CLUSTAL format seed alignment for MF_00332

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DNAK_MYCH7       ---------------------------MAKEIILGIDLGTTNSVVAIIEN-QKPVVLENP
DNAK_MYCHJ       ---------------------------MAKEIILGIDLGTTNSVVAIIEN-QKPVVLENP
DNAK_MYCPU       ---------------------------MAKEIILGIDLGTTNSVVSIIEN-KKPVVLENF
DNAK_MYCMO       ---------------------------MAKEKIIGIDLGTTNSVVAILED-KTPRVLENP
DNAK_MYCS5       ---------------------------MAKEIVLGIDLGTTNSVVSIVEG-KNPTVLENP
DNAK_MYCHO       ---------------------------MAKEFILGIDLGTTNSVVSVIEN-GTPKILENP
DNAK_UREPA       ---------------------------MAKEIILGIDLGTTNSCVAVIEN-KKPIVLENP
DNAK_MYCGE       -------------------------MSADNGLIIGIDLGTTNSCVSVMEG-GRPVVLENP
DNAK_MYCPN       -------------------------MSTDNGLIIGIDLGTTNSCVSVMEN-GRPVVLENP
DNAK_MYCGA       -------------------------MSNNNGLIIGIDLGTTNSCVSVMEG-AQKVVIENP
DNAK_MYCPE       MRVLKYMLLYILYLKSIVKILRRLNNMAGSNIIIGIDLGTTNSCVAVMEN-GKSKILETP
DNAK_MESFL       ---------------------------MAKERIIGIDLGTTNSVVSIMEG-GQPIILENP
DNAK_MYCMS       ---------------------------MAKEKIIGIDLGTTNSVVSVIEG-GQPIILENP
DNAK_BACAN       -----------------------------MSKIIGIDLGTTNSCVAVMEG-GEPKVIPNP
DNAK_BACCZ       -----------------------------MSKIIGIDLGTTNSCVAVMEG-GEPKVIPNP
DNAK_BACHK       -----------------------------MSKIIGIDLGTTNSCVAVMEG-GEPKVIPNP
DNAK_BACCR       -----------------------------MSKIIGIDLGTTNSCVAVMEG-GEPKVIPNP
DNAK_BACC1       -----------------------------MSKIIGIDLGTTNSCVAVMEG-GEPKVIPNP
DNAK_BACSU       -----------------------------MSKVIGIDLGTTNSCVAVLEG-GEPKVIANA
DNAK_BACLD       -----------------------------MSKVIGIDLGTTNSCVAVLEG-GEPKVIPNP
DNAK_GEOKA       -----------------------------MSKIIGIDLGTTNSCVAVLEG-GEVKVIPNP
DNAK_OCEIH       -----------------------------MSKIIGIDLGTTNSCVSVMEG-GEAVVIPNP
DNAK_BACHD       -----------------------------MSKIIGIDLGTTNSCVAVMEG-GEATVIPNP
DNAK_BACSK       -----------------------------MSKIIGIDLGTTNSCVAVMEG-GEATVIPNP
DNAK_STRA3       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRA5       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRA1       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRP1       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRP6       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRP8       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRPM       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRP3       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRMU       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRPN       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRR6       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIANP
DNAK_STRT1       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TEPKIIANP
DNAK_STRT2       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TEPKIIANP
DNAK_LACLA       -----------------------------MSKIIGIDLGTTNSAVAVLEG-TESKIIPNP
DNAK_ENTFA       -----------------------------MSKIIGIDLGTTNSAVAVLEG-GEAKIIANP
DNAK_LISMF       -----------------------------MSKIIGIDLGTTNSAVAVLEG-GEAKIIPNP
DNAK_LISMO       -----------------------------MSKIIGIDLGTTNSAVAVLEG-GEAKIIPNP
DNAK_LISIN       -----------------------------MSKIIGIDLGTTNSAVAVLEG-GEAKIIPNP
DNAK_STAAC       -----------------------------MSKIIGIDLGTTNSCVTVLEG-DEPKVIQNP
DNAK_STAAM       -----------------------------MSKIIGIDLGTTNSCVTVLEG-DEPKVIQNP
DNAK_STAAN       -----------------------------MSKIIGIDLGTTNSCVTVLEG-DEPKVIQNP
DNAK_STAAR       -----------------------------MSKIIGIDLGTTNSCVTVLEG-DEPKVIQNP
DNAK_STAAS       -----------------------------MSKIIGIDLGTTNSCVTVLEG-DEPKVIQNP
DNAK_STAAW       -----------------------------MSKIIGIDLGTTNSCVTVLEG-DEPKVIQNP
DNAK_STAES       -----------------------------MGKVIGIDLGTTNSCVSILEG-DEPKVIQNP
DNAK_STAEQ       -----------------------------MGKVIGIDLGTTNSCVSILEG-DEPKVIQNP
DNAK_STAHJ       -----------------------------MSKVIGIDLGTTNSCVAVLEG-DEPKVIQNP
DNAK_STAS1       -----------------------------MSKVIGIDLGTTNSCIAILEG-DEPKVIQNP
DNAK_LACAC       -----------------------------MSKVIGIDLGTTNSAVAVLEG-KEPKIITNP
DNAK_LACJO       -----------------------------MSKVIGIDLGTTNSAVAVLEG-KEPKIITNP
DNAK_LACSK       -----------------------------MSKVIGIDLGTTNSAVAVLEG-GQPKIITNP
DNAK_LACSS       -----------------------------MSKVIGIDLGTTNSAVAVLEG-GQPKIITNP
DNAK_LACPL       ---------------------------MASNKIIGIDLGTTNSAVAVLEG-NEPKIITTP
DNAK_ONYPE       --------------------------MTKTNKIIGIDLGTTNSCVAVMEG-GEAKVIPNA
DNAK_TROWT       -----------------------------MSRAVGIDLGTTNSVVAVLEG-GEPNVIANA
DNAK_TROW8       -----------------------------MSRAVGIDLGTTNSVVAVLEG-GEPNVIANA
DNAK_LEIXX       -----------------------------MSRAVGIDLGTTNSVVSVLEG-GEPTVIANA
DNAK_BIFLO       -----------------------------MARAVGIDLGTTNSCIATLEG-GEPTVIVNA
DNAK_COREF       -----------------------------MGRAVGIDLGTTNSVVSVLEG-GEPVVIANS
DNAK_CORGL       -----------------------------MGRAVGIDLGTTNSVVSVLEG-GEPVVIANA
DNAK_CORDI       -----------------------------MGRAVGIDLGTTNSVVSVLEG-GEPQVIANS
DNAK_CORJK       -----------------------------MGRAVGIDLGTTNSVVSVLEG-GEAKVIANS
DNAK_MYCLE       -----------------------------MARAVGIDLGTTNSVVSVLEG-GDPVVVANS
DNAK_MYCPA       -----------------------------MARAVGIDLGTTNSVVAVLEG-GDPVVVANS
DNAK_MYCTU       -----------------------------MARAVGIDLGTTNSVVSVLEG-GDPVVVANS
DNAK_MYCBO       -----------------------------MARAVGIDLGTTNSVVSVLEG-GDPVVVANS
DNAK_NOCFA       -----------------------------MARAVGIDLGTTNSVVAVLEG-GEPVVVANS
DNAK1_STRAW      -----------------------------MARAVGIDLGTTNSVVSVLEG-GEPTVITNA
DNAK_STRCO       -----------------------------MARAVGIDLGTTNSVVSVLEG-GEPTVITNA
DNAK_THEFY       -----------------------------MARAVGIDLGTTNSVVAVLEG-GEPTVIANA
DNAK_CUTAK       -----------------------------MARSVGIDLGTTNSCVAVLEG-GEPTVIPNA
DNAK_HALMA       ---------------------------MASNKILGIDLGTTNSAFAVMEG-GDPEIIVNG
DNAK_NATPD       ---------------------------MASNKILGIDLGTTNSAFAVMEG-GDPEIIVNS
DNAK_HALSA       ---------------------------MASEKILGVDLGTTNSAFAVMEG-SDPEIITNE
DNAK_AGRFC       -----------------------------MAKVIGIDLGTTNSCVAVMDG-KDTKVIENA
DNAK_RHIME       -----------------------------MAKVIGIDLGTTNSCVSVMDG-KDAKVIENA
DNAK_RHILO       -----------------------------MAKVIGIDLGTTNSCIAIMDG-KEPKVIENA
DNAK_BRUME       -----------------------------MAKVIGIDMGTTNSCVAVMDG-KNAKVIENA
DNAK_BRUAB       -----------------------------MAKVIGIDLGTTNSCVAVMDG-KNAKVIENA
DNAK_BRUSU       -----------------------------MAKVIGIDLGTTNSCVAVMDG-KNAKVIENA
DNAK_BARHE       -----------------------------MAKVIGIDLGTTNSCVAVMDG-KNAKVIENS
DNAK_BARQU       -----------------------------MAKVIGIDLGTTNSCVAVMDG-KNAKVIENS
DNAK_BRADU       -----------------------------MGKVIGIDLGTTNSCVAVMDG-KNAKVIENS
DNAK_NITWN       -----------------------------MGKVIGIDLGTTNSCVAVMDG-KTPKVIENA
DNAK_RHOPA       -----------------------------MGKVIGIDLGTTNSCVAVMDG-KSAKVIENA
DNAK_CAUVC       -----------------------------MSKIIGIDLGTTNSCVAIMDG-KTPKVIENA
DNAK_ZYMMO       -----------------------------MGKVIGIDLGTTNSCVAVMEG-GQPKVIENA
DNAK_RHOS4       -----------------------------MAKVIGIDLGTTNSCVAIMDG-AQPRVIENS
DNAK_RUEPO       -----------------------------MGKVIGIDLGTTNSCVAIMDG-AQPKVIENS
DNAK_RICFE       -----------------------------MGKVIGIDLGTTNSCVAVMEG-KEPKVIDNA
DNAK_RICTY       -----------------------------MGKVIGIDLGTTNSCVAVMEG-KEPKVIDNA
DNAK_RICPR       -----------------------------MGKVIGIDLGTTNSCVAVMEG-KEPKVIDNA
DNAK_RICCN       -----------------------------MGKVIGIDLGTTNSCVAVMEG-KEPKVIENA
DNAK_PELUB       -----------------------------MSKIIGIDLGTTNSCVSIMEG-SQPKVLENA
DNAK_EHRRG       ----------------------MILCRGLFMAVIGIDLGTTNSCVAVMEG-GDAKAIENS
DNAK_EHRRW       ----------------------MILCRGLFMAVIGIDLGTTNSCVAVMEG-GDAKAIENS
DNAK_EHRCJ       ------------------------------MAVIGIDLGTTNSCVAVMEG-GDAKAIENS
DNAK_ANAMM       -----------------------MGVIMAAERIIGIDLGTTNSCVAVMEA-GTAKVIENS
DNAK_WOLPM       -----------------------------MGRAIGIDLGTTNSCVAIMQG-KDTKVIENK
DNAK_WOLTR       -----------------------------MGRAIGIDLGTTNSCVAIQG-----KIIENK
DNAK_BORBR       -----------------------------MSKIIGIDLGTTNSCVAVLDG-GQVKIIENA
DNAK_BORPE       -----------------------------MSKIIGIDLGTTNSCVAVLDG-GQVKIIENA
DNAK_BORPA       -----------------------------MSKIIGIDLGTTNSCVAVLDG-GQVKIIENA
DNAK_BURPS       -----------------------------MGKIIGIDLGTTNSCVAIMEG-NQVKVIENS
DNAK_BURMA       -----------------------------MGKIIGIDLGTTNSCVAIMEG-NQVKVIENS
DNAK_BURP1       -----------------------------MGKIIGIDLGTTNSCVAIMEG-NQVKVIENS
DNAK_BURL3       -----------------------------MGKIIGIDLGTTNSCVAIMEG-NQVKVIENS
DNAK_RALSO       -----------------------------MGKIIGIDLGTTNSCVSIMEG-NTPKVIENA
DNAK_CUPPJ       -----------------------------MGKIIGIDLGTTNSCVSILEG-NTPKVIENS
DNAK_AROAE       -----------------------------MGKIIGIDLGTTNSCVAVMEG-GKPKVIENS
DNAK_THIDA       -----------------------------MGRIIGIDLGTTNSCVAVMEN-GSPKVIENA
DNAK_DECAR       -----------------------------MGKIIGIDLGTTNSCVAIMEG-GQPKVIENA
DNAK_NITEU       -----------------------------MAKIIGIDLGTTNSCVAVMEG-NKPKVIENA
DNAK_NEIMA       -----------------------------MAKVIGIDLGTTNSCLAISEN-GQTKVIENA
DNAK_NEIG1       -----------------------------MAKVIGIDLGTTNSCLAISEN-GQTKVIENA
DNAK_NEIMB       -----------------------------MAKVIGIDLGTTNSCLAISEN-GQTKVIENA
DNAK_CHRVO       -----------------------------MGKIIGIDLGTTNSCVAVVEG-GNPKVIENA
DNAK_BUCAI       -----------------------------MGKIIGIDLGTTNSCVAIMDG-NKPRVLENA
DNAK_BUCAP       -----------------------------MGKIIGIDLGTTNSCVAIMDG-NKPRVLENS
DNAK_BUCBP       -----------------------------MSKIIGIDLGTTNSCIAIMDG-NKARVLENS
DNAK_BLOFL       -----------------------------MGKIIGVDLGTTNSCVAIIES-NKPRVLENS
DNAK_BLOPB       -----------------------------MGKIIGIDLGTTNSCVAIIEG-NKPRVLENS
DNAK_WIGBR       -------------------------MEILMGNIIGIDLGTTNSCVAIIEN-GKVKVIENS
DNAK_ECOLI       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TTPRVLENA
DNAK_ECOL6       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TTPRVLENA
DNAK_ECO57       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TTPRVLENA
DNAK_SHIBS       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TTPRVLENA
DNAK_SHIDS       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TTPRVLENA
DNAK_SHISS       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TTPRVLENA
DNAK_SHIFL       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TIPRVLENA
DNAK_SALTI       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TQARVLENA
DNAK_SALPA       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TQARVLENA
DNAK_SALTY       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TQARVLENA
DNAK_SALCH       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TQARVLENA
DNAK_YERPE       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TKARVLENS
DNAK_YERPS       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TKARVLENS
DNAK_PHOLL       -----------------------------MGKIIGIDLGTTNSCVAIMDG-TTARVLENS
DNAK_PECAS       -----------------------------MGKIIGIDLGTTNSCVAIIDG-TQVKVLENS
DNAK_PASMU       -----------------------------MGKIIGIDLGTTNSCVAVMDG-DKPRVIENA
DNAK_MANSM       -----------------------------MGKIIGIDLGTTNSCVAVMDG-DKPRVIENA
DNAK_HAEIN       -----------------------------MGKIIGIDLGTTNSCVAVMDG-DKARVIENA
DNAK_HAEI8       -----------------------------MGKIIGIDLGTTNSCVAVMDG-DKARVIENA
DNAK_HAEDU       -----------------------------MGKIIGIDLGTTNSCVAVMDG-DKPRVLENA
DNAK2_COLP3      -----------------------------MGKIIGIDLGTTNSCVAVLDG-DSVRVIENA
DNAK_PSEHT       -----------------------------MGRIIGIDLGTTNSCVAVLDG-GKARVIENA
DNAK_SHEON       -----------------------------MGKIIGIDLGTTNSCVAVLDG-GKARVLENA
DNAK_VIBVU       -----------------------------MGKIIGIDLGTTNSCVAVLDG-DKPRVIENA
DNAK_VIBVY       -----------------------------MGKIIGIDLGTTNSCVAVLDG-DKPRVIENA
DNAK_VIBPA       -----------------------------MGKIIGIDLGTTNSCVAVLDG-DKPRVIENA
DNAK_VIBCH       -----------------------------MGKIIGIDLGTTNSCVAVLDG-DKPRVIENA
DNAK1_ALIF1      -----------------------------MGKIIGIDLGTTNSCVAVLDG-DTPRILENA
DNAK2_ALIF1      -----------------------------MGKIIGIDLGTTNSCVAVLDG-DTPRVLENA
DNAK1_PHOPR      -----------------------------MGRIIGIDLGTTNSCVAVLDG-DKPRVIENA
DNAK2_PHOPR      -----------------------------MSKIIGIDLGTTNSCIALLDG-DKPRVIENA
DNAK_IDILO       -----------------------------MGKTIGIDLGTTNSCVAVLDG-GKARVIENG
DNAK_XANAC       -----------------------------MGKIIGIDLGTTNSCVSIMDG-GKARVIENS
DNAK_XANC5       -----------------------------MGKIIGIDLGTTNSCVSIMDG-GKARVIENS
DNAK_XANCP       -----------------------------MGKIIGIDLGTTNSCVAIMDG-GKARVIENS
DNAK_XANC8       -----------------------------MGKIIGIDLGTTNSCVAIMDG-GKARVIENS
DNAK_XANOR       -----------------------------MGKIIGIDLGTTNSCVSIMDG-GKARVIENS
DNAK_XYLFA       -----------------------------MGKIIGIDLGTTNSCLAIIEG-GKGRVIENS
DNAK_XYLFT       -----------------------------MGKIIGIDLGTTNSCLAIIEG-GKGRVIENS
DNAK_PSEPK       -----------------------------MGKIIGIDLGTTNSCVSILEN-GNVKVIENA
DNAK_PSEPF       -----------------------------MGKIIGIDLGTTNSCVSVLEN-GKAKVIENA
DNAK_PSE14       -----------------------------MDRIIGIDLGTTNSCVSILEN-GNVKVIENA
DNAK_PSEU2       -----------------------------MGRIIGIDLGTTNSCVSILEN-GNVKVIENA
DNAK_PSESM       -----------------------------MGRIIGIDLGTTNSCVSILEN-GNVKVIDNA
DNAK_PSEF5       -----------------------------MGKIIGIDLGTTNSCVSILEN-GNVKVIENA
DNAK_PSEAE       -----------------------------MGKIIGIDLGTTNSCVAILEN-GNVKVIENA
DNAK_ACIAD       -----------------------------MAKIIGIDLGTTNSCVAVLEG-DKVKVIENA
DNAK_PSYA2       -----------------------------MGKVIGIDLGTTNSCVAVMEG-DKVKIIENA
DNAK_FRATT       -----------------------------MGKIIGIDLGTTNSCLAIMDG-KTAKVIENA
DNAK_LEGPH       -----------------------------MAKIIGIDLGTTNSCVAVMEG-DKPKVIENS
DNAK_LEGPL       -----------------------------MAKIIGIDLGTTNSCVAVMEG-DKPKVIENS
DNAK_LEGPA       -----------------------------MAKIIGIDLGTTNSCVAVMEG-DKPKVIENS
