLDPSH
ISCS_METTE       LKIPKTHLNGHP--TQRLANNVNVTFEYIEGESLLLLLNAKGIYASTGSACNSSSLEPSH
ISCS_DICTD       KRISDVYLNGPR--SNRLPNNINFSFAYVEGESILLHLDLEGVEVSTGSACSSSSLEPSH
ISCS_RUMFL       LKIPYTRLNGDR--EKRLPGNINISFEGIEGESLLLMLDLNGICASSGSACTSGSLDPSH
ISCS2_ARCFU      LKIEESYLNGHP--EKRLPNNVNVRFSYIEGESIVLSLDMAGIQASTGSACSSKTLQPSH
ISCS1_ARCFU      LKIEESYLNGHP--EKRLPNNVNVRFSYIEGESIVLSLDMAGIQASTGSACSSKTLQPSH
ISCS_ECO57       D-IEEVYLNGDLE--HGAPNILNVSFNYVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_PECCP       D-IEEVYLNGDIE--QGAPNILNVSFNYVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_EDWI9       D-IEEVYLNGALE--QGAPNILNVSFNFVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_PHOLL       D-IEEVFLNGDLE--HGAPHILNVSFNYVEGES--LMMSLKDLAVSSGSACTSASLEPSY
ISCS_PROMH       D-IEEVYINGSLE--HTAPNILNVSFNYVEGES--LMMALKDLAVSSGSACTSASLEPSY
ISCS_ERWT9       R-IEAVSVNGSLE--HGAANILNVCFHYVDGES--LVMALKDLAVSTGSACTSASMEPSY
ISCS_BUCAT       N-IEEVYLNSDLQ--QGAPHILNVSFNYVEGES--LIMALKDLAISSGSACTSASLEPSY
ISCS_BUCAP       N-IEEVYLNSDLK--QGAPHILNVSFNYIEGES--LIMALKDLAISSGSACTSSSLEPSY
ISCS_BUCBP       N-IEEIHLNSNFE--NTVPHILNVSFNYVEGES--LIMALKNLAVSSGSACTSSSLEASY
ISCS_HAEPS       D-MEEVYVNGTMEAGKRVDSNLNISFNFVEGES--MMMSLKDIAVSSGSACTSASLEPSY
ISCS_HAEDU       A-IEEVYVNGSMEEGKRVDTNLNMSFNFVEGES--LMMALRDIAVSSGSACTSASLEPSY
ISCS_PASMU       D-IEETYVNGSME--HRLDSNLNISFNYVEGES--LMMALRDIAVSSGSACTSASLEPSY
ISCS_HISS2       D-IEETYVNGSME--QRLGNNLNISFNYVEGES--LMMALRDIAVSSGSACTSASLEPSY
ISCS_ACTSZ       D-IEETYVNGSME--HRVDSNLNISFNYVEGES--LMMALRDIAVSSGSACTSASLEPSY
ISCS_MANSM       D-IEETYVNGSME--HRVGSNLNISFNFVEGES--LMMALRDIAVSSGSACTSASLEPSY
ISCS_HAEIE       D-IEETYVNGSME--HRLDSNLNISFNYVEGES--LMMALRDIAVSSGSACTSASLEPSY
ISCS_COLP3       S-MEQVFINGDAD--KRYPGNLNVSFNFVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_PSEHT       SDMEEVYFNGTQD--QSVPGIVNISFNFVEGES--LLMAVKDIAVSSGSACTSASLEPSY
ISCS_VIBPA       D-LEAVTVNGDLE--QRVPQNLNISFAFVEGES--LLMSLKDLAVSSGSACTSASLEPSY
ISCS_VIBTL       D-LEAVTVNGDLD--QRVPHNLNVSFAFVEGES--LLMSLKDLAVSSGSACTSASLEPSY
ISCS_VIBVY       D-MEAVTINGDLD--QRVPHNLNISFAFVEGES--LLMSLKDLAVSSGSACTSASLEPSY
ISCS_VIBCM       D-MEAVTINGDLD--QRVPHNLNVSFAFVEGES--LLMALKDLAVSSGSACTSASLEPSY
ISCS_PHOPR       D-MESVHINGDLE--QRVSSNLNISFAFVEGES--LLMALKDLAVSSGSACTSASLEPSY
ISCS_SHEDO       H-IEETYINGDME--QRFCGSLNVSFNFVEGES--LMMALKDLAVSSGSACTSASLEPSY
ISCS_SHEFN       H-IEETYINGDME--QRYSGIFNVSFNFVEGES--LMMALKDLAVSSGSACTSASLEPSY
ISCS_SHESW       H-IEETYINGDLT--QRFCGSLNVSFNYVEGES--LMMALKDLAVSSGSACTSASLEPSY
ISCS_SHEAM       D-IEETYVNGDFE--QRYCGNLNVSFNFVEGES--LMMALKDLAVSSGSACTSASLEPSY