DNAK_COXBU       -----------------------------MAEIIGIDLGTTNSCVAVMEG-GKVRVIENA
DNAK_METCA       -----------------------------MAKIIGIDLGTTNSCVAILEG-GKPRVIENS
DNAK_NITOC       -----------------------------MGKIIGIDLGTTNSCVALMEG-NKPRVIENA
DNAK1_COLP3      -----------------------------MTKIIGIDLGTTNSCVAVMEG-GIAKIIENA
DNAK_DESAG       -----------------------------MGKIIGIDLGTTNSCVYIMEG-KDPKCITNP
DNAK_DESVH       -----------------------------MGKIIGIDLGTTNSCVYVMEG-KDPKCITNP
DNAK_GEOSL       -----------------------------MSKVIGIDLGTTNSCVAVMEG-GEPVVIANA
DNAK_PELCD       -----------------------------MGKVIGIDLGTTNSCVAVMEG-GEPVVIANA
DNAK_DESPS       -----------------------------MGKIIGIDLGTTNSCVSVMEG-GEPKVIANV
DNAK_CAMJE       -----------------------------MSKVIGIDLGTTNSCVAVYER-GESKVIPNK
DNAK_CAMJR       -----------------------------MSKVIGIDLGTTNSCVAVYER-GESKVIPNK
DNAK_HELHP       -----------------------------MAKVIGIDLGTTNSAMAVYEG-NEAKIIANK
DNAK_WOLSU       -----------------------------MGKVLGIDLGTTNSAMAVFEG-NEGKIIANK
DNAK_HELPY       -----------------------------MGKVIGIDLGTTNSAMAVYEG-NEAKIIANK
DNAK_HELPJ       -----------------------------MGKVIGIDLGTTNSAMAVYEG-NEAKIIANK
DNAK_FUSNN       -----------------------------MSKIIGIDLGTTNSCVAVMEG-GSATIIPNS
DNAK_RHOBA       --------------------------MAQGEKIIGIDLGTTNSVVAIMEG-SEPKVIPNP
DNAK_BACFN       -----------------------------MGKIIGIDLGTTNSCVSVFEG-NEPVVIANS
DNAK_BACFR       -----------------------------MGKIIGIDLGTTNSCVSVFEG-NEPVVIANS
DNAK_BACTN       -----------------------------MGKIIGIDLGTTNSCVAVFEG-NEPVVIANS
DNAK_PORGI       -----------------------------MGKIIGIDLGTTNSCVSVLEG-NEPIVITNS
DNAK_CHLTE       -----------------------------MGKIIGIDLGTTNSCVAVMQG-TQPTVIENS
DNAK_CHLCH       -----------------------------MGKIIGIDLGTTNSCVAVMQG-SQPTVIENS
DNAK_BORBU       -----------------------------MGKIIGIDLGTTNSCVAIMEH-GKPVVIQNS
DNAK_BORBP       -----------------------------MGKIIGIDLGTTNSCVAIMEH-GKPVVIQNS
DNAK_TREPA       -----------------------------MGKIIGIDLGTTNSCVAIMEG-GEPVVIQNA
DNAK_TREDE       -----------------------------MGKIIGIDLGTTNSCVSVMEG-GEPVVIPNS
DNAK_LEPIC       ---------------------------MSKEKIIGIDLGTTNSVVSVMEG-GDPVVIQNS
DNAK_LEPIN       ---------------------------MSKEKIIGIDLGTTNSVVSVMEG-GDPVVIQNS
DNAK_BDEBA       -----------------------------MGKIIGIDLGTTNSCVAIMEG-GEPKVLVNE
DNAK_CHLAB       ----------------------MSE-QKKSSKIIGIDLGTTNSCVSVMEG-GQAKVIVSS
DNAK_CHLCV       ----------------------MSE-QKKSSKIIGIDLGTTNSCVSVMEG-GQAKVITSS
DNAK_CHLPN       ----------------------MSE-HKKSSKIIGIDLGTTNSCVSVMEG-GQAKVITSS
DNAK_CHLTR       ----------------------MSE-KRKSNKIIGIDLGTTNSCVSVMEG-GQPKVIASS
DNAK_CHLTA       ----------------------MSE-KRKSNKIIGIDLGTTNSCVSVMEG-GQPKVIASS
DNAK_CHLMU       ----------------------MSE-KRKSNKIIGIDLGTTNSCVSVMEG-GQPKVIASS
DNAK_PARUW       --------------------MTMSQSQTKKGRIIGIDLGTTNSCVAVMEG-GAPKVIASA
DNAK_DEHM1       -----------------------------MAKVVGIDLGTTNSEVAVMQG-GEPVVIPSA
DNAK_DEHMC       -----------------------------MGKVVGIDLGTTNSEVAVMQG-GEPVVIPSA
DNAK_CLOPE       -----------------------------MSKIIGIDLGTTNSCVAVMEG-GEPVVITNS
DNAK_CLOTE       -----------------------------MAKVIGIDLGTTNSCVSVMEG-GNPVVITNS
DNAK_CLOAB       -----------------------------MSKVIGIDLGTTNSCVAVMEG-GDPAVIANS
DNAK_METAC       -----------------------------MAKILGIDLGTTNSCMAVMEG-GDAVVLPNA
DNAK_METMA       -----------------------------MAKILGIDLGTTNSCVAVMEG-GEAVVIPNA
DNAK_METBF       -----------------------------MAKILGIDLGTTNSCMAVMEG-GEAVVIPNA
DNAK_CALS4       -----------------------------MGKVIGIDLGTTFSCVAVMEG-GQPVVIPNS
DNAK_CARHZ       -----------------------------MGRIVGIDLGTTNSCIAVMEG-GEVIVIPNA
DNAK_SYMTH       -----------------------------MAKVIGIDLGTTNSVVAVMDG-SEPTVLENR
DNAK_AQUAE       -------------------------MAEKKEKIIGIDLGTTNSVVSVMMGDEAV-VIQNQ
DNAK_THEMA       -------------------------MAEKKEFVVGIDLGTTNSVIAWMKPDGTVEVIPNA
DNAK_THEAC       -----------------------------MSKIIGIDLGTSNSAAAVVIS-GKPTVIPSS
DNAK_THEVO       -----------------------------MSKIIGIDLGTSNSAAAVVIS-GKPTVIPSS
DNAK_PICTO       -----------------------------MSKIIGIDLGTSNSAAAVVIS-GKPTVIPAA
DNAK_METTH       --------------------------MAKKEKILGIDLGTSNSAAAVLIG-GKPTIIPSA
DNAK3_NOSS1      -----------------------------MGKVIGIDLGTTNSCVAVLEG-GQPIVIANS
DNAK1_THEEB      -----------------------------MGKIIGIDLGTTNSCVAVLEG-GNPVVIPNA
DNAK3_SYNP6      -----------------------------MGKVIGIDLGTTNSCVAVLEG-GKPIIVTNR
DNAK1_NOSS1      -----------------------------MGKVVGIDLGTTNSVVAVMEG-GKPVVIANA
DNAK3_SYNY3      -----------------------------MGKVVGIDLGTTNSVVAVMEG-GKPIVIANA
DNAK3_THEEB      ----------------------MRSRSNGMGKIVGIDLGTTNSVIAVLEG-GKPVVIANA
DNAK1_SYNP6      -----------------------------MGRVVGIDLGTTNSVIAVMEG-GKPMVIANA
DNAK1_PROMM      -----------------------------MGRIVGIDLGTTNSVVAVLEA-GRPQVIANA
DNAK1_SYNPX      -----------------------------MGRIVGIDLGTTNSVVAVLEA-GRPHVIANA
DNAK1_PROMA      -----------------------------MGRIVGIDLGTTNSVIGVLEA-GRPFVIANA
DNAK1_PROMP      -----------------------------MGQIVGIDLGTTNSVVGVIEA-GRPVVIANS
DNAK_THET8       -----------------------------MAKAVGIDLGTTNSVIAVLEG-GKPVVLENA
DNAK_THET2       -----------------------------MAKAVGIDLGTTNSVIAVLEG-GKPVVLENA
DNAK_DEIRA       -----------------------------MAKAVGIDLGTTNSVIAVMEG-GRPEVIVNA
DNAK2_NOSS1      -----------------------------MAKVVGIDLGTTNSCVAVMEG-GKPTVIANA
DNAK2_SYNY3      -----------------------------MGKVVGIDLGTTNSCVAVMEG-GKPTVIANA
DNAK2_THEEB      -----------------------------MAKVVGIDLGTTNSCVAVMEG-GKPTVIANA
DNAK2_PROMA      -----------------------------MGKVVGIDLGTTNSCVAVMEG-GKPTVIANA
DNAK_PROMT       -----------------------------MGKVVGIDLGTTNSCVAVMEG-GKPTVIANA
DNAK2_PROMP      -----------------------------MGKVVGIDLGTTNSCVAVMEG-GKPTVIANA
DNAK2_PROMM      -----------------------------MGKVVGIDLGTTNSCVAVMEG-GKPVVIANA
DNAK2_SYNPX      -----------------------------MGKVVGIDLGTTNSCVSVMEG-GKPTVIANA
DNAK2_SYNP6      -----------------------------MAKVVGIDLGTTNSCVAVMEG-GKPTVIANA
DNAK_GLOVI       -----------------------------MGKVVGIDLGTTNSVVAVLEG-GQPTVIANA
DNAK2_STRAW      -----------------------------MAKAVGIDLGTTNSVIAVWEG-GEPSVVPNS
                                                  :*:*:**: *             :   

DNAK_MYCH7       N----GKRTTPSVVAFKN-NEEIVGDAAKRQLETNPE-AIASIKRLMGTDK---------
DNAK_MYCHJ       N----GKTTTPSVVAFKN-NEEIVGDAAKRQLETNPE-AIASIKRLMGTDK---------
DNAK_MYCPU       N----GKRTTPSVVAFKN-GEIQVGEIAKRQLETNPD-TIASIKRLMGTTK---------
DNAK_MYCMO       N----GKRTTPSVVSFKN-DDIIVGEVAKRQLETNIN-TIASIKRKMGTSE---------
DNAK_MYCS5       N----GKRTTPSVVAFKN-GEIIVGDAAKRQVETNPD-TIISIKRLMGTNK---------
DNAK_MYCHO       N----GKRTTPSVVAFKN-GETIIGESAKRQLESNKD-SVASIKRLMGTSQ---------
DNAK_UREPA       E----GKRTVPSVVSFNG-DEVLVGDAAKRKQITNPN-TISSIKRLMGTKE---------
DNAK_MYCGE       E----GKRTTPSIVSYKN-NEIIVGDAAKRQMVTNPN-TIVSIKRLMGTSN---------
DNAK_MYCPN       E----GKRTTPSIVSYKN-NEIIVGDAAKRQMVTNPN-TIVSIKRLMGTSN---------
DNAK_MYCGA       E----GKRTTPSVVSYKN-GEIIVGDAAKRQMLTNPN-TIVSIKRLMGTSK---------
DNAK_MYCPE       E----GKRTIPSVVAFKD-NEIIVGDVAKRQMVTNKN-TISSIKRLMGTDK---------
DNAK_MESFL       E----GQRTTPSVVAFKN-EDIIVGGAAKRQAVTNPN-VVISVKSKMGTNE---------
DNAK_MYCMS       E----GQRTTPSVVAFKN-SDIIVGGAAKRQAVTNPN-VVQSIKSKMGTTS---------
DNAK_BACAN       E----GNRTTPSVVAFKN-EERQVGEVAKRQAITNPN-TIMSVKRHMGTDY---------
DNAK_BACCZ       E----GNRTTPSVVAFKN-EERQVGEVAKRQAITNPN-TIMSVKRHMGTDY---------
DNAK_BACHK       E----GNRTTPSVVAFKN-EERQVGEVAKRQAITNPN-TIMSVKRHMGTDY---------
DNAK_BACCR       E----GNRTTPSVVAFKN-EERQVGEVAKRQAITNPN-TIMSVKRHMGTDY---------
DNAK_BACC1       E----GNRTTPSVVAFKN-EERQVGEVAKRQAITNPN-TIMSVKRHMGTDY---------
DNAK_BACSU       E----GNRTTPSVVAFKN-GERQVGEVAKRQSITNPN-TIMSIKRHMGTDY---------
DNAK_BACLD       E----GARTTPSVVAFKN-GERQVGEVAKRQSITNPN-TIMSIKRHMGTDY---------
DNAK_GEOKA       E----GNRTTPSVVAFKN-GERLVGEVAKRQAITNPN-TIISIKRHMGTDY---------
DNAK_OCEIH       E----GNRTSPSVVAFKN-GERQVGEVAKRQAITNPN-TIQSIKRHMGTDY---------
DNAK_BACHD       E----GNRTTPSVVAFKD-GERQVGEVAKRQAITNPN-TVISIKRHMGTNH---------
DNAK_BACSK       E----GNRTTPSVVAFKD-GERLVGEVAKRQAITNPN-TVISIKRHMGTDY---------
DNAK_STRA3       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPD-TVISIKSKMGTSE---------
DNAK_STRA5       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPD-TVISIKSKMGTSE---------
DNAK_STRA1       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPD-TVISIKSKMGTSE---------
DNAK_STRP1       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPE-TVISIKSKMGTSE---------
DNAK_STRP6       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPE-TVISIKSKMGTSE---------
DNAK_STRP8       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPE-TVISIKSKMGTSE---------
DNAK_STRPM       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPE-TVISIKSKMGTSE---------
DNAK_STRP3       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPD-TVISIKSKMGTSE---------
DNAK_STRMU       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPE-TILSIKSKMGTSE---------
DNAK_STRPN       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPD-TVISIKSKMGTSE---------
DNAK_STRR6       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPD-TVISIKSKMGTSE---------
DNAK_STRT1       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPD-TVISIKSKMGTSE---------
DNAK_STRT2       E----GNRTTPSVVSFKN-GEIIVGDAAKRQAVTNPD-TVISIKSKMGTSE---------
DNAK_LACLA       E----GNRTTPSVVAFKN-GEIIVGDAAKRQAVTNPE-TIISIKSKMGTSE---------
DNAK_ENTFA       E----GNRTTPSVVSFKN-GEIQVGEVAKRQAVTNPN-TISSIKRHMGEAGY--------
DNAK_LISMF       E----GARTTPSVVGFKN-GERQVGEVAKRAAITNPN-TISSIKRHMGTNY---------
DNAK_LISMO       E----GARTTPSVVGFKN-GERQVGEVAKRAAITNPN-TISSIKRHMGTNY---------
DNAK_LISIN       E----GARTTPSVVGFKN-GERQVGEVAKRAAITNPN-TISSIKRHMGTNY---------
DNAK_STAAC       E----GSRTTPSVVAFKN-GETQVGEVAKRQAITNPN-TVQSIKRHMGTDY---------
DNAK_STAAM       E----GSRTTPSVVAFKN-GETQVGEVAKRQAITNPN-TVQSIKRHMGTDY---------
DNAK_STAAN       E----GSRTTPSVVAFKN-GETQVGEVAKRQAITNPN-TVQSIKRHMGTDY---------
DNAK_STAAR       E----GSRTTPSVVAFKN-GETQVGEVAKRQAITNPN-TVQSIKRHMGTDY---------
DNAK_STAAS       E----GSRTTPSVVAFKN-GETQVGEVAKRQAITNPN-TVQSIKRHMGTDY---------
DNAK_STAAW       E----GSRTTPSVVAFKN-GETQVGEVAKRQAITNPN-TVQSIKRHMGTDY---------
DNAK_STAES       E----GARTTPSVVAFKN-GETQVGEVAKRQAITNPN-TVQSIKRHMGTDY---------
DNAK_STAEQ       E----GARTTPSVVAFKN-GETQVGEVAKRQAITNPN-TVQSIKRHMGTDY---------
DNAK_STAHJ       E----GARTTPSVVAFKN-GETQVGEVAKRQAITNPN-TVQSIKRHMGTDY---------
DNAK_STAS1       E----GARTTPSVVAFKN-DETQVGEVAKRQAITNPN-TIQSIKRHMGTDY---------
DNAK_LACAC       E----GNRTTPSVVAFKD-GEIQVGEVAKRQAITNPN-TIVSIKRHMGEADY--------
DNAK_LACJO       E----GNRTTPSVVAFKN-GEIQVGEVAKRQAITNPN-TIVSIKSHMGEEGY--------
DNAK_LACSK       E----GARTTPSVVSFKN-GEIQVGEVAKRQAITNPD-TIASIKRHIGEAGY--------
DNAK_LACSS       E----GARTTPSVVSFKN-GEIQVGEVAKRQAITNPD-TIASIKRHIGEAGY--------
DNAK_LACPL       E----GGRTVPSVVAFKD-GETQVGEVAKRQAITNPN-TVASIKRHMGEAGY--------
DNAK_ONYPE       E----GGRTTPSVVSFKG-DEIMVGEIAKRQVITNPN-TISSIKRHMGEANY--------
DNAK_TROWT       E----GLRTTPSVVAFSRDGEVLVGDTAKRQAVTNVDNTISSVKRHIGTDW---------
DNAK_TROW8       E----GLRTTPSVVAFSRDGEVLVGDTAKRQAVTNVDNTISSVKRHIGTDW---------
DNAK_LEIXX       E----GFRTTPSVVAFTKDGEVLVGETAKRQAVTNVDRTLSSVKRHMGTDWK--------
DNAK_BIFLO       E----GARTTPSVVAFSKSGEILVGEVAKRQAVTNVDRTISSVKRHMGSDW---------
DNAK_COREF       E----GSRTTPSVVAFAKNGEVLVGQSAKNQAVTNVDRTIRSVKRHIGTDW---------
DNAK_CORGL       E----GSRTTPSVVAFAKNGEVLVGQSAKNQAVTNVDRTIRSVKRHIGTDW---------
DNAK_CORDI       E----GSRTTPSVVAFAKNGEVLVGQSAKNQAVTNVDRTIRSVKRHVGTDW---------
DNAK_CORJK       E----GSRTTPSIVAFAKNGEVLVGQSAKNQAVANVDRTIRSVKRHMGTDW---------
DNAK_MYCLE       E----GSRTTPSTVAFARNGEVLVGQPAKNQAVTNVDRTIRSVKRHMGSDW---------
DNAK_MYCPA       E----GSRTTPSIVAFARNGEVLVGQPAKNQAVTNVDRTIRSVKRHMGTDW---------
DNAK_MYCTU       E----GSRTTPSIVAFARNGEVLVGQPAKNQAVTNVDRTVRSVKRHMGSDW---------
DNAK_MYCBO       E----GSRTTPSIVAFARNGEVLVGQPAKNQAVTNVDRTVRSVKRHMGSDW---------
DNAK_NOCFA       E----GSRTTPSIVAFAKNGEVLVGQPAKNQAVTNVDRTIRSVKRHIGTDW---------
DNAK1_STRAW      E----GARTTPSVVAFAKNGEVLVGEVAKRQAVTNVDRTVRSVKRHMGTDW---------
DNAK_STRCO       E----GARTTPSVVAFAKNGEVLVGEVAKRQAVTNVDRTIRSVKRHMGTDW---------
DNAK_THEFY       E----GARTTPSVVAFAKNGEVLVGEIAKRQAVTNVERTIRSVKRHMGTDW---------
DNAK_CUTAK       E----GARTTPSVVAFTNSGETLVGEVAKRQAVTNVDRTVRSVKRHMGEAW---------
DNAK_HALMA       E----GERTTPSVVAFDD-GERLVGKPAKNQAVKNPDETIQSIKRHMGEDDY--------
DNAK_NATPD       E----GERTTPSVVAFTDDGERLVGKPAKNQAVQNPEDTIQSIKRHMGEDDY--------
DNAK_HALSA       E----GDRTTPSIVAHDD-GELLVGKPAKNQAVQNPDQTIASIKRHMGEEDY--------
DNAK_AGRFC       E----GARTTPSMVAFSDDGERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPT-----
DNAK_RHIME       E----GARTTPSMVAFTEDGERLVGQPAKRQAVTNPENTLFAIKRLIGRTFEDPT-----
DNAK_RHILO       E----GARTTPSIVAISGDGERLVGQPAKRQAVTNPENTIFAVKRLIGRRYDDPV-----
DNAK_BRUME       E----GARTTPSIIAFTDGDERLAGQPAKRQAVTNPEGTLFAVKRLIGRRYDDPM-----
DNAK_BRUAB       E----GARTTPSIIAFTDGDERLAGQPAKRQAVTNPEGTLFAVKRLIGRRYDDPM-----
DNAK_BRUSU       E----GARTTPSIIAFTDGDERLAGQPAKRQAVTNPEGTLFAVKRLIGRRYDDPM-----
DNAK_BARHE       E----GARTTPSVVAFTDGGERLVGQPAKRQAVTNPEGTIFAVKRLIGRRFDDPM-----
DNAK_BARQU       E----GARTTPSVVAFTDGGERLVGQPAKRQAVTNPEGTIFAVKRLIGRRFDDPM-----
DNAK_BRADU       E----GMRTTPSIVAVTDDGERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPM-----
DNAK_NITWN       E----GMRTTPSIVAFSDDGERLVGQPAKRQAVTNPERTIFAVKRLIGRRYDDPT-----
DNAK_RHOPA       E----GMRTTPSIVAITDDGERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPM-----
DNAK_CAUVC       E----GARTTPSVVAFLEDGERLIGQPAKRQAVTNPTNTLFAIKRLIGRTASDPV-----
DNAK_ZYMMO       E----GARTTPSIVAFTKDSERLIGQPAKRQAVTNSENTIFAVKRLIGRRFDDPV-----
DNAK_RHOS4       E----GARTTPSIVGFTDS-ERLVGQPAKRQAVTNPSNTVFAVKRLIGRRVGDAE-----
DNAK_RUEPO       E----GARTTPSIVAFTDE-ERLVGQPAKRQAVTNPSNTIFGVKRLIGRRVDDAE-----
DNAK_RICFE       E----GERTTPSIIAFANS-ERLVGQPAKRQAVTNPRNTIYAVKRLIGRNFTDPM-----
DNAK_RICTY       E----GERTTPSIIAFANS-ERLVGQPAKRQAVTNPRNTIYAVKRLIGRNFTDPM-----
DNAK_RICPR       E----GERTTPSIIAFANS-ERLVGQPAKRQAVTNPRNTIYAVKRLIGRNFTDPM-----
DNAK_RICCN       E----GERTTPSIIAFANG-EKLVGQSAKRQAVTNPRNTIYAVKRLIGRNFIDPM-----
DNAK_PELUB       E----GARTTPSVVAFTEDGEKLVGQPAKRQAVTNPENTIFAVKRLIGRSFEDPT-----
DNAK_EHRRG       E----GARTTPSIVAFTDS-EVLVGDPAKRQATTNAKNTIYASKRLIGRRYQD-------
DNAK_EHRRW       E----GARTTPSIVAFTDS-EVLVGDPAKRQATTNAKNTIYASKRLIGRRYQD-------
DNAK_EHRCJ       E----GARTTPSIVAFTDS-ERLVGDPAKRQATTNAKNTIYASKRLIGRRYQD-------
DNAK_ANAMM       E----GSRTTPSVVAFTEN-ERLVGELAKRQANINAQNTIYASKRIIGRRYDD-------
DNAK_WOLPM       E----GARTTPSIVALTSSGERLIGAPAKRQATTNASNTFFATKRLIGRQYSDPE-----
DNAK_WOLTR       E----GARTTPSVVAFTSSGERLIGAPAKRQATTNASNTFFATKRLIGRQYGDPE-----
DNAK_BORBR       E----GARTTPSIVAYMDDGETLVGAPAKRQAVTNPKNTLYAVKRLIGRKFDEKA-----
DNAK_BORPE       E----GARTTPSIVAYMDDGETLVGAPAKRQAVANPKNTLYAVKRLIGRKFDEKA-----
DNAK_BORPA       E----GARTTPSIVAYMDDGETLVGAPAKRQAVTNPKNTLYAVKRLIGRKFDEKA-----
DNAK_BURPS       E----GARTTPSIIAYMDDNEVLVGAPAKRQSVTNPKNTLFAVKRLIGRRFEEKE-----
DNAK_BURMA       E----GARTTPSIIAYMDDNEVLVGAPAKRQSVTNPKNTLFAVKRLIGRRFEEKE-----
DNAK_BURP1       E----GARTTPSIIAYMDDNEVLVGAPAKRQSVTNPKNTLFAVKRLIGRRFEEKE-----
DNAK_BURL3       E----GTRTTPSIIAYMDDNEVLVGAPAKRQSVTNPKNTLFAVKRLIGRRFEEKE-----
DNAK_RALSO       E----GARTTPSIIAYMEDGEILVGAPAKRQAVTNPRNTLYAVKRLIGRKFEEKE-----
DNAK_CUPPJ       E----GTRTTPSIIAYMEDGEILVGAPAKRQAVTNPRNTLYAVKRLIGRKFEEKE-----
DNAK_AROAE       E----GARTTPSVVAYAEDGEILTGAPAKRQAVTNAKNTLFAVKRLIGRRFEEKE-----
DNAK_THIDA       E----GARTTPSIVAYAEDGEILVGAPAKRQAVTNPKNTIFAVKRLIGRRFEEKE-----
DNAK_DECAR       E----GARTTPSIIGYTEDGEILCGAPAKRQAVTNPKNTLYAVKRLIGRRFEEKE-----
DNAK_NITEU       E----GARTTPSIVAYAEDNEILVGASAKRQAVTNPENTLFAIKRLIGRRFDEEV-----
DNAK_NEIMA       E----GARTTPSVIAYLDGGEILVGAPAKRQAVTNAKNTIYAAKRLIGHKFEDKE-----
DNAK_NEIG1       E----GARTTPSIIAYLDGGEILVGAPAKRQAVTNAKNTIYAAKRLIGHKFEDKE-----
DNAK_NEIMB       E----GARTTPSVIAYLDGGEILVGAPAKRQAVTNAKNTIYAAKRLIGHKFEDKE-----
DNAK_CHRVO       E----GNRTTPSIIAYVEDGEILVGAPAKRQAVTNPKNTIYAAKRLIGRRFEDKE-----
DNAK_BUCAI       E----GDRTTPSIIAYTQEGEVLVGQPAKRQAITNPKNTLFAIKRLIGRKFKDDE-----
DNAK_BUCAP       E----GDRTTPSIIAYTEKGEVLVGQPAKRQAITNPKNTLFAIKRLIGRKFRDDE-----
DNAK_BUCBP       E----GDRTTPSIIAYTNDNEILIGKPAKRQSITNPKNTLFAIKRLIGRKFTDNE-----
DNAK_BLOFL       E----GDRTTPSVVAYTQDGEILVGQPAKRQSVTNPKNTLFAIKRLIGRRFQDQE-----
DNAK_BLOPB       E----GDRTTPSIIAYTQDGEILVGQPAKRQSVTNPKNTLFAIKRLIGRRFQDTE-----
DNAK_WIGBR       E----GDRTTPSIIAYTEENEILVGQPAKRQSVTNPKNTFFAIKRLIGRKFTDHE-----
DNAK_ECOLI       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_ECOL6       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_ECO57       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_SHIBS       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_SHIDS       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_SHISS       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_SHIFL       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_SALTI       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_SALPA       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_SALTY       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_SALCH       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_YERPE       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_YERPS       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_PHOLL       E----GDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEE-----
DNAK_PECAS       E----GDRTTPSIIAYTQDGEILVGQPAKRQAVTNPQNTLFAIKRLIGRRFKDEE-----
DNAK_PASMU       E----GDRTTPSIIAYTQDNETLVGQPAKRQAVTNPKNTLFAIKRLIGRRFQDEE-----
DNAK_MANSM       E----GERTTPSIIAYTQDNEVLVGQPAKRQAVTNPKNTLFAIKRLIGRRFEDQE-----
DNAK_HAEIN       E----GARTTPSIIAYT-DNETLVGQPAKRQAITNPKNTLFAIKRLIGRRFESEE-----
DNAK_HAEI8       E----GARTTPSIIAYT-DNETLVGQPAKRQAITNPKNTLFAIKRLIGRRFESEE-----
DNAK_HAEDU       E----GARTTPSIIAYT-DKETLVGQPAKRQAITNPKNTLFAIKRLIGRRFTDNE-----
DNAK2_COLP3      E----GDRTTPSIIGYTAEGETLVGQPAKRQSVTNPENTLYAIKRLIGRRFEDKE-----
DNAK_PSEHT       E----GDRTTPSVIAYTQDGETLVGQPAKRQAVTNPTNTVFAIKRLIGRRFEDEE-----
DNAK_SHEON       E----GDRTTPSIIAYTDD-ETIVGQPAKRQAVTNPNNTFFAIKRLIGRRFKDDE-----
DNAK_VIBVU       E----GERTTPSVIAYT-DGETLVGQPAKRQAVTNPENTLFAIKRLIGRRFEDEE-----
DNAK_VIBVY       E----GERTTPSVIAYT-DGETLVGQPAKRQAVTNPENTLFAIKRLIGRRFEDEE-----
DNAK_VIBPA       E----GERTTASVIAYT-DGETLVGQPAKRQAVTNPTNTLFAIKRLIGRRFEDEE-----
DNAK_VIBCH       E----GERTTPSVIAYT-DGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDEE-----
DNAK1_ALIF1      E----GERTTASVIAYT-DGETLVGQPAKRQAITNPQNTLFAIKRLIGRRFEDEE-----
DNAK2_ALIF1      E----GERTTASVIAYT-DGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDEE-----
DNAK1_PHOPR      E----GERTTASVVAYTQDGETLVGQPAKRQAVTNPENTLYAIKRLIGRRFEDEE-----
DNAK2_PHOPR      E----GERTTASVIAYTQDGEILVGQPAKRQAVTNPKNTLFAIKRLLGRRFEDEE-----
DNAK_IDILO       E----GDRTTPSVVAFTDDGEILVGSPAKRQAVTNPNKTLFAIKRLIGRRFQDEE-----
DNAK_XANAC       E----GDRTTPSIVAYTKDGEVLVGASAKRQAVTNPKNTFYAVKRLIGRKFTDGE-----
DNAK_XANC5       E----GDRTTPSIVAYTKDGEVLVGASAKRQAVTNPKNTFYAVKRLIGRKFTDGE-----
DNAK_XANCP       E----GDRTTPSIVAYTKDGEVLVGASAKRQAVTNPKNTFYAVKRLIGRKFTDGE-----
DNAK_XANC8       E----GDRTTPSIVAYTKDGEVLVGASAKRQAVTNPKNTFYAVKRLIGRKFTDGE-----
DNAK_XANOR       E----GDRTTPSIVAYTKDGEVLVGASAKRQAVTNPKNTFYAVKRLIGRKFTDAE-----
DNAK_XYLFA       E----GDRTTPSIVAYTKDGEVLVGAAAKRQAVTNPKNTFYAVKRLIGRKFGDAE-----
DNAK_XYLFT       E----GDRTTPSIVAYTKDGEVLVGAAAKRQAVTNPKNTFYAVKRLIGRKFGDAE-----
DNAK_PSEPK       E----GARTTPSIVAYANDGEILVGQSAKRQAVTNPHNTLFAVKRLIGRRFEEDV-----
DNAK_PSEPF       E----GARTTPSIIAYANDGEILVGQSAKRQAVTNPHNTLFAVKRLIGRRFEEEV-----
DNAK_PSE14       E----GTRTTPSIIAYANDGEILVGQSAKRQAVTNPHNTLYAVKRLIGRKFEEDV-----
DNAK_PSEU2       E----GTRTTPSIIAYANDGEILVGQSAKRQAVTNPHNTLYAVKRLIGRKFEEDV-----
DNAK_PSESM       E----GTRTTPSIIAYANDGEILVGQSAKRQAVTNPHNTLYAVKRLIGRKFDEQV-----
DNAK_PSEF5       E----GARTTPSIIAYANDGEILVGQSAKRQAVTNPHNTLYAVKRLIGRRFDEEV-----
DNAK_PSEAE       E----GARTTPSIIAYTNDGETLVGQPAKRQAVTNPQNTLYAVKRLIGRRFEENV-----
DNAK_ACIAD       E----GTRTTPSIVAYK-DSEILVGQSAKRQAVTNPKNTLFAIKRLIGRRYEDQA-----
DNAK_PSYA2       E----GTRTTPSIVAYK-DDEILVGQSAKRQAVTNPNNTLFAIKRLIGRRFDDKV-----
DNAK_FRATT       E----GHRTTPSVVAYTDSGEILVGQAAKRQAVTNPDNTFFAIKRLIGRKYDDKA-----
DNAK_LEGPH       E----GHRTTPSIVAFTDDNEILVGQSAKRQSVTNPEKTLFAIKRLIGRRFDDPI-----
DNAK_LEGPL       E----GHRTTPSIVAFTDDNEILVGQSAKRQSVTNPEKTLFAIKRLIGRRFDDPI-----
DNAK_LEGPA       E----GHRTTPSIVAFTDDNEILVGQSAKRQSVTNPEKTLFAIKRLIGRRFDDPI-----
DNAK_COXBU       E----GSRTTPSIVAYTKDGEVLVGASAKRQAVTNADRTLYAIKRLIGRRFDDNV-----
DNAK_METCA       E----GARTTPSIVAFTADNEVLVGQSAKRQAITNPKNTLFAIKRLIGRRYKDDV-----
DNAK_NITOC       E----GDRTTPSVVAFTKEGETLVGQSAKRQAITNPQNTLYAIKRLIGRRFDEEV-----
DNAK1_COLP3      E----GSRTTPSIVAYA-NNETLAGQPAKRQSVTNSTNTLFAIKRLIGRKFDDKE-----
DNAK_DESAG       E----GGRTTPSVVGFTDK-ERLVGDIAKRQAVTNPERTVFAIKRLMGRKADAPE-----
DNAK_DESVH       E----GGRTTPSVVAFTDK-ERLVGDIAKRQAVTNPERTVFAVKRLMGRRGDAPE-----
DNAK_GEOSL       E----GSRTTPSMVAFAESGERLVGQQAKRQAVTNPENTLFAIKRLIGRKYDTEE-----
DNAK_PELCD       E----GSRTTPSMVAFTENGERLVGQQAKRQAVTNPENTLFAIKRLIGRKFDSDA-----
DNAK_DESPS       E----GNRTTPSVVAFADNDERLVGMIAKRQAVTNPERTVYAAKRLIGRKFTDAE-----
DNAK_CAMJE       E----GKNTTPSVVAFTDKGEVLVGDSAKRQAVTNPEKTIYSIKRIMGLMINEDA-----
DNAK_CAMJR       E----GKNTTPSVVAFTDKGEVLVGDSAKRQAVTNPEKTIYSIKRIMGLMINEDA-----
DNAK_HELHP       E----GKNTTPSIVAFTDKGEILVGEPAKRQAVTNPKKTVYSIKRIMGLMFNEDK-----
DNAK_WOLSU       E----GRNTTPSVVAFTDKGEILVGDPAKRQAITNPQKTIYSIKRIMGLMMSEDK-----
DNAK_HELPY       E----GKNTTPSIVAFTDKGEILVGESAKRQAVTNPEKTIYSIKRIMGLMFNEDK-----
DNAK_HELPJ       E----GKNTTPSIVAFTDKGEILVGESAKRQAVTNPEKTIYSIKRIMGLMFNEDK-----
DNAK_FUSNN       E----GARTTPSVVNIKDNGEVVVGEIAKRQAVTNPTSTVSSIKTHMGSDY---------
DNAK_RHOBA       E----GNRLTPSVVAFTDKQETIVGEPARRQAVTNPKRTVYSAKRFMGRRHNEVQ-----
DNAK_BACFN       E----GKRTTPSIVAFVDGGERKVGDPAKRQAITNPTRTIFSIKRFMGENWDQ-------
DNAK_BACFR       E----GKRTTPSIVAFVDGGERKVGDPAKRQAITNPTRTIFSIKRFMGENWDQ-------
DNAK_BACTN       E----GKRTTPSVVAFVDGGERKVGDPAKRQAITNPTRTIFSIKRFMGENWDQ-------
DNAK_PORGI       E----GKRTTPSVVAFVDGGERKVGDPAKRQAITNPTKTIYSIKRFMGETYDQ-------
DNAK_CHLTE       E----GSRTTPSMVAFTKTGERLVGQAAKRQAVTNPKNTIFSIKRFMGRKYDE-------
DNAK_CHLCH       E----GNRTTPSVVGFTKTGDRLVGQAAKRQAITNPKNTIFSIKRFMGRRFDE-------
DNAK_BORBU       E----GGRTTPSIVAYTNKGERLVGQVAKNQMVTNPENTIYSIKRFMGRRFEE-------
DNAK_BORBP       E----GGRTTPSIVAYTNKGERLVGQVAKNQMVTNPENTIYSIKRFMGRRFEE-------
DNAK_TREPA       E----GGRTTPSIIGFTSDGGRVVGQPAKNQMVTNPEHTIYSIKRFIGSRFNE-------
DNAK_TREDE       E----GGRTTPSIVGFTSKDERVVGQPAKNQMITNPERTVYSVKRFIGHRYSE-------
DNAK_LEPIC       E----GARTTPSIVAFTAKGETLIGQFAKNQAITNAVNTIRSAKRFIGRRLNE-------
DNAK_LEPIN       E----GARTTPSIVAFTAKGETLIGQFAKNQAITNAVNTIRSAKRFIGRRLNE-------
DNAK_BDEBA       E----GARTTPSVVAYTKDGDRLVGQIAKRQAVTNPENTIYSAKRFIGRRFEE-------
DNAK_CHLAB       E----GTRTTPSIVAFKGN-ETLVGIPAKRQAVTNPAKTLASTKRFIGRKYSE-------
DNAK_CHLCV       E----GTRTTPSIVAFKGN-ETLVGIPAKRQAVTNPEKTLASTKRFIGRKHSE-------
DNAK_CHLPN       E----GTRTTPSIVAFKGN-EKLVGIPAKRQAVTNPEKTLGSTKRFIGRKYSE-------
DNAK_CHLTR       E----GTRTTPSIVAFKGG-ETLVGIPAKRQAVTNPEKTLASTKRFIGRKFSE-------
DNAK_CHLTA       E----GTRTTPSIVAFKGG-ETLVGIPAKRQAVTNPEKTLASTKRFIGRKFSE-------
DNAK_CHLMU       E----GTRTTPSIVAFKGS-ETLVGIPAKRQAVTNPEKTLASTKRFIGRKFSE-------
DNAK_PARUW       E----GTRTTPSVVAYKGN-ERLVGIPAKRQAVTNPENTITSSKRFIGRKYQE-------
DNAK_DEHM1       E----GSTLIPSVVAVNKNGERIVGRQAKNQAILNPENTVYSIKRFMGRKWGEPAGRELP
DNAK_DEHMC       E----GSTLIPSVVAINKNGERIVGRQAKNQAILNPENTVYSIKRFMGRKWGEPAGRELP
DNAK_CLOPE       E----GARTTPSVVSFQANGERLVGQVAKRQAITNPDKTIMSIKRHMG-TDYKVN-----
DNAK_CLOTE       E----GARTTPSVVSFQDNGERLVGQIAKRQAITNPHKTIMSIKRYMG-TDHKET-----
DNAK_CLOAB       E----GARTTPSVVSFQKNGERLVGQVAKRQSITNPDKTIISIKRKMG-TAEKVA-----
DNAK_METAC       E----GSRTTPSVVGFSKKGEKLVGQVAKRQAISNPENTVYSIKRHMGEANYKVT-----
DNAK_METMA       E----GSRTTPSVVGFSKKGEKLVGQVAKRQAISNPDNTVYSIKRHMGEANYKVT-----
DNAK_METBF       E----GARTTPSVVGFSKKGEKLVGQVAKRQAISNPENTVYSIKRHMGDANYTVT-----
DNAK_CALS4       E----GTRTTPSVVAFTKEGERLVGHPARRQAIINPERTIMSIKRHMG-TDYKVK-----
DNAK_CARHZ       E----GGRTTPSVVAFGKNGERIVGQVAKRQAITNPERTVISIKRHMG-TNYRVK-----
DNAK_SYMTH       E----GDRTTPSVVAFTKTGERLVGKVAKRQAITNPDRTIISIKRHMG-SDYKVR-----
DNAK_AQUAE       E----GSRLTPSVVSWTKEKEILVGEPAKRRAILDPENTVYESKRFIGRKFEEVK-----
DNAK_THEMA       E----GSRVTPSVVAFTKSGEILVGEPAKRQMILNPERTIKSIKRKMG------------
DNAK_THEAC       EGVSIGGKAFPSYVAFTKDGQMLVGEPARRQALLNPEGTIFAAKRKMG------------
DNAK_THEVO       EGVSIGGKAFPSYVAFTKDGQMLVGEPARRQALLNPEGTIFAAKRKMG------------
DNAK_PICTO       EGVSLGGKAFPSYVAFTKDGQLLVGEPARRQALLNPEGTVYAAKRKMG------------
DNAK_METTH       EGASQYGKSFPSCVAFTEDGQMLVGEPARRQAVTNPENTITAIKRSMG------------
DNAK3_NOSS1      E----GGRTTPSIVGFGKSGDRLVGQLAKRQAVTNAENTIFSIKRFIGRRWEDTETE---
DNAK1_THEEB      E----GGRTTPSIVAFGKSGERLVGQLAKRQAITNAENTIFSIKRFIGRRWEETAQE---
DNAK3_SYNP6      E----GDRTTPSIVAVGRKGDRIVGRMAKRQAVTNAENTVYSIKRFIGRRWEDTEAE---
DNAK1_NOSS1      E----GMRTTPSVVGFSKDGERVVGQMARRQTVLNPQNTFFAVKRYIGRRYNELS-----
DNAK3_SYNY3      E----GMRTTPSVVGFNKEGELVVGQMGRRQAVLNPQNTFYGVKRFMGRRYTDLT-----
DNAK3_THEEB      E----GSRTTPSVVAFGKDGERLVGQLARRQAVLNPQNTFYAVKRFIGREYSELT-----
DNAK1_SYNP6      E----GVRTTPSVVGVSKTGERLVGELARRQLVLNPRNTFANIKRFIGRRYDELT-----
DNAK1_PROMM      E----GSRTTPSVVGYSKEAELLVGQLARRQLVLNPRNTFANLKRFVGRGWDEMD-----
DNAK1_SYNPX      E----GGRTTPSVVGYSKDQELLVGQLARRQLVLSPRNTFSNLKRFVGRDWEELE-----
DNAK1_PROMA      E----GSRTTPSVIGYTKESELVVGQQARRQLVLNPKNTFSNLKRYVGRSWDELE-----
DNAK1_PROMP      E----GTRTTPSIVGFTKNSEIVIGDQARRQLVLNPKNTFYNLKRFIGRDWDELD-----
DNAK_THET8       E----GERVTPSVVAFR-DGETLVGRMAKRQAVLNPEGTIFEIKRFIGRRFEEVQ-----
DNAK_THET2       E----GERVTPSVVAFR-DGETLVGRMAKRQAVLNPEGTIFEIKRFIGRRFEEVQ-----
DNAK_DEIRA       E----GGRTTPSVVAYK-GDEILVGQIARRQAALNPAATLFEVKRFIGRRWDEVK-----
DNAK2_NOSS1      E----GFRTTPSVVAFAKNGDTLVGQIAKRQAVMNPENTFYSVKRFIGRRYDEVT-----
DNAK2_SYNY3      E----GFRTTPSVVGYAKNGDRLVGQIAKRQAVMNPGNTFYSVKRFIGRKFDEIT-----
DNAK2_THEEB      E----GFRTTPSVVAYTKNGDRLVGQIAKRQAVMNPENTFYSVKRFIGRRFDEVT-----
DNAK2_PROMA      E----GFRTTPSVVAYTKNQDQLVGQIAKRQAVMNPENTFYSAKRFVGRRVDEVN-----
DNAK_PROMT       E----GFRTTPSVVAYTKNQDQLVGQIAKRQAVMNPENTFYSSKRFVGRRVDEVN-----
DNAK2_PROMP      E----GFRTTPSVVAYTKNQDQLVGQIAKRQAVMNPENTFYSAKRFVGRRVDEVN-----
DNAK2_PROMM      E----GFRTTPSVVAYTKNQDQLVGQIAKRQAVMNTDNTFYSAKRFVGRRVDEVN-----
DNAK2_SYNPX      E----GFRTTPSVVAYTKNQDQLVGQIAKRQAVMNPDNTFYSVKRFIGRRVDEVN-----
DNAK2_SYNP6      E----GFRTTPSVVAFAKNQDRLVGQIAKRQAVMNPENTFYSVKRFIGRRPDEVT-----
DNAK_GLOVI       E----GSRTTPSVVAFTKNHDRLVGQLARRQAVLNPENTFYSVKRFIGRKYDEIT-----
DNAK2_STRAW      E----GNRTTPSVVAFTDTGERLVGQLARRQAILNPKGTIYSAKRFIGRHFDEIS-----
                 :         .* :          *  .:.    .    .   *  :*            

DNAK_MYCH7       ---------------------TVRANE------------RDYKPEEISAKILAYLKEYAE
DNAK_MYCHJ       ---------------------TVRANE------------RDYKPEEISAKILAYLKEYAE
DNAK_MYCPU       ---------------------TVKANG------------KTYKPEEISAMILSHLKEYAE
DNAK_MYCMO       ---------------------TVKIND------------KEYKPEEISAMILSYLKDYAE
DNAK_MYCS5       ---------------------TVKANN------------KEYKPEEISAMILSYMKDYAE
DNAK_MYCHO       ---------------------TVHLNN------------KDYKPEEISAMILSYMKDYAD
DNAK_UREPA       ---------------------KVTVLN------------KDYTPEEISAKILTYIKEYAE
DNAK_MYCGE       ---------------------KVKVQNADGT-------TKELSPEQVSAQILSYLKDFAE
DNAK_MYCPN       ---------------------KVTVKNPDGS-------TKELTPEEVSAQILSYLKDYAE
DNAK_MYCGA       ---------------------KVKIND-KGV-------EKELTPEEVSASILSYLKDYAE
DNAK_MYCPE       ---------------------TVEVNG------------KKYTPEQISAQILSYIKKCAE
DNAK_MESFL       ---------------------KIDING------------KKYTPEQISAEILRYMKKYAE
DNAK_MYCMS       ---------------------KVNLEG------------KDYSPEQISAEILRYMKNYAE
DNAK_BACAN       ---------------------KVEVEG------------KDYTPQEISAIILQNLKASAE
DNAK_BACCZ       ---------------------KVEVEG------------KDYTPQEISAIILQNLKASAE
DNAK_BACHK       ---------------------KVEVEG------------KDYTPQEISAIILQNLKASAE