ISCS_SHEWM       G-IEETYINGDVE--QRYCGSLNVSFNFVEGES--LMMALKDLAVSSGSACTSASLEPSY
ISCS_SHEPW       H-IEETYINGDME--QRHCGSLNVSFNFVEGES--LMMALKDLAVSSGSACTSASLEPSY
ISCS_SHELP       H-IEETYINGDAE--QRYCGSLNVSFNFVEGES--LMMALKDLAVSSGSACTSASLEPSY
ISCS_AERS4       D-IEAVYINGDLE--QRVPGNLNVSFAYVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_TOLAT       D-IEQVFVNGSTE--HRVAGNLNISFAYVEGES--LMMALKDLAVSSGSACTSASLEPSY
ISCS_PSYIN       D-MEEVYVNGSLE--NRIAGNINISFNYVEGES--LVMALKDLAVSSGSACTSASLEPSY
ISCS_RUTMC       N-MEEVVINGDMK--NRIPGNLNISFNYVEGES--LMMAVNDIAVSSGSACTSSSLEPSY
ISCS_VESOH       D-MEEVVVNGDME--SRIPGNLNISFNYVEGES--LMMAINDIAVSSGSACTSLSLEPSY
ISCS_PSESM       N-LEELYVNGSLT--ARVPHNLNLSFNYVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_PSEF5       H-LEELYINGSMT--ARVPHNLNLSFNYVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_PSEU5       H-LEELYVNGSMT--ARVPHNLNLSFNYVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_PSEMY       G-MEELYVNGSLT--ARVPHNLNLSFNYVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_AZOVD       T-LEEVYLNGSAT--ARVPHNLNLSFNYVEGES--LIMSLRDLAVSSGSACTSASLEPSY
ISCS_PSEA7       G-LEELYINGSMT--SRVPHNLNVSFNYVEGES--LIMALKDLAVSSGSACTSASLEPSY
ISCS_PSEE4       D-LEELYVNGSQT--ARVPHNLNLSFNYVEGES--LLMSLKDIAVSSGSACTSASLEPSY
ISCS_ACIBS       D-LEQVFLNGHPT--QNVANYLNVSFNFVEGES--LMMSLKDAAVSSGSACTSATLEPSY
ISCS_METFK       E-IEEVYVNGDLE--HRVAHNLNISFNFVEGES--LIMAVKDIAVSSGSACTSASLEPSY
ISCS_DECAR       D-IEATFVNGDLT--QRVAHNLNISFAYVEGES--MIMAIKDLAVSSGSACTSASLEPSY
ISCS_METCA       D-MEEVFINGDLE--QRVPHNLNISFNYVEGES--LMMAIKDLAVSSGSACTSASLEPSY
ISCS_NEIMB       G-IEEVYINGDLE--HRVPNNLNVSFNFVEGES--LIMAVKELAVSSGSACTSASLEPSY
ISCS_ANAD2       KELDLLTVNGSLE--HRVPGNLNVSFAYVEGEA--LMMAVKDVAVSSGSACTSASLEPSY
ISCS_ANADF       AGLDLLTVNGSLA--HRVPGNLNVSFAYVEGEA--LMMAIKDVAVSSGSACTSASLEPSY
ISCS_RICAH       SRISEVYLNGAKD--PRYKGNLNLSFAGVEGES--IILAIKDLAVSSGSACTSASLEPSY
ISCS_RICCK       QKISEVYLNGDKD--QRYKGNLNLSFAGVEGES--IILAIKDLAVSSGSACTSASLEPSY
ISCS_RICTY       SRIPEVYLNGDKD--QRYKGNLNLSFAGVEGES--IILAIKDLAVSSGSACTSASLEPSY
ISCS_RICBR       SQISEVYLNGDKD--QRYKGNLNLSFAGVEGES--IILAIKDLAVSSGSACTSASLEPSY
ISCS_EHRCR       KHLPYVVLNGDYE--QRIAGNLNLSFPYVEGES--IIMAINNLAVSSGSACTSASLEPSY
ISCS_HELPY       K-IPDVMVVGDRI--HRVPNTTLVSVRGIEGEAMLWDLNRSNIAASTGSACASEDLEANP
ISCS_HELP2       K-IPDVMVVGDRI--HRVPNTTLVSVRGIEGEAMLWDLNRSNIAASTGSACASEDLEANP
ISCS_HELPJ       K-IPDVMVVGDRV--HRVPNTTLISVRGIEGEAMLWDLNRSNIAASTGSACASEDLEANP
                   :    . .             . .  ::**:    :       *:**** *  ::.. 