DNAK_BACCR       ---------------------KVEVEG------------KDYTPQEISAIILQNLKASAE
DNAK_BACC1       ---------------------KVEIEG------------KEYTPQEISAIILQNLKASAE
DNAK_BACSU       ---------------------KVEIEG------------KDYTPQEVSAIILQHLKSYAE
DNAK_BACLD       ---------------------TVEIEG------------KKYTPQEVSAIILQHLKSYAE
DNAK_GEOKA       ---------------------KVEIEG------------KQYTPQEISAIILQYLKSYAE
DNAK_OCEIH       ---------------------KVKIEE------------KEYTPQEVSAIILQYIKSYAE
DNAK_BACHD       ---------------------KENIEG------------KEYTPQEISAIILQKLKSDAE
DNAK_BACSK       ---------------------KVDIEG------------KSYSPQEISAIILQKLKADAE
DNAK_STRA3       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRA5       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRA1       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRP1       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRP6       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRP8       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRPM       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRP3       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRMU       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRPN       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRR6       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRT1       ---------------------KVSANG------------KEYTPQEISAMILQYLKGYAE
DNAK_STRT2       ---------------------KVSANG------------KEYTPQEISALILQYLKGYAE
DNAK_LACLA       ---------------------KVSANG------------KEYTPQEISAMILQNLKATAE
DNAK_ENTFA       ---------------------KVDVEG------------KSYTPQEVSAMILQYLKGFAE
DNAK_LISMF       ---------------------KETIEG------------KDYSPQEISAIILQYLKSYAE
DNAK_LISMO       ---------------------KETIEG------------KDYSPQEISAIILQYLKSYAE
DNAK_LISIN       ---------------------KETIEG------------KDYSPQEISAIILQYLKSYAE
DNAK_STAAC       ---------------------KVDIEG------------KSYTPQEISAMILQNLKNTAE
DNAK_STAAM       ---------------------KVDIEG------------KSYTPQEISAMILQNLKNTAE
DNAK_STAAN       ---------------------KVDIEG------------KSYTPQEISAMILQNLKNTAE
DNAK_STAAR       ---------------------KVDIEG------------KSYTPQEISAMILQNLKNTAE
DNAK_STAAS       ---------------------KVDIEG------------KSYTPQEISAMILQNLKNTAE
DNAK_STAAW       ---------------------KVDIEG------------KSYTPQEISAMILQNLKNTAE
DNAK_STAES       ---------------------KVDIEG------------KSYTPQELSAMILQNLKSTAE
DNAK_STAEQ       ---------------------KVDIEG------------KSYTPQELSAMILQNLKSTAE
DNAK_STAHJ       ---------------------KVDIEG------------KSYTPQEISAMVLQNLKNTAE
DNAK_STAS1       ---------------------KVDVDG------------KSYTPQEISAMVLQNLKSTAE
DNAK_LACAC       ---------------------KVKVGD------------KSYTPQEISAFILQYIKKFSE
DNAK_LACJO       ---------------------KVKVGD------------KEYTPQEISAFILQYIKKFSE
DNAK_LACSK       ---------------------KVTVGD------------KSYTPQEVSAMILQYIKKFAE
DNAK_LACSS       ---------------------KVTVGD------------KSYTPQEVSAMILQYIKKFAE
DNAK_LACPL       ---------------------KVSIEG------------KDYTPQQISAMILQYIKGFAE
DNAK_ONYPE       ---------------------TVNVGG------------KKYTPQEISAMILANLKKTAE
DNAK_TROWT       ---------------------TKQIGD------------KKYTPQEISARILSKLKRDAE
DNAK_TROW8       ---------------------TKQIGD------------KKYTPQEISARILSKLKRDAE
DNAK_LEIXX       ---------------------TQEIDG------------KKYTAQEISARILQKLKRDAE
DNAK_BIFLO       ---------------------TVDIDG------------KKWTPQEISAQILMKLKRDAE
DNAK_COREF       ---------------------SVAIDD------------KNYTAQEISARILMKLKRDAE
DNAK_CORGL       ---------------------SVAIDD------------KNYTSQEISARTLMKLKRDAE
DNAK_CORDI       ---------------------TIAIDD------------KKYTSQEISARTLMKLKRDAE
DNAK_CORJK       ---------------------KVSIDD------------KEYTAPEISARTLQKLKRDAE
DNAK_MYCLE       ---------------------SIEIDG------------KKYTAQEISARVLMKLKRDAE
DNAK_MYCPA       ---------------------SIEIDG------------KKYTAQEISARVLMKLKRDAE
DNAK_MYCTU       ---------------------SIEIDG------------KKYTAPEISARILMKLKRDAE
DNAK_MYCBO       ---------------------SIEIDG------------KKYTAPEISARILMKLKRDAE
DNAK_NOCFA       ---------------------TVEIDG------------KKYTPQEISARTLMKLKRDAE
DNAK1_STRAW      ---------------------KINLDG------------KDFNPQQMSAFILQKLKRDAE
DNAK_STRCO       ---------------------KVNLDG------------KDFNPQQISAFVLQKLKRDAE
DNAK_THEFY       ---------------------KTHIDG------------KDFTPQQISAFVLQKLKRDAE
DNAK_CUTAK       ---------------------TMGVDD------------KTYKPQQISAFILQKLKRDAE
DNAK_HALMA       ---------------------SVELDG------------EEYTPEQVSAMILQKIKHDAE
DNAK_NATPD       ---------------------TVEVGD------------DEYTPEQISAMILQKIKRDAE
DNAK_HALSA       ---------------------TVALGD------------DEYTPEEISARILQKIKRDAE
DNAK_AGRFC       VEKDKA-LVPFEIVKGDNGDAWVKAQ------------DKNYSPSQISAMILQKMKETAE
DNAK_RHIME       TQKDKG-MVPYKIVKADNGDAWVEAH------------GTSYSPSQISAMILQKMKETAE
DNAK_RHILO       TEKDKK-LVPYKIVKGDNGDAWVEAG------------GKKQSPSQISAMILQKMKETAE
DNAK_BRUME       VTKDKD-LVPYKIVKGDNGDAWVEVH------------GKKYSPSQISAMILQKMKETAE
DNAK_BRUAB       VTKDKD-LVPYKIVKGDNGDAWVEVH------------GKKYSPSQISAMILQKMKETAE
DNAK_BRUSU       VTKDKD-LVPYKIVKGDNGDAWVEVH------------GKKYSPSQISAMILQKMKETAE
DNAK_BARHE       VEKDKA-LVPYKIVKGDNGDAWVEEA------------GKKYSPSQISAMILQKMKETAE
DNAK_BARQU       VEKDKA-LVPYKIVKGDNGDAWVEEA------------GKKYSPSQISAMILQKMKETAE
DNAK_BRADU       VEKDKK-LVPYKIVKASNGDAWVEAD------------GQTYSPSQVSAFILQKMKETAE
DNAK_NITWN       VEKDKQ-LVPYKIAKAGNGDAWVEAD------------GKTYSPSQISAFTLQKMKETAE
DNAK_RHOPA       VEKDKG-LVPYKIVKASNGDAWVEAD------------GKTYSPSQVSAFILQKMKETAE
DNAK_CAUVC       VEKDKG-MVPYEIVKGPTGDAWVKAH------------GKDYSPQEVSAFILQKMKEAAE
DNAK_ZYMMO       TKRDTE-LVPYHIVRGSNGDAWVKAG------------GQDYSPSQISAFILQKMKETAE
DNAK_RHOS4       VEKDKK-LVPYSIVNGGNGDAWVEVR------------GEKYSPSQISAFILQKMKETAE
DNAK_RUEPO       VTKDKK-MVPFTIVNGGNGDAWVEAK------------GEKYSPSQISAVILGKMKETAE
DNAK_RICFE       VRKDQG-LVPYNIVKADNGDAWVEAD------------NNKYSPSQISAFILQKMKETAE
DNAK_RICTY       VRKDQG-LVPYNIVKADNGDAWVEAD------------NNKYSPSQISAFILQKMKETAE
DNAK_RICPR       VRKDQG-LVPYNIVKADNGDAWVEAD------------NHKYSPSQISAFILQKMKETAE
DNAK_RICCN       VRKDQG-IVPYNIVKADNGDAWVEAD------------NNKYSPSQISAFILQKMKETAE
DNAK_PELUB       VKKDIA-AAPFKIVNSEKGDAWIEAK------------GEKYSPSQISAFILQKMKETAE
DNAK_EHRRG       TRDIK---TSYDIVSAKNGDAWIKVR------------DKDYSPSQIGALILEKMKETAE
DNAK_EHRRW       TRDIK---TSYDIVSAKNGDAWIKVR------------DKDYSPSQIGALILEKMKETAE
DNAK_EHRCJ       VKDIK---SSYEVVSAKNGDAWIKVL------------GKEYSPSQIGAFVLEKMKETAE
DNAK_ANAMM       MRDVK---CPYEVFPAKNGDAWIRAR------------GEGYSPVQIGAFVLEKIKETAE
DNAK_WOLPM       MKNLS---VPYKVFAAKSGDAWVKTTD-----------NKEYSPSQIGAFILQNMKEAAE
DNAK_WOLTR       MKDLN---VPYKVFAAKNGDAWIKTTD-----------GKEYSPSQIGAFILQNLKEAAE
DNAK_BORBR       VQKDID-LMPYSIVKADNGDAWVEVRGK------------KLAPPQVSAEVLRKMKKTAE
DNAK_BORPE       VQKDID-LMPYSIVKADNGDAWVEVRGK------------KLAPPQVSAEVLRKMKKTAE
DNAK_BORPA       VQKDID-LMPYSIVKADNGDAWVEVHGK------------KLAPPQVSAEVLRKMKKTAE
DNAK_BURPS       VQKDIG-LMPYAIIKADNGDAWVEAHGE------------KLAPPQVSAEVLRKMKKTAE
DNAK_BURMA       VQKDIG-LMPYAIIKADNGDAWVEAHGE------------KLAPPQVSAEVLRKMKKTAE
DNAK_BURP1       VQKDIG-LMPYAIIKADNGDAWVEAHGE------------KLAPPQVSAEVLRKMKKTAE
DNAK_BURL3       VQKDIG-LMPYTIVKADNGDAWVEAHGE------------KLAPPQVSAEVLRKMKKTAE
DNAK_RALSO       VQKDIG-LMPYTISKADNGDAWVEVRDK------------KMAPPQISAEVLRKMKKTAE
DNAK_CUPPJ       VQKDIG-LMPYSIVKADNGDAWVGVRDQ------------KLAPPQVSAEVLRKMKKTAE
DNAK_AROAE       VQKDID-LMPYTICKADNSDAWVEVRGK------------KIAPPQVSAEVLRKMKKTAE
DNAK_THIDA       VQKDIG-LMPYKIVKADNGDAWVEVRDK------------KMAAQQVSAEILRKMKKTAE
DNAK_DECAR       VQKDIS-LMPFKIVKADNGDAWVEARDK------------KIAPPQVSAEVLRKMKKTAE
DNAK_NITEU       VQKDIS-VTPYKIVRADNNDAWIEARGR------------KIAPPEVSAQVLIKMKKTAE
DNAK_NEIMA       VQRDIE-SMPFEIIKANNGDAWVKAQGK------------ELSPPQISAEVLRKMKEAAE
DNAK_NEIG1       VQRDIE-SMPFEIIKADNGDAWVKAQGK------------ELSPPQISAEVLRKMKEAAE
DNAK_NEIMB       VQRDIE-SMPFEIIKANNGDAWVKAQGK------------ELSPPQISAEVLRKMKEAAE
DNAK_CHRVO       VQKDID-LMPFEILKAKNGDAWVKVRDQ------------ELAPPQISAEVLRKMKKAAE
DNAK_BUCAI       VQRDIK-IMPYNIVNSDNGDAWIDV-KK-----------QKMAPPQISAEVLKKMKKTAE
DNAK_BUCAP       VQRDIK-IMPYSIINSENGDAWIDV-KK-----------QKMAPPQISAEVLKKMKKTAE
DNAK_BUCBP       VQRDIK-IMPYKIIQSENGDAWINI-KN-----------KKLAPPQISAEILKKMKKTAE
DNAK_BLOFL       VQRDVK-IMPYKIISSNNGDAWLDI-KG-----------QKIAPPQISAEILKKMKKTAE
DNAK_BLOPB       VQRDVN-IMPYKIISADNGDAWLDV-KG-----------QKMAPPQVSAEILKKMKKTAE
DNAK_WIGBR       VQRDVN-IMPYKIVSSENGDVWLNV-KN-----------QKVAPPQISAEILKKMKKTAE
DNAK_ECOLI       VQRDVS-IMPFKIIAADNGDAWVEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_ECOL6       VQRDVS-IMPFKIIAADNGDAWVEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_ECO57       VQRDVS-IMPFKIIAADNGDAWVEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_SHIBS       VQRDVS-IMPFKIIAADNGDAWVEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_SHIDS       VQRDVS-IMPFKIIAADNGDAWVEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_SHISS       VQRDVS-IMPFKIIAADNGDAWVEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_SHIFL       VQRDVS-IMPFKIIAADNGDAWVEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_SALTI       VQRDVS-IMPYKIIGADNGDAWLDV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_SALPA       VQRDVS-IMPYKIIGADNGDAWLDV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_SALTY       VQRDVS-IMPYKIIGADNGDAWLDV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_SALCH       VQRDVS-IMPYKIIGADNGDAWLDV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_YERPE       AQRDKD-IMPYKIIAADNGDAWLEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_YERPS       AQRDKD-IMPYKIIAADNGDAWLEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_PHOLL       AQRDVA-IMPYKIIAADNGDAWLEV-KD-----------QKMAPPQVSAEVLKKMKKTAE
DNAK_PECAS       VQRDSN-IMPYKIVAADNGDAWLEV-KD-----------QKMAPPQISAEVLKKMKKTAE
DNAK_PASMU       VQRDVS-IMPFEIVAADNGDAWVGV-KG-----------EKMAPPQISAEVLKKMKKTAE
DNAK_MANSM       VQRDVN-IMPFQIIKADNGDAWVDV-KG-----------DKLAPPQISAEVLKKMKKTAE
DNAK_HAEIN       VQRDIK-IMPFEITRADNGDAWVNV-KG-----------DKLAPPQISAEVLKKMKKTAE
DNAK_HAEI8       VQRDIK-IMPFEITRADNGDAWVNV-KG-----------DKLAPPQISAEVLKKMKKTAE
DNAK_HAEDU       VQRDIE-IMPFEIAKADNGDAWVNV-KG-----------DKLAPPQISAEVLKKMKKTAE
DNAK2_COLP3      TQRDID-IMPFGIVKADNGDAWVQV-KG-----------EKIAPPQVSAEVLKKMKKTAE
DNAK_PSEHT       VQRDIG-IMPFKIVKADNGDAWVEA-GG-----------EKRAAPQISAEILKKMKKTAE
DNAK_SHEON       VQRDVN-IMPFKIIAADNGDAWVES-RG-----------NKMAPPQVSAEILKKMKKTAE
DNAK_VIBVU       VQRDIE-IMPYKIVKADNGDAWVEA-KG-----------QKMAAPQVSAEVLKKMKKTAE
DNAK_VIBVY       VQRDIE-IMPYKIVKADNGDAWVEA-KG-----------QKMAAPQVSAEVLKKMKKTAE
DNAK_VIBPA       VQRDIE-IMPYKIVKADNGDAWVEA-KG-----------QKMAAPQVSAEVLKKMKKTAE
DNAK_VIBCH       VQRDIK-IMPYKIVKADNGDAWVEA-KG-----------QKMAAPQVSAEVLKKMKKTAE
DNAK1_ALIF1      VQRDIE-IMPYKIIKADNGDAWVEA-KG-----------QKMAAPQVSAEILKKMKKTAE
DNAK2_ALIF1      VQRDIE-IMPFKIVKADNGDAWVEA-KG-----------QKMAAPQVSAEVLKKMKKTAE
DNAK1_PHOPR      VQRDLK-IMPFKIVKADNGDAWVEA-KG-----------QKMAAPQVSAEILKKMKKTAE
DNAK2_PHOPR      VQRDIE-IMPFNIVKADNGDAWVEA-KG-----------KKMAAPQVSAEVLKKMKKTAE
DNAK_IDILO       VQRDIG-IMPYKIVKADNGDAWVEI-DG-----------DKKAPPQISAEVLKKMKKTAE
DNAK_XANAC       VQKDIS-HVPYGILAHDNGDAWVQTSDG-----------KRMAPQEISARVLEKMKKTAE
DNAK_XANC5       VQKDIS-HVPYGILAHDNGDAWVQTSDA-----------KRMAPQEISARVLEKMKKTAE
DNAK_XANCP       VQKDIS-HVPYGILAHDNGDAWVQTSDS-----------KRMAPQEISARVLEKMKKTAE
DNAK_XANC8       VQKDIS-HVPYGILAHDNGDAWVQTSDS-----------KRMAPQEISARVLEKMKKTAE
DNAK_XANOR       VQKDIS-HVPYGILAHDNGDAWVQTSDA-----------KRMAPQEISARVLEKMKKTAE
DNAK_XYLFA       VQKDLD-LVPYKITQHDNGDAWVATADA-----------KKLAPQEISAKVLEKMKKTAE
DNAK_XYLFT       VQKDLD-LVPYKITQHDNGDAWVATADG-----------KKLAPQEISAKVLEKMKKTAE
DNAK_PSEPK       VQKDIK-LVPYKIVKANNGDAWVEA-AG-----------KEMAPPQISAEVLKKMKKTAE
DNAK_PSEPF       VQKDIK-LVPYKIVKANNGDAWVEA-SG-----------KQMAPPQISAEVLKKMKKTAE
DNAK_PSE14       VQKDIQ-MVPYKIVKADNGDAWVEV-NG-----------QKMAPPQISAEILKKMKKTAE
DNAK_PSEU2       VQKDIQ-MVPYKIVKADNGDAWVEV-NG-----------QKMAPPQISAEILKKMKKTAE
DNAK_PSESM       VQKDIQ-MVPYKIVKADNGDAWVEV-NG-----------QKMAPPQISAEILKKMKKTAE
DNAK_PSEF5       VQKDIQ-MVPYKIVKADNNDAWVEV-NG-----------QKMAPPQISAEILKKMKKTAE
DNAK_PSEAE       VQKDIQ-MVPYSIVKADNGDAWVEV-KG-----------QKMAPPQISAEVLKKMKKTAE
DNAK_ACIAD       VQKDIG-LVPYKIIKADNGDAWVEV-ND-----------KKLAPQQVSAEILKKMKKTAE
DNAK_PSYA2       VQKDIG-MVPYKIAKADNGDAWVEI-NG-----------KKLAPPQVSAEILKKMKKTAE
DNAK_FRATT       VQEDIKKKVPYAVIKADNGDAWVATKEG-----------KKMAPPQVSAEVLRKMKKTAE
DNAK_LEGPH       VQKDIK-MVPYKIMKADNGDAWVRVKD------------QDKAPPQISAEVLRKMKKTAE
DNAK_LEGPL       VQKDIK-MVPYKIMKADNGDAWVRVKD------------QDKAPPQISAEVLRKMKKTAE
DNAK_LEGPA       VQKDIK-MVPYKIMKADNGDAWVRVKD------------QDKAPPQISAEVLRKMKKTAE
DNAK_COXBU       VQKDIK-MVPYKIIKADNGDAWVEVKDKEGK-------SQKLAPPQISAQVLIKMKKTAE
DNAK_METCA       VQKDIK-MVPYTIVEAENGDAWVEVGG------------KKMAPPEISARVLMKLKKDAE
DNAK_NITOC       VQRDIK-MVPYKIVKADNGDAWVEATG------------KKMAPPEVSANVLRKMKKTAE
DNAK1_COLP3      VQKDIK-LAPYKIVKADNGDAWVEVDGK------------ALSPQEVSAQILRKLKKDAE
DNAK_DESAG       VARWKE-HSPYQIVAGPNGDAYVEIEGR------------KYSPAEVSAMVLAKLKADAE
DNAK_DESVH       VGRWKE-HSPYRIVAGANGDAAVEVQGR------------PYSAPEISAMILGKLKADAE
DNAK_GEOSL       VRKDIS-ISPFKIVKADNGDAWVEARGK------------MYSAPEISAMVLQKMKQTAE
DNAK_PELCD       VRRDIQ-ISPFEIVKADNGDAWVDVRDK------------KYSPPEISAMILQKMKQTAE
DNAK_DESPS       VQRSQE-VSPFDIVEGISGSVAIQVEGH------------KYRPAEISAMVLGKMKQTAE
DNAK_CAMJE       AKEAKN-RLPYHITE-RNGACAIEIAGK------------IYTPQEISAKVLMKLKEDAE
DNAK_CAMJR       AKEAKN-RLPYHITE-RNGACAIEIAGK------------IYTPQEISAKVLMKLKEDAE
DNAK_HELHP       AKEAEK-RLPYNIVD-RNGACAVEIADK------------IYTPQEISAKILMKLKEDAQ
DNAK_WOLSU       AKEAQK-RLPYKVVD-RNGACAVEIADK------------VYTPQEISAKILMKLKEDAE
DNAK_HELPY       AKEAEK-RLPYKIVD-RNGACAIEISGK------------VYTPQEISAKILMKLKEDAE
DNAK_HELPJ       AKEAEK-RLPYKIVD-RNGACAIEISGK------------IYTPQEISAKILMKLKEDAE