ISCS_CLOBJ       VLLSIGLPHETAHGSLRLSLGAKNTEEDIDYVLEVLPKIIKQRREMSPLWEDYMKNKEEK
ISCS_METTE       VLTACGVPHEIIHGSLRLSLGRMNTSEDVDRVLEVVPEIVQKLRNMSPLTPKEYRTL---
ISCS_DICTD       VLSAINVPIELAHGSIRFTLGLYTTKEDLNYTLDVLERIIEKLRTISPYKQEWKINKKS-
ISCS_RUMFL       VLLSIGLKHAVAHGSLRLSIEEDVSDEDVEYIIETIPKVVQRLRSMSPVWERMMKGEKYD
ISCS2_ARCFU      VLMACGLKHEEAHGTLLLTLGRYNTDEDVDRLLEVLPGVIERLRSMSPLYRR--------
ISCS1_ARCFU      VLMACGLKHEEAHGTLLLTLGRYNTDEDVDRLLEVLPGVIERLRSMSPLYRR--------
ISCS_ECO57       VLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLN
ISCS_PECCP       VLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMFKQGVDIS
ISCS_EDWI9       VLRALGLNDELAHSSIRFSLGRFTTEEEVDYAIDLVRKSIGRLRELSPLWEMHKQGVDIS
ISCS_PHOLL       VLRALGMNDELAHSSIRFSLGRFTTEEEIDYAIELIHKSIGRLRELSPLWEMFRQGVDLN
ISCS_PROMH       VLRALGLTDELAHSSIRFSLGRFTTEEEIDYAIEQIHSAIGRLRDLSPLWEMHKQGVDIN
ISCS_ERWT9       VLRAIGLSDELAHSSIRFSLGRLTSEEEIDYAIQLLQKSITRLREHSPAWRAFKAGSE--
ISCS_BUCAT       VLKSLGIRDELAHSSIRFSIGRFTTEKEIIHAIKLVHKSIHRLRELSPLWEMFKSGVDLN
ISCS_BUCAP       VLRALGIKDELAHSSIRFSIGRFTTKEEIQHTVKSVHKSIHRLRALSPLWEMFKSGVDLN
ISCS_BUCBP       VLRSLGLKDELAHSSIRFSLGRFTTKEEIDYTIQLIHQSINRLRNLSPLWEMFKSGVDMN
ISCS_HAEPS       VLRALGLNDELAHSSIRFSIGRWTTEEEIDHTIEIVKKAVTKLRELSPLWDMFKEGIDLN
ISCS_HAEDU       VLRAIGRNDELAHSSIRFSLGRWATEEEIDYTIELVKKSILKLRELSPLWEMFKEGIDLS
ISCS_PASMU       VLRALGLNDELAHSSIRFTLGRYTTEEEIDYTIELVKNAVAKLRELSPLWDMFKEGIDLN
ISCS_HISS2       VLRALGLNDELAHSSIRFTVGRYTTEEEIDYSIGLVKSAVKKLRDLSPLWDMFKEGIDLN
ISCS_ACTSZ       VLRALGLNDELAHSSIRFTVGRYTTEEEIDYTIELVKSAVKKLRELSPLWDMFKEGVDMS
ISCS_MANSM       VLRALGLNDELAHSSIRFSLGRYTTEEEIDYTIDLVKSAVKKLRDLSPLWDMFKEGIDMS
ISCS_HAEIE       VLRALGLNDELAHSSIRFTLGRYTTEEEIDYTINLMKGAVEKLRALSPLWDMFKEGIDLN
ISCS_COLP3       VLRALGLNDEMAHSSIRFSFGRFTTTEEIDYAIELIKGAIGHLRDMSPLWEMFKDGIDLD
ISCS_PSEHT       VLRALGRNDELAHSSIRFSIGRFTTEEEIDYTVELMKNSIGRLREMSPLWEMHQEGIDLD
ISCS_VIBPA       VLRALGMDDELAHSSVRFSFGRFTTEEEIDYAIEQIRVAVTKLRDMSPLWDMYKEGVDLS
ISCS_VIBTL       VLRALGLNDELAHSSVRFSFGRFTTEEEIDYAIAQIRVAVNKLRDMSPLWDMYKEGIDLN
ISCS_VIBVY       VLRALGLNDELAHSSIRFSFGRFTTEEEIDYAIEQIRVAVAKLRDMSPLWDMYKEGIDLN
ISCS_VIBCM       VLRALGLNDELAHSSIRFSFGRFTTEAEIDYAIELIRVAVDKLRAMSPLWDMYKDGVDLN
ISCS_PHOPR       VLRALGLDDELAHSSIRFSFGRFSTEEEIDYAITQIRTAVEKLRDMSPLWDMHKEGIDLN