DNAK_FUSNN       ---------------------KVEIFGK------------KYTPQEISAKTLQKLKKDAE
DNAK_RHOBA       SEEKMV---PYGITGGPGDYVKIQVGDS------------EYTPQEISAKVLRKLKESAE
DNAK_BACFN       VQKEIA-RVPYKVVKGDNNTPRVDIDG------------RLYTPQEISAMILQKMKKTAE
DNAK_BACFR       VQKEIA-RVPYKVVKGDNNTPRVDIDG------------RLYTPQEISAMILQKMKKTAE
DNAK_BACTN       VQKEVT-RVPYKVVKGDNNTPRVDIDG------------RLYTPQEISAMILQKMKKTAE
DNAK_PORGI       VSREVE-RVPFKVVRGDNNTPRVDIDG------------RLYTPQEISAMILQKMKKTAE
DNAK_CHLTE       VPNEKK-LASYDVVN-EGGYAKVKIGD------------KTYSPQEISAMILQKMKQTAE
DNAK_CHLCH       VGEEKK-MAPYELIN-DSGEARVKIND------------KVYSPQEISAMVLQKMKQTAE
DNAK_BORBU       VASEIK-MVPYKIEKGLNGDARVNISNI----------KKQMSPPEISAATLTKMKETAE
DNAK_BORBP       VASEIK-MVPYKIEKGLNGDARVNISNI----------KKQMSPPEISAATLTKMKETAE
DNAK_TREPA       LTGEAK-KVPYKIVP-QGDDVRVEVEG------------KLYSTQEISAFILQKMKKTAE
DNAK_TREDE       LTDELK-RVPYKIVP-QGEDVRIDIDG------------KLYSTQEISAFILQKMKKTAE
DNAK_LEPIC       CESEMK-HVSYKVIRSGNEGVKFETSA------------GEFTPQEISARVLMKMKQTAE
DNAK_LEPIN       CESEMK-HVSYKVIRSGNEGVKFETSA------------GEFTPQEISARVLMKMKQTAE
DNAK_BDEBA       IQEEIK-LVPYTVVA-KGNDCAFKVQG------------KTASPEEIGAAVLAKLKKVAE
DNAK_CHLAB       VESEIK-TVPYQVASGSNGDVVFPIDG------------KQFTPEEIGAQVLIKMKETAE
DNAK_CHLCV       VESEIK-TVPYKVASGSNGDVVFLVDG------------KQYTPEEIGAQVLIKMKETAE
DNAK_CHLPN       VASEIQ-TVPYTVTSGSKGDAVFEVDG------------KQYTPEEIGAQILMKMKETAE
DNAK_CHLTR       VESEIK-TVPYKVAPNSKGDAVFDVEQ------------KLYTPEEIGAQILMKMKETAE
DNAK_CHLTA       VESEIK-TVPYKVAPNSKGDAVFDVEQ------------KLYTPEEIGAQILMKMKETAE
DNAK_CHLMU       VESEIK-TVPYKVAPNSKGDAVFEVEN------------KLYTPEEIGAQILMKMKETAE
DNAK_PARUW       VLSEIK-TVPYKVTNNNNGDAVFEIQG------------KIVTPEEIAAQILIKMKETAE
DNAK_DEHM1       VEADAK-RKPYKVIQGNNNEVRVVMGD------------KDFSPPEVSAMILQKLKSDAE
DNAK_DEHMC       VEADAK-RKPYKVIQGNNNEVRVVMGD------------KDFSPPEVSAMILQKLKSDAE
DNAK_CLOPE       IDGKD------------------------------------YTPQEISAMILQKLKADAE
DNAK_CLOTE       IDGKE------------------------------------YTPQELSAIILQKLKADAE
DNAK_CLOAB       IDDKN------------------------------------YTPQEISAMILQKLKADAE
DNAK_METAC       LNGKT------------------------------------YTPQEISAMILQKLKTEAE
DNAK_METMA       LNGKD------------------------------------YTPQEISAMILQKLKADAE
DNAK_METBF       LQGTQ------------------------------------YKPQEISAMILQKLKTDAE
DNAK_CALS4       IDDKE------------------------------------YTPQEISAMILQKLKADAE
DNAK_CARHZ       IDDKE------------------------------------YTPQEISAMILQKLKQDAE
DNAK_SYMTH       IDDKA------------------------------------YTPQEISAMILSKLKADAE
DNAK_AQUAE       -------------EEAKRVSYKVVPDEKGDAAFDIPNAGKLVRPEEVGAHVLRKLKEAAE
DNAK_THEMA       ------------------TDYKVRIDDKE------------YTPQEISAFILKKLKNDAE
DNAK_THEAC       ------------------TDYKFKVFDKE------------FTPQQISAFILQKIKKDAE
DNAK_THEVO       ------------------TDYKFKVFDKE------------FTPQQISAFILQKIKKDAE
DNAK_PICTO       ------------------TDYKYKIFGKE------------YTPQQISAFILQKIKRDAE
DNAK_METTH       ------------------TDRKVKVHGKE------------YTPQEISAFILQKIKKDAE
DNAK3_NOSS1      -----RDRVPYGCVKGRDDTVDVQIRGR------------NYTPQEISAMILQKLKQDAE
DNAK1_THEEB      -----RARVPYACVPGRDGMVDVQIRDR------------TYTPQEISAMVLQKLKQDAE
DNAK3_SYNP6      -----RSRVTYTCVPGKDDTVNVTIRDR------------VCTPQEISAMVLQKLRQDAE
DNAK1_NOSS1      ---PESKRVPYTIRKDEVGNIKVACPRL----------NKEFSAEEISAMVLKKLADDAS
DNAK3_SYNY3      ---PESKRVAYTIRRDDRDNIKVRCPRL----------KKDFAPEEISAMILRKLAEEAS
DNAK3_THEEB      ---AESKRVPYTIRRDESGKVRIKCPRL----------QREFAPEEISAMVLRKLVEDAS
DNAK1_SYNP6      ---DESKRVPYTVRRDPEGNVRIVCPQL----------SREFAPEEVAAMILRKLAEEAS
DNAK1_PROMM      ---DSSLSVPYTVRANEQGNVRVSCQVT----------EREYAPEELVASIIRKLVDDAA
DNAK1_SYNPX      ---DSSLAVPYTVRANDRGQVRVPCPVT----------EREYAPEELVASIIRKLVDDAS
DNAK1_PROMA      ---ENSLNVAYTIRANNQGCVRVTCPIT----------EREYAPEELIGSIIRKLIDDAE
DNAK1_PROMP      ---ETSISVPYNVKSNDKGSVRILSPFT----------EREYAPEELISSIIRKLINDAE
DNAK_THET8       ---EEAKRVPYKVVPGPDGGVRVEVK------------GKLYTPEEISAMILRKLVEDAS
DNAK_THET2       ---EEAKRVPYKVVPGPDGGVRVEVK------------GKLYTPEEISAMILRKLVEDAS
DNAK_DEIRA       ---EEAARSPFTVKEGPSGSVRIEVN------------GKDLAPEQVSAEVLRKLVSDAS
DNAK2_NOSS1      ---NEATEVSYKVLSSG-GNVKVDSPGA----------GKQFAPEEISAKVLRKLVEDAS
DNAK2_SYNY3      ---NEATEVAYSVVKDGNGNVKLDCPAQ----------GKQFAPEEISAQVLRKLVDDAS
DNAK2_THEEB      ---HEATEVSYKVLNVN-GNVKLDCPAL----------GKQFAPEEISAQVLRKLKEDAS
DNAK2_PROMA      ---EESKEVSYSVEKSG-SSVKLKCPVL----------DKQFSPEEVAAQVLRKLSEDAG
DNAK_PROMT       ---DESKEVSYGVEKAG-SNVKIKCPIL----------DKQFSPEEVSAQVLRKLSDDAG
DNAK2_PROMP      ---EESKEVSYGIEKAG-SNVKLKCPVL----------DKQFSPEEVSAQVLRKLSEDAG
DNAK2_PROMM      ---EESKEVSYEVEKSG-SNVRLKCPVL----------DKQFSPEEVSAQVLRKLAEDAG
DNAK2_SYNPX      ---EESKEVSYGVEKAG-SNVKVKCPVL----------DKQFAPEEVSAQVLRKLAEDAG
DNAK2_SYNP6      ---NELTEVAYKVDTSG-NAVKLDSSNA----------GKQFAPEEISAQVLRKLAEDAS
DNAK_GLOVI       ---DEAKQVAYRVVRDG-SNVKLHSTNE----------DKDFAPEEISALVLRKLVDDAS
DNAK2_STRAW      ---DEARAVTYDVVEGDGGAARFK--VR----------DKLYAPEEISAQVLRKLADDAS
                                                            . :: .  :  :   : 

DNAK_MYCH7       KKIGHKVTKAVITVPAYFDNAQREATKNAGKIAGLQVERIINEPTAAALAFGLDKT---E
DNAK_MYCHJ       KKIGHKVTKAVITVPAYFDNAQREATKNAGKIAGLQVERIINEPTAAALAFGLDKT---E
DNAK_MYCPU       KKVGKKLTKAVITVPAYFDNSQREATKIAGKIAGLDVLRIINEPTAAALSFGLDKK---E
DNAK_MYCMO       KKIGSKIKKAVITVPAYFNNAQREATKTAGRIAGLSVERIINEPTAAALAFGLDKT---D
DNAK_MYCS5       KKLGQKVSKAVITVPAYFDNAEREATKNAGRIAGLEVLRIINEPTAAALAFGLDK----N
DNAK_MYCHO       KKLGQPVKKAVITVPAYFDNAQREATKNAGIIAGLDVVRIINEPTAAALAFGLNKDK--N
DNAK_UREPA       KKIGAKVNKAVITVPAYFDDAQRQATKNAGIIAGLSVERIINEPTAAALAYGIDKL---D
DNAK_MYCGE       KKIGKKISRAVITVPAYFNDAERNATKTAGKIAGLNVERIINEPTAAALAYGIDKA---S
DNAK_MYCPN       KKIGKTISRAVITVPAYFNDAERNATKTAGKIAGLNVERIINEPTAAALAYGIDKS---N
DNAK_MYCGA       KKTGQKISRAVITVPAYFNDAERQATKTAGKIAGLTVERIINEPTAAALAYGIDKG---H
DNAK_MYCPE       EKLGQTITKAVITVPAYFNDAERNATKNAGKIAGLEVERIINEPTAAALAYGMDKS---K
DNAK_MESFL       EKVGEKITKAVITVPAYFNDSQRKATKDAGKIAGLDVERIINEPTAAALAYGLEKK---D
DNAK_MYCMS       AKLGQKVTKAVITVPAYFNDAQRKATKDAGTIAGLQVERIINEPTAAALAYGLDKQ---D
DNAK_BACAN       AYLGETVTKAVITVPAYFNDAERQATKDAGRIAGLEVERIINEPTAAALAYGLEKQ---D
DNAK_BACCZ       AYLGETVTKAVITVPAYFNDAERQATKDAGRIAGLEVERIINEPTAAALAYGLEKQ---D
DNAK_BACHK       AYLGETVTKAVITVPAYFNDAERQATKDAGRIAGLEVERIINEPTAAALAYGLEKQ---D
DNAK_BACCR       AYLGETVTKAVITVPAYFNDAERQATKDAGRIAGLEVERIINEPTAAALAYGLEKQ---D
DNAK_BACC1       AYLGETVTKAVITVPAYFNDAERQATKDAGRIAGLEVERIINEPTAAALAYGLEKQ---D
DNAK_BACSU       SYLGETVSKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---D
DNAK_BACLD       SYLGETVSKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---E
DNAK_GEOKA       DYLGEPVTRAVITVPAYFNDAQRQATKDAGRIAGLEVERIINEPTAAALAYGLDK----E
DNAK_OCEIH       DYIGEKVEKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGIDKE---D
DNAK_BACHD       AYLGEEVTKAVITVPAYFNDSQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDK----E
DNAK_BACSK       AYLGEKVTKAVITVPAYFNDSQRQATKDAGKIAGLEVDRIVNEPTAAALAYGLEK----E
DNAK_STRA3       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKT---D
DNAK_STRA5       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKT---D
DNAK_STRA1       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKT---D
DNAK_STRP1       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKT---D
DNAK_STRP6       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKT---D
DNAK_STRP8       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKT---D
DNAK_STRPM       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKT---D
DNAK_STRP3       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKT---D
DNAK_STRMU       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKT---D
DNAK_STRPN       DYLGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKT---D
DNAK_STRR6       DYLGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKT---D
DNAK_STRT1       EYLGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKT---D
DNAK_STRT2       EYLGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKT---D
DNAK_LACLA       AYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKT---D
DNAK_ENTFA       DYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKT---D
DNAK_LISMF       DYLGETVDKAVITVPAYFNDAQRQATKDAGKIAGLEVERIINEPTAAALAYGMDKT---E
DNAK_LISMO       DYLGETVDKAVITVPAYFNDAQRQATKDAGKIAGLEVERIINEPTAAALAYGMDKT---E
DNAK_LISIN       DYLGETVDKAVITVPAYFNDAQRQATKDAGKIAGLEVERIINEPTAAALAYGMDKT---E
DNAK_STAAC       SYLGEKVDKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---D
DNAK_STAAM       SYLGEKVDKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---D
DNAK_STAAN       SYLGEKVDKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---D
DNAK_STAAR       SYLGEKVDKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---D
DNAK_STAAS       SYLGEKVDKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---D
DNAK_STAAW       SYLGEKVDKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---D
DNAK_STAES       NYLGDTVDKAVITVPAYFNDGERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---E
DNAK_STAEQ       NYLGDTVDKAVITVPAYFNDGERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---E
DNAK_STAHJ       SYLGDKVDKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---D
DNAK_STAS1       DYLGESVDKAVITVPAYFNDSERQATKDAGKIAGLEVERIINEPTAAALAYGLDKT---E
DNAK_LACAC       DYLGEEVKDAVITVPAYFNDAQRQATKDAGKIAGLNVQRIINEPTASALAYGLDKD---D
DNAK_LACJO       DYLGEKVTDAVITVPAYFNDAQRQATKDAGKIAGLNVQRIINEPTASALAYGLDKD---E
DNAK_LACSK       DYLGEEVTEAVITVPAYFNDSQRQATKDAGKIAGLDVKRIINEPTASALAYGLDKT---E
DNAK_LACSS       DYLGEEVTEAVITVPAYFNDSQRQATKDAGKIAGLDVKRIINEPTASALAYGLDKT---E
DNAK_LACPL       DYLGDTVEKAVVTVPAYFNDAQRQATKDAGKIAGLNIERIINEPTAAALAYGLDKT---D
DNAK_ONYPE       DYLGAQVSEAVITVPAYFNDAQRQATKDAGKIAGLNVKRIINEPTAAALSYGVDKG---D
DNAK_TROWT       QYLGEKVTDAVITVPAYFNDAERQATKEAGEIAGLNVLRIINEPTAAALAYGLDKG---K
DNAK_TROW8       QYLGEKVTDAVITVPAYFNDAERQATKEAGEIAGLNVLRIINEPTAAALAYGLDKG---K
DNAK_LEIXX       QYLGDTVTDAVITVPAYFNDAERQATKEAGEIAGLNVLRIINEPTAAALAYGLDKG---K
DNAK_BIFLO       AYLGEPVTDAVITCPAYFNDAQRQATKDAGKIAGLNVLRIINEPTAAALAYGLEKG---K
DNAK_COREF       AYLGEEVTDAVITVPAYFEDSQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLEKG---E
DNAK_CORGL       AYLGEDVTDAVITVPAYFEDSQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLEKG---E
DNAK_CORDI       AYLGEDVTDAVITVPAYFSDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLEKG---E
DNAK_CORJK       SYLGEDVTDAVITVPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLEKG---D
DNAK_MYCLE       AYLGEDITDAVITTPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLDKG---E
DNAK_MYCPA       AYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLDKG---E
DNAK_MYCTU       AYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLDKG---E
DNAK_MYCBO       AYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLDKG---E
DNAK_NOCFA       AYLGEEITDAVITVPAYFEDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLDKG---D
DNAK1_STRAW      AYLGEKVTDAVITVPAYFNDSERQATKEAGEIAGLNVLRIVNEPTAAALAYGLDKD----
DNAK_STRCO       SYLGEKVTDAVITVPAYFNDAERQATKEAGEIAGLNVLRIVNEPTAAALAYGLDKD----
DNAK_THEFY       AYLGEEVTDAVITVPAYFSDAERQATKDAGKIAGLNVLRIINEPTSAALAYHLEKE---G
DNAK_CUTAK       AYLGEPVTNAVITVPAYFSDAQRQATKEAGEIAGLAVDRIVNEPTAAALAYGLDKT---D
DNAK_HALMA       EYLGDEIEKAVITVPAYFNDRQRQATKDAGEIAGFEVERIVNEPTAAAMAYGLDDE---S
DNAK_NATPD       EYLGDDIEKAVITVPAYFNDRQRQATKDAGEIAGFEVERIVNEPTAAAMAYGLDDE---S
DNAK_HALSA       EYLGQDVEKAVITVPAYFNDRQRQATKDAGEIAGFDVERIVNEPTAASMAYGLDED---R
DNAK_AGRFC       SYLGEKVEKAVITVPAYFNDAQRQATKDAGRIAGLDVLRIINEPTAAALAYGLDKKE---
DNAK_RHIME       SYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLDVLRIINEPTAAALAYGLDKKE---
DNAK_RHILO       AYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKD---
DNAK_BRUME       SYLGETVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKSE---
DNAK_BRUAB       SYLGETVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKSE---
DNAK_BRUSU       SYLGETVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKSE---
DNAK_BARHE       SYLGEKVEQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKD---
DNAK_BARQU       SYLGEKVEQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKD---
DNAK_BRADU       AHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKTK---
DNAK_NITWN       AHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKSK---
DNAK_RHOPA       AHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKAK---
DNAK_CAUVC       AHLGEPVTKAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKND---
DNAK_ZYMMO       SYLGETVDQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKND---
DNAK_RHOS4       AYLGESVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKD---
DNAK_RUEPO       SYLGEEVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKN---
DNAK_RICFE       NYLGEKVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGFEKSS---
DNAK_RICTY       NYLGEKVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGFEKSS---
DNAK_RICPR       NYLGEKVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGFEKSS---
DNAK_RICCN       NYLGDKVTQAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGFEKSA---
DNAK_PELUB       KYLGQEVTKAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAASLAYGLDKKQ---
DNAK_EHRRG       RHLGCKVEKAVITVPAYFDDAQRQATKDAGKIAGLDVIRIINEPTAAALAYGLNKSD---
DNAK_EHRRW       RHLGCKVEKAVITVPAYFDDAQRQATKDAGRIAGLDVIRIINEPTAAALAYGLNKSD---
DNAK_EHRCJ       RHLGHKVEKAVITVPAYFNDAQRQATKDAGKIAGLDVIRIINEPTAAALAYGLNKSD---
DNAK_ANAMM       RYFGAPVKKAVITVPAYFNDAQRQATKDAGTIAGLDVVRIINEPTAAALAYGLDKGD---
DNAK_WOLPM       AYLGEEVKDAVITVPAYFNDSQRQATKDAGKIAGLNVLRIVNEPTAAALAYGLDKKH---
DNAK_WOLTR       AYLGEEVKDAVITVPAYFNDSQRQATKDAGKIAGLNVLRIVNEPTAAALAYGLDKKH---
DNAK_BORBR       DYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKTE--K
DNAK_BORPE       DYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKTE--K
DNAK_BORPA       DYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKTE--K
DNAK_BURPS       DYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKAE--K
DNAK_BURMA       DYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKAE--K