ISCS_SHEDO       VLRALGLNDEMAHSSIRFSIGRFTTDEDIDHAIKVITQSIDKLREMSPLWEMFKDGIDLD
ISCS_SHEFN       VLRALGLNDEMAHSSIRFSIGRFTTDEEIDHAIKTITESIDKLREMSPLWEMFKDGIDLE
ISCS_SHESW       VLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIETITQSIDKLREMSPLWEMFKDGIDLN
ISCS_SHEAM       VLRALGLSDEMAHSSIRFSIGRFTTEEEVDYAIGIIQGSIGKLREMSPLWEMFKDGVDLS
ISCS_SHEWM       VLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIETINKSIDSLRDMSPLWEMFKDGVDLE
ISCS_SHEPW       VLRALGLNDEMAHSSIRFSIGRFTTDEEIEHAIETITESIGNLREMSPLWEMFKDGIDLD
ISCS_SHELP       VLRALGLDDEMAHSSIRFSIGRFTTEEEIDHAIETITKSIGQLREMSPLWEMFKDGVDLS
ISCS_AERS4       VLRALGLNDELAHSSIRFSLGRFTTEEEIDYAIKLIRDSIGRLREMSPLWEMYKDGVDLN
ISCS_TOLAT       VLRALGLNDELAHSSIRFSIGRFTTAEEIDYAIGLIRDSIGKLRDLSPLWDMYKEGIDLS
ISCS_PSYIN       VLRAIGRDDELAHSSIRFSIGRFTTEEEIDYAINIIRKNIGRLRDMSPLWDMYKEGIDIK
ISCS_RUTMC       VLRALGLSDELAHSSIRFTIGRYTTEAQVDKAINLVRTKVDKLRDLSPLWDMFKDGIDIS
ISCS_VESOH       VLRALGLNDELAHSSIRFTIGRYTTEAQIDKAIDLVRAKVDKLRDLSPLWDMFKDGVDIS
ISCS_PSESM       VLRALGRNDELAHSSIRFTFGRFSTEEEIDYAAQKVCEAVTRLRALSPLWDMFKDGVDIS
ISCS_PSEF5       VLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAQKVCEAVTKLRALSPLWDMYKDGVDIS
ISCS_PSEU5       VLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAQKVCEAVTKLRELSPLWDMFKDGVDIS
ISCS_PSEMY       VLRALGRNDELAHSSIRFTFGRFTTEEEVDYAAAKVREAVDKLRELSPLWDMFKEGVDLS
ISCS_AZOVD       VLRALGRNDELAHSSIRFTFGRFTTEEEVDYAARKVCEAVGKLRELSPLWDMYKDGVDLS
ISCS_PSEA7       VLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAQKVVEAVSKLRELSPLWDMYKEGVDLS
ISCS_PSEE4       VLRALGRNDELAHSSIRFSFGRFTTEEEVDYAAQEVCKAVNKLRELSPLWDMYKDGVDIS
ISCS_ACIBS       VLRALGLSDELAHSSIRFSFGKYTTEEDIDHVLTITKAAVEKLRELSPLWDMYKEGIDLS
ISCS_METFK       VLRALGRSDELAHSSIRFSIGRFTTEEEIDYTIQLMKSKIGKLRELSPLWEMHLEGVDLN
ISCS_DECAR       VLRALGRDDELAHSSIRFSIGRFTTEEEIDYAIKLLHQKVGKLRELSPLWEMYKDGIDLS
ISCS_METCA       VLRALGRSDELAHSSIRFTLGRYTTAEDVDFAISLIKDKVARLREISPLWEMYKDGIDLN
ISCS_NEIMB       VLRALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLN
ISCS_ANAD2       VLRAMGVSEDLAHSSIRFGLGRFSTEEEVDYTIRLFGEKVRKLREMSPLYEMVKDGVDLN
ISCS_ANADF       VLRAMGISEDLAHSSIRFGLGRFTTEEEVDHVVRLVVEKVRKLREMSPLYEMVKEGVDLS
ISCS_RICAH       VLRSMGIGEELAHTSIRFGIGRFTTEQEIDYAVNLICSKIDKLRKLSPLWEMMQEGIDLK
ISCS_RICCK       VLRSMGIGEELAHTSIRFGIGKFTTEQEIDYAVDLICSKIDKLRELSPLWEMMQQGIDLK