DNAK_BURP1       DYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKAE--K
DNAK_BURL3       DYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKVE--K
DNAK_RALSO       DYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAFGLDKNE--K
DNAK_CUPPJ       DYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAFGMDKNE--K
DNAK_AROAE       DYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGMDKKP---
DNAK_THIDA       DYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGMDKKE---
DNAK_DECAR       DYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGMDKTS--K
DNAK_NITEU       DYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLDKKE---
DNAK_NEIMA       AYLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAFGMDKGD--N
DNAK_NEIG1       AYLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAFGMDKGD--N
DNAK_NEIMB       AYLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAFGMDKGD--N
DNAK_CHRVO       DYLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAFGLAKQE--G
DNAK_BUCAI       DYLGETIKEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGK---
DNAK_BUCAP       DYLGESIKEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGE---
DNAK_BUCBP       DYLGESIQEAVITVPAYFNDAQRQATKDAGRIAGLKVKRIINEPTAAALAYGLDKGK---
DNAK_BLOFL       DYLGENVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKEA--H
DNAK_BLOPB       DYLGEQISEAVITVPAYFNDAQRQATKDSGRIAGLEVKRIINEPTAAALAYGLDKET--R
DNAK_WIGBR       DYIGKSITEAVITVPAYFNDTQRQATKDAGKIAGLDVKRIINEPTAAALAYGLDKKT---
DNAK_ECOLI       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGT---
DNAK_ECOL6       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGT---
DNAK_ECO57       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGT---
DNAK_SHIBS       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGT---
DNAK_SHIDS       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGT---
DNAK_SHISS       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGT---
DNAK_SHIFL       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGT---
DNAK_SALTI       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKEV---
DNAK_SALPA       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKEV---
DNAK_SALTY       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKEV---
DNAK_SALCH       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKEV---
DNAK_YERPE       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKEV---
DNAK_YERPS       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKEV---
DNAK_PHOLL       DYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDREV---
DNAK_PECAS       DYLGETITEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKEV---
DNAK_PASMU       DFLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGQ---
DNAK_MANSM       DFLGETVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGK---
DNAK_HAEIN       DFLGESVTEAVITVPAYFNDAQRQATIDAGKIAGLDVKRIINEPTAAALAFGLGSSK---
DNAK_HAEI8       DFLGESVTEAVITVPAYFNDAQRQATIDAGKIAGLDVKRIINEPTAAALAFGLGSSK---
DNAK_HAEDU       DFLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDSKK---
DNAK2_COLP3      DFLGETVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKQE---
DNAK_PSEHT       DFLGEAVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKNR---
DNAK_SHEON       DFLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGIDKKQ---
DNAK_VIBVU       DFLGEEVTGAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKQG---
DNAK_VIBVY       DFLGEEVTGAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKQG---
DNAK_VIBPA       DFLGEEVTGAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKKG---
DNAK_VIBCH       DFLGEPVTAAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKQG---
DNAK1_ALIF1      DFLGEEVTGAVVTVPAYFNDAQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKKG---
DNAK2_ALIF1      DFLGEEVTGAVVTVPAYFNDAQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKKG---
DNAK1_PHOPR      DFLGEEVTAAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKKG---
DNAK2_PHOPR      DYLGEEVTGAVITVPAYFNDAQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKQG---
DNAK_IDILO       EFLGEKVTDAVITVPAYFNDAQRQATKDAGKIAGLNVKRIINEPTAAALAYGMDKKS---
DNAK_XANAC       DFLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKNG---
DNAK_XANC5       DFLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKNG---
DNAK_XANCP       DFLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKNG---
DNAK_XANC8       DFLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKNG---
DNAK_XANOR       DYLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKKG---
DNAK_XYLFA       DFLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKKG---
DNAK_XYLFT       DFLGEKVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKKG---
DNAK_PSEPK       DYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGMDKAK---
DNAK_PSEPF       DYLGEAVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGMDKAK---
DNAK_PSE14       DYLGEAVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGMDKAK---
DNAK_PSEU2       DYLGEAVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGMDKAK---
DNAK_PSESM       DYLGEAVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGMDKAK---
DNAK_PSEF5       DYLGEAVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGMDKAK---
DNAK_PSEAE       DYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKAK---
DNAK_ACIAD       DYLGETVTEAVITVPAYFNDAQRQATKDAGRIAGLDVKRIINEPTAAALAFGMDKKE---
DNAK_PSYA2       DYLGEAVTEAVVTVPAYFNDSQRQATKDAGKIAGLDVKRIINEPTAAALAYGMDKKQ---
DNAK_FRATT       DYLGEPVTEAVITVPAYFNDSQRQATKDAGKIAGLEVKRIINEPTAAALAYGVDSKK---
DNAK_LEGPH       DYLGEEVKEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKKR---
DNAK_LEGPL       DYLGEEVKEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKKR---
DNAK_LEGPA       DYLGEEVKEAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDKKR---
DNAK_COXBU       DYLGHEVKDAVITVPAYFNDSQRQATKDAGKIAGLNVKRIINEPTAAALAYGMDKKK---
DNAK_METCA       AYLGEEVKEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGMDKSR---
DNAK_NITOC       DYLGEEVEAAVITVPAYFNDSQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKKR---
DNAK1_COLP3      AYLGETVTDAVITVPAYFNDSQRQATKDAGKIAGLNVKRIINEPTAAALAYGVDKNS--N
DNAK_DESAG       AYLGETVTEAVITVPAYFNDSQRQSTKDAGRIAGLDVKRIINEPTAASLAYGFDKKA---
DNAK_DESVH       AYLGETVTEAVITVPAYFNDAQRQATKDAGRIAGLDVKRIINEPTAASLAYGFDRKA---
DNAK_GEOSL       DYLGETVTDAVITVPAYFNDSQRQATKDAGKIAGLNVLRIINEPTAAALAYGLDKKK---
DNAK_PELCD       DYLGEKVTDAVITVPAYFNDSQRQATKDAGKISGLNVLRIINEPTAASLAYGLDKKS---
DNAK_DESPS       EYLGEEVTEAVVTVPAYFNDSQRQATKDAGKIAGLDVKRIINEPTAASLAYGLDKKV---
DNAK_CAMJE       AFLGESVTDAVITVPAYFNDAQRKATKEAGTIAGLNVLRIINEPTSAALAYGLDKKD---
DNAK_CAMJR       AFLGESVVDAVITVPAYFNDAQRKATKEAGTIAGLNVLRIINEPTSAALAYGLDKKD---
DNAK_HELHP       SYLGEDVTEAVITVPAYFNDSQRKATKEAGTIAGLNVLRIINEPTSAALAYGLDKKE---
DNAK_WOLSU       AYLGEEVSEAVITVPAYFNDAQRKATKEAGTIAGLNVLRIINEPTSAALAYGLDKKH---
DNAK_HELPY       SYLGESVTEAVITVPAYFNDSQRKATKEAGTIAGLNVLRIINEPTSAALAYGLDKKE---
DNAK_HELPJ       SYLGESVTEAVITVPAYFNDSQRKATKEAGTIAGLNVLRIINEPTSAALAYGLDKKE---
DNAK_FUSNN       AYLGEEVKEAVITVPAYFTDSQRQATKDAGTIAGLDVKRIINEPTAAALAYGLEKKK---
DNAK_RHOBA       SYLGHKVNKAVITVPAYFNDAQRQATKDAGQIAGLEVARIINEPTAAALAYGLDKKK---
DNAK_BACFN       DYLGQEVTEAVITVPAYFSDSQRQATKEAGQIAGLEVKRIVNEPTAAALAYGLDKA--H-
DNAK_BACFR       DYLGQEVTEAVITVPAYFSDSQRQATKEAGQIAGLEVKRIVNEPTAAALAYGLDKA--H-
DNAK_BACTN       DYLGQEVTEAVITVPAYFSDSQRQATKEAGQIAGLEVKRIVNEPTAAALAYGLDKA--H-
DNAK_PORGI       DYLGQEVTEAVITVPAYFNDAQRQATKEAGEIAGLKVRRIVNEPTAASLAYGLDKS--N-
DNAK_CHLTE       DFLGEKVTEAVITVPAYFNDAQRQATKDAGKIAGLEVKRIINEPTAAALAYGLDKK--K-
DNAK_CHLCH       DFLGEKVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKK--N-
DNAK_BORBU       AYLGEKVTEAVITVPAYFNDAQRQATKDAGKIAGLEVKRIVNEPTAAALAYGIEK---K-
DNAK_BORBP       AYLGEKVTEAVITVPAYFNDAQRQATKDAGKIAGLEVKRIVNEPTAAALAYGIEK---K-
DNAK_TREPA       DYLGEAVTEAVITVPAYFNDAQRQATKDAGKIAGLDVKRIINEPTAASLAFGFNKD-SK-
DNAK_TREDE       DYLGETVTEAVITVPAYFNDAQRQATKDAGKIAGLEVKRIINEPTAASLAFGFNKD-SK-
DNAK_LEPIC       DYLGQKVTKAVITVPAYFNDEQRQATKDAGRIAGLEVERIINEPTAAALAYGFDK--KN-
DNAK_LEPIN       DYLGQKVTKAVITVPAYFNDEQRQATKDAGRIAGLEVERIINEPTAAALAYGFDK--KN-
DNAK_BDEBA       DYLGEPVTEAVVTVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGMDK---K-
DNAK_CHLAB       AYLGEPVTEAVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKA----
DNAK_CHLCV       AYLGEPVTEAVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKA----
DNAK_CHLPN       AYLGETVTEAVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKV----
DNAK_CHLTR       AYLGETVTEAVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKE----
DNAK_CHLTA       AYLGETVTEAVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKE----
DNAK_CHLMU       AYLGETVTEAVITVPAYFNDSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKE----
DNAK_PARUW       AYLGEKITEAVITVPAYFNDSQRQSTKDAGRIAGLDVKRIIPEPTAAALAYGLDKEN---
DNAK_DEHM1       AYLGEKVTEAVITVPAYFNDAQRQATKDAGAIAGLKVLRIINEPTAAALAYGLDKK----
DNAK_DEHMC       AYLGEKVTEAVITVPAYFNDAQRQATKDAGAIAGLKVLRIINEPTAAALAYGLDKK----
DNAK_CLOPE       AYLGEKVTEAVITVPAYFNDAERQATKDAGRIAGLDVKRIINEPTAASLAYGLDKMD---
DNAK_CLOTE       AYLGGTVTQAVITVPAYFNDSQRQATKDAGRIAGLEVLRIINEPTAASLAYGLDKMD---
DNAK_CLOAB       AYLGETVTQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAASLAYGLDKMD---
DNAK_METAC       AYLGETIKQAVITVPAYFNDAQRQATKDAGSIAGLEVLRIINEPTAASLAYGLDKGD---
DNAK_METMA       AYLGETIKQAVITVPAYFNDSQRQATKDAGAIAGLEVLRIINEPTAASLAYGLDKGD---
DNAK_METBF       AYLGETIKQAVITVPAYFNDAQRQATKDAGAIAGLDVLRIINEPTSASLAYGLDKGD---
DNAK_CALS4       AYLGEKVTQAVITVPAYFNDSQRQATKDAGRIAGLEVLRIINEPTAAALAYGLDK-E---
DNAK_CARHZ       AYLGEKIEKAVITVPAYFTDAQRQATKDAGRIAGLEVLRIINEPTAAALAYGLDK-E---
DNAK_SYMTH       EKLGEKITQAVITVPAYFTDAQRQATKDAGTIAGLEVLRIINEPTAAALAYGLDK-G---
DNAK_AQUAE       AFLGEPVKKAVITVPAYFNERQRQATKDAGKIAGLEVVRILNEPTAAAMAYGLHKKD---
DNAK_THEMA       AYLGGEIKKAVITCPAYFNDAQRQATKEAGIIAGLEVLRIINEPTAAALAYGLDKAG---
DNAK_THEAC       AFLGEPVNEAVITVPAYFNDNQRQATKDAGTIAGFDVKRIINEPTAAALAYGVDKSG---
DNAK_THEVO       AFLGEPVNEAVITVPAYFNDNQRQATKDAGTIAGFDVKRIINEPTAAALAYGVDKSG---
DNAK_PICTO       AFLGEPVTDAVITVPAYFNDNQRQATKDAGAIAGLNVRRIINEPTAACLAYGIDKLN---
DNAK_METTH       AFLGEEIKKAVITVPAYFDDNQRTATKDAGTIAGLDVVRLVNEPTAASLAYGLDKED---
DNAK3_NOSS1      NFLGEAVTQAVITVPAYFTDAQRQATKDAGTIAGLEVLRIINEPTAAALAFGLEKQD---
DNAK1_THEEB      AYLGEPVTQAVITVPAYFSDAQRQATKDAGAIAGLEVLRIINEPTAASLAYGIDKQD---
DNAK3_SYNP6      TFLGEPVTQAVITVPAYFTDAQRQATKDAGAIAGLKVLRIVNEPTAAALSYGLDKLH---
DNAK1_NOSS1      AYLGSAVTGAVITVPAYFNDSQRQATRDAGRIAGLEVLRILNEPTAASLAYGLDRGD---
DNAK3_SYNY3      RYLGEKVTGAVITVPAYFNDSQRQATRDAGKIAGLEVLRIINEPTAASLAYGLDQGR---
DNAK3_THEEB      RYLGEPVTDAVITVPAYFNDSQRQATRDAGRIAGLNVRRIINEPTAAALAYGLDRQQ---
DNAK1_SYNP6      RYLGEPVTGAVITVPAYFNDSQRQATRDAGRIAGLEVKRILNEPTAASLAYGLDRRD---
DNAK1_PROMM      TYLGEPVEAAVVTVPAYFNDAQRQATRDAGRLAGITVERILNEPTAAALAYGFDRSA---
DNAK1_SYNPX      TYLGESVEAAVVTVPAYFNDAQRQATRDAGRLAGIAVERILNEPTAAALAYGFDRSA---
DNAK1_PROMA      KYLSETIDSAVITVPAYFNDSQRQATKDAALLAGVRVERILNEPTAAALAYGFDKSS---
DNAK1_PROMP      TYLGDTIDSAVITVPAYFNESQRQATKDSAVLAGIKVDRILNEPTAAALAYGFEKSS---
DNAK_THET8       KKLGEKITKAVITVPAYFNNAQREATANAGRIAGLEVLRIINEPTAAALAYGLDKKG---
DNAK_THET2       KKLGEKITKAVITVPAYFNNAQREATANAGRIAGLEVLRIINEPTAAALAYGLDKKG---
DNAK_DEIRA       AKLGNKITDAVITVPAYFDNSQREATRQAGEIAGLNVLRVINEPTAAALAYGLERKG---
DNAK2_NOSS1      KYLGETVTQAVITVPAYFNDSQRQATKDAGKIAGIEVMRIINEPTAASLAYGFDKKS---
DNAK2_SYNY3      KYLGETVTQAVITVPAYFNDSQRQATKDAGKIAGIEVLRIINEPTAASLAYGLDKKD---
DNAK2_THEEB      KYLGEEVTQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAASLAYGLDKKA---
DNAK2_PROMA      KYLGENINQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDRKS---
DNAK_PROMT       KYLGETVTQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKS---
DNAK2_PROMP      KYLGENITQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKS---
DNAK2_PROMM      KYLGENVTQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKS---
DNAK2_SYNPX      KYLGETVTQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKS---
DNAK2_SYNP6      KYLGETVTQAVIPVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKS---
DNAK_GLOVI       KYLGEKITQAVITVPAYFNDSQRQATKDAGRIAGIEVLRIINEPTAAALAYGLDKKA---
DNAK2_STRAW      KQLGERVTEAVITVPAYFNDAQRTATKDAGRIAGLEVLRIINEPTAAALAYGMDKKE---
                    .  :  **:. **** : :* :*  :. ::*. : *:: ***::.::: .       

DNAK_MYCH7       KEMKVLVYDLGGGTFDVSVLELS--------GGTFEVLSTSGDNHLGGDDWDNEIVNWLV
DNAK_MYCHJ       KEMKVLVYDLGGGTFDVSVLELS--------GGTFEVLSTSGDNHLGGDDWDNEIVNWLV
DNAK_MYCPU       KEMKVLVYDLGGGTFDVSVLELE--------NGTFEVLSTSGDNHLGGDDWDHVIVEWLT
DNAK_MYCMO       KEQKILVYDLGGGTFDVSVLELA--------NGTFEVLSTSGDNFLGGDDWDNEIVKWLI
DNAK_MYCS5       KAMKVLVYDLGGGTFDVSVLDLE--------DGTFEVLSTSGDNHLGGDDWDNEIVKWLT
DNAK_MYCHO       ENQKILVFDLGGGTFDVSLLEME--------SGTFEVLATAGDNHLGGDDWDHEIVKWMV
DNAK_UREPA       KEQKILVFDLGGGTFDVSVLDMA--------DGTFEVLSTSGDNHLGGDDWDQVIINWLL
DNAK_MYCGE       REMKVLVYDLGGGTFDVSLLDIA--------EGTFEVLATAGDNRLGGDDWDNKIIEYIS
DNAK_MYCPN       REMKVLVYDLGGGTFDVSLLDIA--------EGTFEVLATAGDNRLGGDDWDNKIIEFIL
DNAK_MYCGA       REMKVLVYDLGGGTFDVSLLDIA--------DGTFEVMATAGDNRLGGDDWDNKIIEWII
DNAK_MYCPE       TEHKVLVYDLGGGTFDVSILEIA--------DGTFEVLSTSGDNHLGGDDWDQKIINWIV
DNAK_MESFL       KEEKVLVYDLGGGTFDVSILELA--------DGTFEVLSTSGDNKLGGDNFDTQIINWLI
DNAK_MYCMS       KEETILVYDLGGGTFDVSILAIG--------GGSFDVIATSGNNKLGGDNFDEEIIKWLL
DNAK_BACAN       EEQKILVYDLGGGTFDVSILELA--------DGTFEVISTAGDNRLGGDDFDQVIIDHLV
DNAK_BACCZ       EEQKILVYDLGGGTFDVSILELA--------DGTFEVISTAGDNRLGGDDFDQVIIDHLV
DNAK_BACHK       EEQKILVYDLGGGTFDVSILELA--------DGTFEVISTAGDNRLGGDDFDQVIIDHLV
DNAK_BACCR       EEQKILVYDLGGGTFDVSILELA--------DGTFEVISTAGDNRLGGDDFDQVIIDHLV
DNAK_BACC1       EEQKILVYDLGGGTFDVSILELA--------DGTFEVISTAGDNRLGGDDFDQVIIDHLV
DNAK_BACSU       EDQTILVYDLGGGTFDVSILELG--------DGVFEVRSTAGDNRLGGDDFDQVIIDHLV
DNAK_BACLD       EDQTILVYDLGGGTFDVSILELG--------DGVFEVRSTAGDNRLGGDDFDQVIIDHLV
DNAK_GEOKA       EDQTILVYDLGGGTFDVSILELG--------DGVFEVKATAGDNHLGGDDFDQVIIDYLV
DNAK_OCEIH       QDQTILVYDLGGGTFDVSILDIG--------DGTFEVVSTAGDNRLGGDDFDQVIIDHMV