ISCS_RICTY       VLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLICSKIDKLRKLSPLWEMMQEGIDLK
ISCS_RICBR       VLRSMGVDEELAHTSIRFGIGRFTTEQEIDYAVKLICSKINKLRDLSPLWEMMQEGIDLK
ISCS_EHRCR       VLRALNIEKDLEHSSIRFGIGRFTTREEILYAAELIVSSIKKLREMSPLWEMVQEGVDLN
ISCS_HELPY       VMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAAVRLRNISSSY----------
ISCS_HELP2       VMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAAIRLRNISSSY----------
ISCS_HELPJ       VMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAAVRLRNISSSY----------
                 *: : .      * :: : .    :  ::              *  *.            

ISCS_CLOBJ       --------
ISCS_METTE       --------
ISCS_DICTD       --------
ISCS_RUMFL       --------
ISCS2_ARCFU      --------
ISCS1_ARCFU      --------
ISCS_ECO57       SIEWAHH-
ISCS_PECCP       SIEWAHH-
ISCS_EDWI9       TIEWSAH-
ISCS_PHOLL       SIEWSHH-
ISCS_PROMH       SIEWSHH-
ISCS_ERWT9       --------
ISCS_BUCAT       SIEWDHV-
ISCS_BUCAP       SIEWDHT-
ISCS_BUCBP       NVNWTHN-
ISCS_HAEPS       SIEWSHH-
ISCS_HAEDU       KIEWNHH-
ISCS_PASMU       TIEWTHH-
ISCS_HISS2       SIEWTHH-
ISCS_ACTSZ       KIEWSAH-
ISCS_MANSM       KIEWSAH-
ISCS_HAEIE       TIEWSAH-
ISCS_COLP3       SIEWAAH-
ISCS_PSEHT       SVEWAHH-
ISCS_VIBPA       TVEWAHH-
ISCS_VIBTL       TVEWAHH-
ISCS_VIBVY       TVEWAHH-
ISCS_VIBCM       TVEWAHH-
ISCS_PHOPR       SVEWAHH-
ISCS_SHEDO       QVQWAHH-
ISCS_SHEFN       QVQWAHH-
ISCS_SHESW       QVQWAHH-
ISCS_SHEAM       KVEWVHH-
ISCS_SHEWM       QVQWAHH-
ISCS_SHEPW       SVQWAHH-
ISCS_SHELP       TVQWAHH-
ISCS_AERS4       TVEWAHH-
ISCS_TOLAT       KVEWVSH-
ISCS_PSYIN       SIEWSH--
ISCS_RUTMC       KVEWTAH-
ISCS_VESOH       KVEWSAH-
ISCS_PSESM       KIEWAAH-
ISCS_PSEF5       KIEWAAH-
ISCS_PSEU5       KVEWQAH-
ISCS_PSEMY       SVEWAAH-
ISCS_AZOVD       KIEWQAH-
ISCS_PSEA7       QVEWQAH-
ISCS_PSEE4       KIEWAAH-
ISCS_ACIBS       TVEWAEH-
ISCS_METFK       AVAWATH-
ISCS_DECAR       TVQWAAH-
ISCS_METCA       TVQWAAAH
ISCS_NEIMB       SIEWAAH-
ISCS_ANAD2       QIEWANPH
ISCS_ANADF       QIEWANPH
ISCS_RICAH       KIKWAVH-
ISCS_RICCK       KIKWASH-
ISCS_RICTY       KIKWTAH-
ISCS_RICBR       KIKWATH-
ISCS_EHRCR       NIKWDAH-
ISCS_HELPY       --------
ISCS_HELP2       --------
ISCS_HELPJ       --------