DNAK_BACHD       DDQTILVYDLGGGTFDVSILELG--------DGFFEVKATSGDNKLGGDDFDQVIIDHLI
DNAK_BACSK       DDQTILVYDLGGGTFDVSILELG--------DGFFEVKATSGDNKLGGDDFDEVIMDHLV
DNAK_STRA3       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDFLV
DNAK_STRA5       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDFLV
DNAK_STRA1       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDFLV
DNAK_STRP1       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDFLV
DNAK_STRP6       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDFLV
DNAK_STRP8       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDFLV
DNAK_STRPM       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDFLV
DNAK_STRP3       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDFLV
DNAK_STRMU       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDNFDQKVIDWLV
DNAK_STRPN       KEEKILVFDLGGGTFDVSILELG--------DGVFDVLSTAGDNKLGGDDFDQKIIDHLV
DNAK_STRR6       KEEKILVFDLGGGTFDVSILELG--------DGVFDVLSTAGDNKLGGDDFDQKIIDHLV
DNAK_STRT1       KEEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDYMV
DNAK_STRT2       KEEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGDNKLGGDDFDQKIIDYMV
DNAK_LACLA       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLATAGNNKLGGDDFDQKIIDWMV
DNAK_ENTFA       KDEKILVFDLGGGTFDVSILELG--------DGVFDVLSTAGDNNLGGDDFDNKIIDYMV
DNAK_LISMF       TDQTILVFDLGGGTFDVSILELG--------DGVFEVHSTAGDNELGGDDFDKKIIDYLV
DNAK_LISMO       TDQTILVFDLGGGTFDVSILELG--------DGVFEVHSTAGDNELGGDDFDKKIIDYLV
DNAK_LISIN       TDQTILVFDLGGGTFDVSILELG--------DGVFEVHSTAGDNELGGDDFDKKIIDYLV
DNAK_STAAC       KDEKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDYLV
DNAK_STAAM       KDEKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDYLV
DNAK_STAAN       KDEKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDYLV
DNAK_STAAR       KDEKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDYLV
DNAK_STAAS       KDEKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDYLV
DNAK_STAAW       KDEKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDYLV
DNAK_STAES       TDQKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDYLV
DNAK_STAEQ       TDQKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDYLV
DNAK_STAHJ       QDQKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDYLV
DNAK_STAS1       QDQKVLVFDLGGGTFDVSILELG--------DGVFEVLSTAGDNKLGGDDFDQVIIDHLV
DNAK_LACAC       DDEKVLVYDLGGGTFDVSVLQLG--------DGVFQVLSTNGDTHLGGDDFDNRIMDWLI
DNAK_LACJO       NDEKVLVYDLGGGTFDVSILQLG--------DGVFQVLSTNGDTHLGGDDFDQRIMDWLI
DNAK_LACSK       TDEKVLVYDLGGGTFDVSVLELG--------DGVFQVLSTNGDTRLGGDDFDEAIMNWLV
DNAK_LACSS       TDEKVLVYDLGGGTFDVSVLELG--------DGVFQVLSTNGDTRLGGDDFDEAIMNWLV
DNAK_LACPL       KDEKILVYDLGGGTFDVSILELG--------DGVFEVLSTNGDTHLGGDDFDQKIIDWLV
DNAK_ONYPE       KEQTILVFDLGGGTFDVSILTLV--------DGTFEVLSTSGDNALGGDDFDLRIVDFLV
DNAK_TROWT       EDELILVFDLGGGTFDVSLLEVGKDDD----FSTIQVRATSGDNRLGGDDWDQRIIDWLV
DNAK_TROW8       EDELILVFDLGGGTFDVSLLEVGKDDD----FSTIQVRATSGDNRLGGDDWDQRIIDWLV
DNAK_LEIXX       EDELILVFDLGGGTFDVSLLEVGKDDD----FSTIQVRATAGDNRLGGDDWDQRIVEWLI
DNAK_BIFLO       EDERILVFDLGGGTFDVSLLEIGKDDDG---FSTIQVQATNGDNHLGGDDWDQKIIDWLV
DNAK_COREF       QEQTILVFDLGGGTFDVSLLEIG--------DGVVEVRATSGDNELGGDDWDQRIVDWLV
DNAK_CORGL       QEQTILVFDLGGGTFDVSLLEIG--------DGVVEVRATSGDNELGGDDWDQRIVDWLV
DNAK_CORDI       KEQTILVFDLGGGTFDVSLLEIG--------DGVVEVRATAGDNELGGDDWDQRIVDWLV
DNAK_CORJK       KEQTILVFDLGGGTFDVSLLEIG--------DGVVEVRATAGDNELGGDDWDQRIVDWLA
DNAK_MYCLE       REQTILVFDLGGGTFDVSLLEIG--------EGVVEVRATSGDNHLGGDDWDDRIVNWLV
DNAK_MYCPA       KEQTILVFDLGGGTFDVSLLEIG--------EGVVEVRATSGDNQLGGDDWDDRIVNWLV
DNAK_MYCTU       KEQRILVFDLGGGTFDVSLLEIG--------EGVVEVRATSGDNHLGGDDWDQRVVDWLV
DNAK_MYCBO       KEQRILVFDLGGGTFDVSLLEIG--------EGVVEVRATSGDNHLGGDDWDQRVVDWLV
DNAK_NOCFA       KEQTILVFDLGGGTFDVSLLEIG--------EGVVEVRATSGDNHLGGDDWDQRIVNWLV
DNAK1_STRAW      -DQTILVFDLGGGTFDVSLLEIG--------DGVVEVKATNGDNHLGGDDWDQRVVDYLV
DNAK_STRCO       -EQVILVFDLGGGTFDVSLLEIG--------DGVVEVKATNGDNNLGGDDWDQRVVDYLV
DNAK_THEFY       -EATILVFDLGGGTFDVSLLDVG--------DGVVEVKATHGDNHLGGDDWDQAVVDWLV
DNAK_CUTAK       KDQTVLVFDLGGGTFDVSLLDIS--------DGVFEVKATNGDNHLGGDDWDQRIVDWLV
DNAK_HALMA       -DQTVLVYDLGGGTFDVSILDLG--------GGVYEVVATNGDNDLGGDDWDHAIIDYLA
DNAK_NATPD       -DQTVLVYDLGGGTFDVSILDLG--------GGVYEVVATNGDNDLGGDDWDEAIIDYLA
DNAK_HALSA       -DQTVLVYDLGGGTFDVSILDLG--------GGVYEVAATNGDNDLGGDDWDHAIIDHLA
DNAK_AGRFC       GK-TIAVYDLGGGTFDISVLEI--------GDGVFEVKSTNGDTFLGGEDFDMRLVEYLA
DNAK_RHIME       GK-TIAVYDLGGGTFDISVLEI--------GDGVFEVKSTNGDTFLGGEDFDMRLVEYLA
DNAK_RHILO       GK-TIAVYDLGGGTFDISVLEI--------GDGVFEVKSTNGDTFLGGEDFDMRLVEYLA
DNAK_BRUME       GK-TIAVYDLGGGTFDVSVLEI--------GDGVFEVKSTNGDTFLGGEDFDIRLVEYLV
DNAK_BRUAB       GK-TIAVYDLGGGTFDVSVLEI--------GDGVFEVKSTNGDTFLGGEDFDIRLVEYLV
DNAK_BRUSU       GK-TIAVYDLGGGTFDVSVLEI--------GDGVFEVKSTNGDTFLGGEDFDIRLVEYLV
DNAK_BARHE       GK-TIAVYDLGGGTFDISVLEI--------GDGVFEVKSTNGDTFLGGEDFDMRLVGYFA
DNAK_BARQU       GK-TIAVYDLGGGTFDISVLEI--------GDGVFEVKSTNGDTFLGGEDFDMRLVGYFA
DNAK_BRADU       TG-TIAVYDLGGGTFDISILEI--------GDGVFEVKSTNGDTFLGGEDFDMRLVGYLA
DNAK_NITWN       AG-TIAVYDLGGGTFDVSVLEI--------GDGVFEVKSTNGDTFLGGEDFDMRLVNYLA
DNAK_RHOPA       TG-TIAVYDLGGGTFDVSILEI--------GDGVFEVKSTNGDTFLGGEDFDMRLVNYLA
DNAK_CAUVC       GK-KIAVYDLGGGTFDVSILEI--------GDGVFEVKSTNGDTFLGGEDFDLRIVDYLA
DNAK_ZYMMO       GK-TIAVYDLGGGTFDISILEI--------GDGVFEVKATNGDTFLGGEDFDTKIVSYLA
DNAK_RHOS4       TK-TIAVYDLGGGTFDITILEI--------DDGLFEVKSTNGDTFLGGEDFDMRIVNYLA
DNAK_RUEPO       SQ-TIAVYDLGGGTFDVTILEI--------DDGLFEVKSTNGDTFLGGEDFDMRIVNYLA
DNAK_RICFE       SK-TIAVYDLGGGTFDVSILEI--------SDGVFEVKSTNGDTFLGGEDFDTRILNHLI
DNAK_RICTY       SK-TIAVYDLGGGTFDVSILEI--------SDGVFEVKSTNGDTFLGGEDFDTRILNHLI
DNAK_RICPR       SK-TIAVYDLGGGTFDVSILEI--------SDGVFEVKSTNGDTFLGGEDFDTRILNHLI
DNAK_RICCN       SK-TIAVYDLGGGTFDVSILEI--------ADGVFEVKSTNGDTFLGGEDFDTRILNHLI
DNAK_PELUB       NK-KIAVYDLGGGTFDVSILEL--------GDGVFEVKSTNGDTFLGGEDFDNTIVDYLI
DNAK_EHRRG       KQKVIAVYDLGGGTFDVSILEI--------ADGVFEVKSTNGDTMLGGEDFDHAIMEYLM
DNAK_EHRRW       KQKVIAVYDLGGGTFDVSILEI--------ADGVFEVKSTNGDTMLGGEDFDHAIMEYLM
DNAK_EHRCJ       KQKVIAVYDLGGGTFDVSILEI--------ADGVFEVKATNGDTMLGGEDFDHAIMDYLM
DNAK_ANAMM       KQRTIVVYDLGGGTFDVSVLEI--------AEGVFEVKATNGDTKLGGEDFDNAVMEHMM
DNAK_WOLPM       GH-TIVVYDLGGGTFDVSILEI--------GDGVFEVKATNGDTHLGGEDFDNGVVSYLL
DNAK_WOLTR       GH-TIVVYDLGGGTFDVSILEI--------GDGVFEVKATNGDTHLGGEDFDNAIVSYLL
DNAK_BORBR       GDRKIVVYDLGGGTFDVSIIEIADV----DGEMQFEVLSTNGDTFLGGEDFDQRIIDYII
DNAK_BORPE       GDRKIVVYDLGGGTFDVSIIEIADV----DGEMQFEVLSTNGDTFLGGEDFDQRIIDYII
DNAK_BORPA       GDRKIVVYDLGGGTFDVSIIEIADV----DGEMQFEVLSTNGDTFLGGEDFDQRIIDYII
DNAK_BURPS       GDRKIAVYDLGGGTFDVSIIEIADV----DGEMQFEVLSTNGDTFLGGEDFDQRIIDYII
DNAK_BURMA       GDRKIAVYDLGGGTFDVSIIEIADV----DGEMQFEVLSTNGDTFLGGEDFDQRIIDYII
DNAK_BURP1       GDRKIAVYDLGGGTFDVSIIEIADV----DGEMQFEVLSTNGDTFLGGEDFDQRIIDYII
DNAK_BURL3       GDRKIAVYDLGGGTFDVSIIEIADV----DGEMQFEVLSTNGDTFLGGEDFDQRIIDYII
DNAK_RALSO       GDRKIAVYDLGGGTFDISIIEIADV----DGEKQFEVLSTNGDTFLGGEDFDQRIIDYII
DNAK_CUPPJ       GDRKIAVYDLGGGTFDISIIEIADV----DGEKQFEVLSTNGDTFLGGEDFDQRIIDYII
DNAK_AROAE       GDSKIAVYDLGGGTFDISIIEIADI----DGEHQFEVLATNGDTFLGGEDFDQRLIDYIV
DNAK_THIDA       GDRKIAVYDLGGGTFDISIIEIAEM----DGEHQFEVLSTNGDTFLGGEDFDQRLIDYIA
DNAK_DECAR       SDRKIAVYDLGGGTFDISIIEIANV----DGETQFEVLATNGDTFLGGEDFDQRLIDYII
DNAK_NITEU       GDRKIAVYDLGGGTFDISIIEIAEV----EGEHQFEVLATNGDTFLGGEDFDSRVIEYLV
DNAK_NEIMA       KDRKVAVYDLGGGTFDISIIEIANL----DGDKQFEVLATNGDTFLGGEDFDQRLIDYII
DNAK_NEIG1       KDRKIAVYDLGGGTFDISIIEIANL----DGDKQFEVLATNGDTFLGGEDFDQRLIDYII
DNAK_NEIMB       KDRKVAVYDLGGGTFDISIIEIANL----DGDKQFEVLATNGDTFLGGEDFDQRLIDHII
DNAK_CHRVO       -DRKIAVYDLGGGTFDVSIIEIADV----DGEHQFEVLSTNGDTFLGGEDFDQRLIDYIV
DNAK_BUCAI       GNRTIAVYDLGGGTFDISIIEIDEV----DKEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_BUCAP       GNRTIAVYDLGGGTFDISIIEIDDV----DKEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_BUCBP       GNKTIAVYDLGGGTFDISIIEIDDV----DKEKTFEVLATNGDTHLGGEDFDNRLINYLV
DNAK_BLOFL       GNRIIAVYDLGGGTFDISIIEIDNV----DGEKTFEVLATNGDTHLGGEDFDSLLINYLV
DNAK_BLOPB       GNRTIAVYDLGGGTFDISIIEIDDV----DGEKTFEVLSTNGDTHLGGEDFDSLLINYLA
DNAK_WIGBR       GNRIIAVYDLGGGTFDISIIEIDDV----DGEKTFEVLSTNGDTHLGGEDFDSRLINYLV
DNAK_ECOLI       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_ECOL6       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_ECO57       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_SHIBS       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_SHIDS       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_SHISS       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_SHIFL       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_SALTI       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDTRLINYLV
DNAK_SALPA       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDTRLINYLV
DNAK_SALTY       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDTRLINYLV
DNAK_SALCH       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDTRLINYLV
DNAK_YERPE       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_YERPS       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDSRLINYLV
DNAK_PHOLL       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTYEVLATNGDTHLGGEDFDSRMINYLV
DNAK_PECAS       GNRTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLATNGDTHLGGEDFDNRMINYLV
DNAK_PASMU       GNKTIAVYDLGGGTFDLSIIEIDEV----GGEKTFEVLSTNGDTHLGGEDFDNRVINYLV
DNAK_MANSM       GNQTIAVYDLGGGTFDLSIIEIDEV----GGEKTFEVLATNGDTHLGGEDFDNRVINYLV
DNAK_HAEIN       ENQVIAVYDLGGGTFDISIIEIDNF----DGEQTFEVLATGGNTHLGGEDFDNRVIDYII
DNAK_HAEI8       ENQVIAVYDLGGGTFDISIIEIDNF----DGEQTFEVLATGGNTHLGGEDFDNRVIDYII
DNAK_HAEDU       ENQIIAVYDLGGGTFDISIIEIDNF----DGEQTFEVRATNGDTHLGGEDFDNRVINYLV
DNAK2_COLP3      GDKVVAVYDLGGGTFDISIIEIDEM----DGEHTFEVLATNGDTHLGGEDFDNRLINYLV
DNAK_PSEHT       GENIVAVYDLGGGTFDLSIIEIDEV----EGEHTFEVLATNGDTHLGGEDFDNRVINYLV
DNAK_SHEON       GDNIVAVYDLGGGTFDISIIEIDSN----DGDQTFEVLATNGDTHLGGEDFDNRLINYLA
DNAK_VIBVU       GDRTIAVYDLGGGTFDISIIEIDEV----EGEKTFEVLATNGDTHLGGEDFDNRLINYLV
DNAK_VIBVY       GDRTIAVYDLGGGTFDISIIEIDEV----EGEKTFEVLATNGDTHLGGEDFDNRLINYLV
DNAK_VIBPA       GDRTIAVYDLGGGTFDISIIEIDEV----EGEKTFEVLATNGDTHLGGEDFDNRLINYLV
DNAK_VIBCH       GDRTIAVYDLGGGTFDISIIEIDEV----EGEKTFEVLSTNGDTHLGGEDFDNRMINYLV
DNAK1_ALIF1      GDRTIAVYDLGGGTFDISIIEIDNV----DGEQTFEVLATNGDTHLGGEDFDNRLINFLV
DNAK2_ALIF1      GDRTIAVYDLGGGTFDISIIEIDNV----DGEQTFEVLATNGDTHLGGEDFDNRLINYLV
DNAK1_PHOPR      GDRTIAVYDLGGGTFDISIIEIDEV----EGEKTFEVLSTNGDTHLGGEDFDNRLINYLV
DNAK2_PHOPR      GERTIAVYDLGGGTFDISIIEIDEV----DGEKTFEVLSTNGDTHLGGEDFDNRMINYLV
DNAK_IDILO       GDNVIAVYDLGGGTFDISIIEIDEV----EGEHTFEVLATNGDTHLGGEDFDNRLINYLV
DNAK_XANAC       GDRKIAVYDLGGGTFDVSIIEIAEV----DGEKQFEVLATNGDTFLGGEDFDNRVIEYLV
DNAK_XANC5       GDRKIAVYDLGGGTFDVSIIEIAEV----DGEKQFEVLATNGDTFLGGEDFDNRVIEYLV
DNAK_XANCP       GDRKIAVYDLGGGTFDVSIIEIAEV----DGEKQFEVLATNGDTFLGGEDFDNRVIEYLV
DNAK_XANC8       GDRKIAVYDLGGGTFDVSIIEIAEV----DGEKQFEVLATNGDTFLGGEDFDNRVIEYLV
DNAK_XANOR       GDRKIAVYDLGGGTFDVSIIEIAEV----DGEKQFEVLATNGDTFLGGEDFDNRVIEYLV
DNAK_XYLFA       GDRKIAVYDLGGGTFDVSIIEIAEV----DGEKQFEVLATNGDTFLGGEDFDKRVIDYLV
DNAK_XYLFT       GDRKIAVYDLGGGTFDVSIIEIAEV----DGEKQFEVLATNGDTFLGGEDFDKRVIDYLV
DNAK_PSEPK       GDHTVIVYDLGGGTFDVSVIEIAEV----DGEHQFEVLATNGDTFLGGEDFDMRLIDYLV
DNAK_PSEPF       GDHTVIVYDLGGGTFDVSVIEIAEV----DGEHQFEVLATNGDTFLGGEDFDMRLIDYLV
DNAK_PSE14       GDHTVIVYDLGGGTFDVSVIEIAEV----DGEHQFEVLATNGDTFLGGEDFDIRLIDYFV
DNAK_PSEU2       GDHTVIVYDLGGGTFDVSVIEIAEV----DGEHQFEVLATNGDTFLGGEDFDIRLIDYFV
DNAK_PSESM       GDHTVIVYDLGGGTFDVSVIEIAEV----DGEHQFEVLATNGDTFLGGEDFDIRLIDYFV
DNAK_PSEF5       GDHTVIVYDLGGGTFDVSVIEIAEV----DGEHQFEVLATNGDTFLGGEDFDIRLIDYLV
DNAK_PSEAE       GDHTVIVYDLGGGTFDVSVIEIAEV----DGEHQFEVLATNGDTFLGGEDFDIRLIDYLV
DNAK_ACIAD       GDRKVAVYDLGGGTFDVSIIEIADL----DGDQQIEVLSTNGDTFLGGEDFDTALIDYLV
DNAK_PSYA2       GDSTVAVYDLGGGTFDVSIIEIADV----DGEQQFEVLATNGDTFLGGEDFDSALIDFLV
DNAK_FRATT       GEQTVAVYDLGGGTFDISIIEIADV----DGDNQIEVLSTNGDTFLGGEDFDLALMNYLI
DNAK_LEGPH       GDSVIAVYDLGGGTFDISIIEIAEV----DGEHQFEVLATNGDTFLGGEDFDLALIEYLA
DNAK_LEGPL       GDSVIAVYDLGGGTFDISIIEIAEV----DGEHQFEVLATNGDTFLGGEDFDLALIEYLA
DNAK_LEGPA       GDSVIAVYDLGGGTFDISIIEIAEV----DGEHQFEVLATNGDTFLGGEDFDLALIEYLA
DNAK_COXBU       GDRKIAVYDLGGGTFDISIIEIAEV----DGEHQFEVLATNGDTFLGGEDFDLRLIDYLA
DNAK_METCA       GDQKIAVYDLGGGTFDISIIEIAEV----DGEHQFEVLSTNGDTFLGGEDFDLRIIEYIV
DNAK_NITOC       GDQKIAVYDLGGGTFDVSIIEIAEV----EGEHQFEVLSTNGDTFLGGEDFDKRIIDYIA
DNAK1_COLP3      ADQKVVVYDLGGGTFDLSIIEISNV----DGEKQFEVLATNGDTFLGGEDFDLRLINYLA
DNAK_DESAG       -NEKIAVFDLGGGTFDISILEV--------GDNVVEVRATNGDTFLGGEDFDQRVINYLV
DNAK_DESVH       -NEKIAVFDLGGGTFDISILEV--------GDNVVEVRATNGDTFLGGEDFDQRIISYLV
DNAK_GEOSL       -DEKIAVFDLGGGTFDISILEL--------GDGVFEVKSTNGDTFLGGEDFDQRVIDWIA
DNAK_PELCD       -EEKIAVFDLGGGTFDISILEL--------GDGVFEVKSTNGDTFLGGEDFDQHIMDYVA
DNAK_DESPS       -EEKIAVFDLGGGTFDVSVLEI--------GDGVFEVKSTNGDTFLGGEDFDMRIVHWLA
DNAK_CAMJE       -SEKIVVYDLGGGTFDVTVLET--------GDNVVEVLATGGNAFLGGDDFDNKLIDFLA
DNAK_CAMJR       -SEKIVVYDLGGGTFDVTVLET--------GDNVVEVLATGGNAFLGGDDFDNKLIDFLA
DNAK_HELHP       -AEKIMVYDLGGGTFDVTVLET--------GDNVVEVLATGGDAFLGGDDFDNRIIDWAA
DNAK_WOLSU       -AEKIVVYDLGGGTFDVTVLET--------GDNVVEVLATGGDAFLGGDDFDNRIIDWAA
DNAK_HELPY       -SEKIMVYDLGGGTFDVTVLET--------GDNVVEVLATGGDAFLGGDDFDNRVIDFLA
DNAK_HELPJ       -SEKIMVYDLGGGTFDVTVLET--------GDNVVEVLATGGDAFLGGDDFDNRVIDFLA
DNAK_FUSNN       -EEKVLVFDLGGGTFDVSVLEISDG--------VIEVISTAGNNHLGGDDFDNEIINWLV
DNAK_RHOBA       -DESIIVFDLGGGTFDVSVLEVADSGDEEQESRVFQVVSTSGDTHLGGDDFDEALINYVA
DNAK_BACFN       KDMKIAVFDLGGGTFDISILEF--------GGGVFEVLSTNGDTHLGGDDFDQVIIDWLV
DNAK_BACFR       KDMKIAVFDLGGGTFDISILEF--------GGGVFEVLSTNGDTHLGGDDFDQVIIDWLV
DNAK_BACTN       KDMKIAVFDLGGGTFDISILEF--------GGGVFEVLSTNGDTHLGGDDFDQVIINWLV
DNAK_PORGI       KDMKIAVFDLGGGTFDISILEL--------GDGVFEVKSTNGDTHLGGDDFDHVIIDWLA
DNAK_CHLTE       ENEKVAVFDLGGGTFDISILEL--------GGGVFEVKSTDGDTHLGGDDFDQVIINYLA
DNAK_CHLCH       ASEKVAVFDLGGGTFDISILEL--------GEGVFEVKSTDGDTHLGGDDFDQKIIDYIA
DNAK_BORBU       HEEIVAVYDLGGGTFDISILEL--------GDGVFEVKSTNGDTHLGGDNFDDEIIKHLI
DNAK_BORBP       HEEIVAVYDLGGGTFDISILEL--------GDGVFEVKSTNGDTHLGGDNFDDEIIKHLI
DNAK_TREPA       REKIIAVYDLGGGTFDISILEL--------GDGVFEVKSTNGDTHLGGDDFDARIVQWLE
DNAK_TREDE       KEKTIAVYDLGGGTFDISILEL--------GDGVFEVKSTNGDTHLGGDDFDNRIVNWLV
DNAK_LEPIC       VNSKIAVYDLGGGTFDISILEL--------ADGVFEVKSTNGDTHLGGDDFDMAIMEWMI
DNAK_LEPIN       VNSKIAVYDLGGGTFDISILEL--------ADGVFEVKSTNGDTHLGGDDFDMAIMEWMI
DNAK_BDEBA       KDEKIVIYDFGGGTFDVSILEV--------GDGVVEVRATNGDTHLGGDNFDTVILEWLI
DNAK_CHLAB       GDKKIAVFDLGGGTFDISILEI--------GDGVFEVLSTNGDTHLGGDDFDEVIIKWMI
DNAK_CHLCV       GDKKIAVFDLGGGTFDISILEI--------GDGVFEVLSTNGDTHLGGDDFDEVIIKWMI
DNAK_CHLPN       GDKKIAVFDLGGGTFDISILEI--------GDGVFEVLSTNGDTLLGGDDFDEVIIKWMI
DNAK_CHLTR       GDKKIAVFDLGGGTFDISILEI--------GDGVFEVLSTNGDTHLGGDDFDGVIINWML
DNAK_CHLTA       GDKKIAVFDLGGGTFDISILEI--------GDGVFEVLSTNGDTHLGGDDFDGVIINWML
DNAK_CHLMU       GDKKIAVFDLGGGTFDISILEI--------GDGVFEVLSTNGDTHLGGDDFDEVIINWML
DNAK_PARUW       ADKKIAVFDLGGGTFDISVLEI--------GDGVFEVLSTSGDTHLGGDDFDNAILNWML
DNAK_DEHM1       KDETIAVYDLGGGTFDISILEL--------GEGTFQVKSTAGDTHLGGDDFDQKIIDWLI
DNAK_DEHMC       KDETIAVYDLGGGTFDISILEL--------GEGTFQVKSTAGDTHLGGDDFDQKIIDWLI
DNAK_CLOPE       SAHKILVYDLGGGTFDVSILDL--------GDGVFEVVSTNGDARLGGDDFDQRIIDYIA
DNAK_CLOTE       TNQKILVYDLGGGTFDVSILEL--------GDGVFEVKSTNGNTKLGGDDFDQRIIDHIA
DNAK_CLOAB       TNQKILVYDLGGGTFDVSVLEL--------GDGVFEVKSTNGNTHLGGDDFDEKIMDYIA
DNAK_METAC       VDQKILVYDLGGGTFDVSILEL--------GGGVFEVKSTSGDTHLGGDDFDQRVIDHLL
DNAK_METMA       IDQKILVYDLGGGTFDVSILEL--------GGGVFEVKSTSGDTHLGGDDFDQRVIDYLL
DNAK_METBF       IEQKILVYDLGGGTFDVSILEL--------GGGVFEVKSTSGDTRLGGDDFDQRIVNYLL
DNAK_CALS4       GNQKVMVYDLGGGTFDVSILEI--------GDGVFEVLATSGNNHLGGDDFDQRIIDWLA
DNAK_CARHZ       GEQTILVYDLGGGTFDVSILEI--------GDGVFEVKATAGNNRLGGDDFDQRIIDWLV
DNAK_SYMTH       EDQRILVFDLGGGTFDVSILEL--------GGGTFQVIATAGNNKLGGDDFDERIVNYLA
DNAK_AQUAE       N-VRILVYDFGGGTFDVSILEGG-------EGV-IEVKVTAGDTHLGGANIDERIMDWLI
DNAK_THEMA       KEEKVLVYDLGGGTFDVSILEIG-------EGV-IEVIATAGNNHLGGDDFDQRLIDWMA
DNAK_THEAC       KSEKILVFDLGGGTLDVTIMDFG-------DGV-FQVLSTSGDTRLGGTDMDEAIVNYIA
DNAK_THEVO       KSEKILVFDLGGGTLDVTIIEIS-------KRPNVQVLSTSGDTQLGGTDMDEAIVNYIA
DNAK_PICTO       QTLKIVIYDLGGGTLDVTIMDFG-------QGV-FQVLSTSGDTHLGGTDMDEAIVNFLA
DNAK_METTH       EDMVIMVFDLGGGTLDVTIMEFG-------GGV-FEVRSTSGDTQLGGTDMDNAIMNYLA
DNAK3_NOSS1      QEQLILVFDLGGGTFDVSILQLG--------DGVFEVKATSGNNQLGGDDFDGCVVCWMI
DNAK1_THEEB      QDQTILVFDLGGGTFDVSILQLG--------DGVFEVRSTAGNNHLGGDNFDECIVDWLL
DNAK3_SYNP6      ENSRILVFDLGGGTLDVSILQLG--------DSVFEVKATAGNNHLGGDDFDAVIVDWLA
DNAK1_NOSS1      -TETILVFDLGGGTFDVSILEVG--------DGVFEVKATSGDTQLGGNDFDKKIVDWLA
DNAK3_SYNY3      -IQKILVFDLGGGTFDVSVLEVG--------DGIFEVKATSGDTQLGGNDFDRRIVDWLA
DNAK3_THEEB      -EQTILVFDLGGGTFDVSILEVG--------DGVFEVKATSGDTQLGGNDFDKLIVDWLA
DNAK1_SYNP6      -NQTILVFDLGGGTFDVSVLEVG--------NGVFEVKATSGDTQLGGNDFDRRIVDWLA
DNAK1_PROMM      -ARRVLVFDLGGGTFDVSLMRVA--------NGVFDVKATCGDTQLGGNDFDQRIVDWLA
DNAK1_SYNPX      -VRRVLVFDLGGGTFDVSLLRIA--------NGVFDVKATNGDTQLGGNDFDQRIVDWIA
DNAK1_PROMA      -SSRVLVFDLGGGTFDISLLRIS--------NGVFDVKATSGDTQLGGNDFDQKIVEWLA
DNAK1_PROMP      -SNNVLVFDLGGGTFDVSLLRIS--------NGVFDVKATCGDTQLGGNNFDSKIVDWIA
DNAK_THET8       -NETVLVFDLGGGTFDVTILEIG--------EGVFEVKATSGDTHLGGSDMDHAIVNWLA
DNAK_THET2       -NETVLVFDLGGGTFDVTVLEIG--------EGVFEVKATSGDTHLGGSDMDHAIVNWLA
DNAK_DEIRA       -NETVLVFDLGGGTFDVTILELG--------DGVFEVKSTAGDTHLGGADFDYRIVDWLA
DNAK2_NOSS1      -NETILVFDLGGGTFDVSVLEVG--------DGVFEVLATSGDTHLGGDDFDKKIVDFLA
DNAK2_SYNY3      -NETILVFDLGGGTFDVSILEVG--------EGVFEVLATSGDTHLGGDDFDKKIVDFLA
DNAK2_THEEB      -NETILVFDLGGGTFDVSILEVG--------DGVFEVLATSGDTHLGGDDFDKKIVDYLA
DNAK2_PROMA      -NERILVFDLGGGTFDVSVLEVG--------DGVFEVLSTSGDTHLGGDDFDKVIVDHLA
DNAK_PROMT       -NERILVFDLGGGTFDVSVLEVG--------DGVFEVLSTSGDTHLGGDDFDRVIVDHLA
DNAK2_PROMP      -NERILVFDLGGGTFDVSVLEVG--------DGVFEVLSTSGDTHLGGDDFDRCIVDHLA
DNAK2_PROMM      -NERILVFDLGGGTFDVSVLEVG--------DGVFEVLSTSGDTHLGGDDFDKVIVDHLA
DNAK2_SYNPX      -NERILVFDLGGGTFDVSVLEVG--------DGVFEVLSTSGDTHLGGDDFDKVIVDHLA
DNAK2_SYNP6      -NERILVFDLGGGTFDVSVLEVG--------DGVFEVLATSGDTHLGGDDFDKKIVDFLA
DNAK_GLOVI       -NETILVFDLGGGTFDVSILEVG--------DGVFEVKSTSGDTHLGGDDFDRRIVDYLA
DNAK2_STRAW      -HETVLVFDLGGGTFDVSILDVG--------DGVVEVRSTAGDSHLGGDDFDRRLVDYLA
                     : ::*:****:*::::               :*  * *:  *** : *  ::    

DNAK_MYCH7       KKIKEEYD-FDPKSDKMALTRLKEEAEKTKINLSNQSVSTVSLPFLGMGKNG----PINV
DNAK_MYCHJ       KKIKEEYD-FDPKSDKMALTRLKEEAEKTKINLSNQSVSTVSLPFLGMGKNG----PINV
DNAK_MYCPU       KEIKNRYD-FDPSKDKMVMTRLKEAAEKAKIDLSAQMVAQITLPFLSVTSKG----PINV
DNAK_MYCMO       GKIKLEHK-YDVSKDKMAMARLKEEAEKAKINLSTTSTTSINLPFLAVTDSG----PINV
DNAK_MYCS5       KEIKTKYS-YDVSKDKYALARLKENAEKAKIDLSNQSVVQINIPFLAMSANG----PINV
DNAK_MYCHO       EQIKSKYN-FDPTTDKMAMARLKEEAERAKITLSEQLIANISLPFLAMNENG----PVNV
DNAK_UREPA       KSIADEFN-IDLSKNKMAMQRLKDAAEKAKIELSGINTTTISLPFIAMDSSGQ---PINF
DNAK_MYCGE       AYIAKEHQGLNLSKDKMAMQRLKEAAERAKIELSAQLETIISLPFLTVTQKG----PVNV
DNAK_MYCPN       AHIAQEHNGLNLSNDKMAMQRLKEAAERAKIELSAQLEAIISLPFLTVTEKG----PVNV
DNAK_MYCGA       AEIKKDHPSLDLKSDKMAMQRLKEAAERAKIELSAQLETLISLPFIAVTPEG----PVNA
DNAK_MYCPE       EEVKKNDK-VDLSNDKMAMQRLKDAAEKAKIDLSGLKEVEISLPFIAMTESG----PLNV
DNAK_MESFL       EKIKTESG-VDLKNDKMALQRLKDEAEKAKINLSSQLEVEINLPFIAMNENG----PVSF
DNAK_MYCMS       GKIKAEYN-IDLSKEKMALQRLKDEAEKAKINLSSQLEVEINLPFIAMNESG----PISF
DNAK_BACAN       AEFKKENN-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFISAGAAG----PLHL
DNAK_BACCZ       AEFKKENN-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFISAGAAG----PLHL
DNAK_BACHK       AEFKKENN-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFISAGAAG----PLHL
DNAK_BACCR       AEFKKENN-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFISAGAAG----PLHL
DNAK_BACC1       AEFKKENN-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFISAGAAX----PLHL
DNAK_BACSU       SEFKKENG-IDLSKDKMALQRLKDAAEKAKKDLSGVSSTQISLPFITAGEAG----PLHL
DNAK_BACLD       SEFKKENG-IDLSKDKMALQRLKDAAEKAKKDLSGVSSTQISLPFITAGEAG----PLHL
DNAK_GEOKA       NQFKQEHG-IDLSKDKMALQRLKDAAEKAKKELSGVTQTQISLPFISANENG----PLHL
DNAK_OCEIH       QEFKKENA-IDLSQDKMATQRLKDAAEKAKKDLSGVTQTQISLPFITAGDAG----PLHL
DNAK_BACHD       AEFKKENG-IDLSQDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITADATG----PKHL
DNAK_BACSK       AEFKKENG-IDLSQDKMAMQRLKDAAEKAKKDLSGVTQTQISLPFITADATG----PKHL
DNAK_STRA3       EEFKKENG-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAG----PLHL
DNAK_STRA5       EEFKKENG-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAG----PLHL
DNAK_STRA1       EEFKKENG-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAG----PLHL
DNAK_STRP1       AEFKKENG-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAG----PLHL
DNAK_STRP6       AEFKKENG-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAG----PLHL
DNAK_STRP8       AEFKKENG-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAG----PLHL
DNAK_STRPM       AEFKKENG-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAG----PLHL
DNAK_STRP3       AEFKKENG-IDLSQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAG----PLHL
DNAK_STRMU       EEFKKENG-IDLSTDKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAG----PLHL
DNAK_STRPN       AEFKKENG-IDLSTDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAG----PLHL
DNAK_STRR6       AEFKKENG-IDLSTDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAG----PLHL
DNAK_STRT1       EEFKKENG-IDLSTDKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAG----PLHL
DNAK_STRT2       EEFKKENG-IDLSTDKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAG----PLHL
DNAK_LACLA       AEFKKENG-IDLAQDKMALQRLKDAAEKAKKDLSGVTTTQISLPFITAGAAG----PLHL
DNAK_ENTFA       AEFKKENG-IDLANDKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAG----PLHL
DNAK_LISMF       AEFKKDNG-IDLSQDKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAG----PLHL
DNAK_LISMO       AEFKKDNG-IDLSQDKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAG----PLHL
DNAK_LISIN       AEFKKDNG-IDLSQDKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAG----PLHL
DNAK_STAAC       AEFKKENG-VDLSQDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGENG----PLHL
DNAK_STAAM       AEFKKENG-VDLSQDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGENG----PLHL
DNAK_STAAN       AEFKKENG-VDLSQDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGENG----PLHL
DNAK_STAAR       AEFKKENG-VDLSQDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGENG----PLHL
DNAK_STAAS       AEFKKENG-VDLSQDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGENG----PLHL
DNAK_STAAW       AEFKKENG-VDLSQDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGENG----PLHL
DNAK_STAES       SEFKKENG-VDLSQDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGENG----PLHL
DNAK_STAEQ       SEFKKENG-VDLSQDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGENG----PLHL
DNAK_STAHJ       SEFKKENG-VDLSQDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGESG----PLHL
DNAK_STAS1       AEFKKENS-VDLSKDKMALQRLKDAAEKAKKDLSGVSQTQISLPFISAGENG----PLHL
DNAK_LACAC       KNFKDENG-VDLSKDKMAMQRLKDASEKAKKDLSGVSSTHISLPFISAGESG----PLHL
DNAK_LACJO       QNFKEENG-VDLSNDKMALQRLKDAAEKAKKDLSGVSSTHISLPFISAGEAG----PLHL
DNAK_LACSK       ENFKSDNG-IDLSKDKMAMQRLKDAAEKAKKDLSGVSSTQISLPFISAGENG----PLHL
DNAK_LACSS       ENFKSDNG-IDLSKDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFISAGENG----PLHL
DNAK_LACPL       DGFKADNG-VDLSKDKMALQRLKDAAEKAKKDLSGVSEAQISLPFISAGASG----PLHL
DNAK_ONYPE       QEFKKENS-VDLSKDKMAMQRLKDAAEKAKKELSGVTSSQISLPFLTMSEAG----PLHL
DNAK_TROWT       DDFRKTTG-VDLSSDKIAMQRLREASEQAKKELSSATSANIQLPYISLTESG----PVNM
DNAK_TROW8       DDFRKTTG-VDLSSDKIAMQRLREASEQAKKELSSATSANIQLPYISLTESG----PVNM
DNAK_LEIXX       KRFKESTG-VDASTDKIAKQRLKEAAEQAKKELSSSMSTSIQLPYLSLTENG----PANL
DNAK_BIFLO       SEVKNKYG-VDLSKDKIALQRLKEAAEQAKKELSSSTSTSISMQYLAMTPDGT---PVHL
DNAK_COREF       EKFQSSHG-IDLTKDKMALQRLREAAEKAKIELSASQNANINLPYITVDADKN---PLFL
DNAK_CORGL       EKFQSSNG-IDLTKDKMALQRLREAAEKAKIELSSSQSANINLPYITVDADKN---PLFL
DNAK_CORDI       EKFKTAQG-VDLSKDKMAMQRLREAAEKAKIELSSSQSANVNLPYITVDADKN---PLFL
DNAK_CORJK       DKFKASHG-VDLTKDKMALQRLREAAEKAKIELSSSQQASINLPYITVDEDRN---PLFL
DNAK_MYCLE       DKFKGTSG-IDLTKDKMAMQRLREAAEKAKIELSSSQSTSVNLPYITVDSDKN---PLFL
DNAK_MYCPA       DKFKGTSG-IDLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKN---PLFL
DNAK_MYCTU       DKFKGTSG-IDLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKN---PLFL
DNAK_MYCBO       DKFKGTSG-IDLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKN---PLFL
DNAK_NOCFA       DKFKASSG-IDLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKN---PLFL
DNAK1_STRAW      QQFKAGHG-VDLAKDKMALQRLREAAEKAKIELSSSTETSINLPYITASAE-G---PLHL
DNAK_STRCO       KQFQSGHG-VDLAKDKMALQRLREAAEKAKIELSSSTETTINLPYITASAE-G---PLHL
DNAK_THEFY       ERFKSSNG-IDLSKDKMAMQRLREAAEKAKIELSSSTETSINLPYITASAE-G---PLHL
DNAK_CUTAK       TQFKNANG-IDLAADKMAKQRLQEAAERAKIELSQASETHINLPYITAGAAG----PLHL
DNAK_HALMA       DEFEAEHG-IDLRDDRQALQRLTEAAEEAKIELSSRKETRINLPFIATTDDG----PLDL
DNAK_NATPD       DSFEEEHG-IDLREDRQALQRLHEAAEEAKIELSSRKETNINLPFIAATDEG----PLNL
DNAK_HALSA       DNFENEHG-IDLREDRQALQRLTEAAEEAKIELSSRKETTVNLPFVTATDSG----PVHL
DNAK_AGRFC       GEFKKDQG-IDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFITADAS----GPKHL
DNAK_RHIME       SEFKKEQG-IDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFITADAS----GPKHL
DNAK_RHILO       AEFKKEQG-IDLKNDKLALQRLKEAAEKAKIELSSTTQTEINLPFITADAT----GPKHL
DNAK_BRUME       AEFKKESG-IDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFITADQT----GPKHL
DNAK_BRUAB       AEFKKESG-IDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFITADQT----GPKHL
DNAK_BRUSU       AEFKKESG-IDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFITADQT----GPKHL
DNAK_BARHE       DEFKKEQG-IDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFITADQS----GPKHL
DNAK_BARQU       DEFKKEQG-IDLKNDKLALQRLKEAAEKAKIELSSSQQTEINLPFITADQS----GPKHL
DNAK_BRADU       DEFQKEQG-INLRNDKLALQRLKEAAEKAKIELSSTTQTEINLPFITADQT----GPKHL
DNAK_NITWN       DEFQKEQG-INLRNDKLALQRLKEAAEKAKIELSSTTQTEINLPFITADQS----GPKHL
DNAK_RHOPA       DEFQKEQG-IDLRKDKLALQRLKEAAEKAKIELSSTTQTEINLPFITADQS----GPKHL
DNAK_CAUVC       DEFKKEQG-VDLRKDKLALQRLREEAEKAKKELSSTAQYEVNLPFISMNAS----GPLHL
DNAK_ZYMMO       EEFKKAEG-IDLTKDRLALQRLKEAAEKAKIELSSAQTTEVNLPFITADAT----GPKHL
DNAK_RHOS4       DEFKKEHG-VDLTLDKMALQRLKEAAEKAKIELSSSQQTEINQPFISMDRNT-G-QPLHM
DNAK_RUEPO       DEFKKEHG-VDLSGDKMALQRLKEAAEKAKIELSSTTQTEINQPFISMGAN--G-QPLHL
DNAK_RICFE       DVFKKDSG-IDLSKDPLALQRLKEAAEKAKKELSSTSATDINLPYITADST----GPKHL
DNAK_RICTY       DVFKKDSG-IDLSKDPLALQRLKEAAEKAKKELSSTSATDINLPYITADST----GPKHL
DNAK_RICPR       EVFKKESG-IDLSKDPLALQRLKEAAEKAKKELSSTSTTDINLPYITADST----GPKHL
DNAK_RICCN       DVFKKENG-IDLSKDPLALQRLKEAAEKAKKELSSAVTTDINLPYITADSS----GPKHL
DNAK_PELUB       GEFKKDSG-IDLRSDKLALQRLKEAAEKAKIELSSAEQTDVNLPFITADKT----GPKHI
DNAK_EHRRG       DDFKKSTG-IDLHSDAMAMQRIKEAAEKAKIELSSRMETDINLPFLSSDST----GPKHL
DNAK_EHRRW       DDFKKSTG-IDLHSDAMAMQRIKEAAEKAKIELSSRMETDINLPFLSSDST----GPKHL
DNAK_EHRCJ       DDFKKTTG-IDLHNDAMAVQRIKEASEKAKIELSNRMETDINLPFISSDST----GPKHL
DNAK_ANAMM       ESFKQETG-IDLHNDPMAVQRIKEAAEKAKIELSSRLETDITLPFISSDST----GAKHL
DNAK_WOLPM       DEFKKSNG-IDLKNDPMAMQRIKEAAEKAKIELSSAMETEINLPFITADAS----GPKHL
DNAK_WOLTR       DEFKKSNG-IGLKNDPMAMQRIKEAAEKAKIELSSAMETEINLPFITADAN----GPKHL
DNAK_BORBR       SEFKKEQG-VDLSKDVLALQRLKEAAEKAKIELSSSQQTEINLPYITADAS----GPKHL
DNAK_BORPE       SEFKKEQG-VDLSKDVLALQRLKEAAEKAKIELSSSQQTEINLPYITADAS----GPKHL
DNAK_BORPA       SEFKKEQG-VDLSKDVLALQRLKEAAEKAKIELSSSQQTEINLPYITADAS----GPKHL
DNAK_BURPS       GEFKKEQG-VDLSKDVLALQRLKEAAEKAKIELSSSQQTEINLPYITADAS----GPKHL
DNAK_BURMA       GEFKKEQG-VDLSKDVLALQRLKEAAEKAKIELSSSQQTEINLPYITADAS----GPKHL
DNAK_BURP1       GEFKKEQG-VDLSKDVLALQRLKEAAEKAKIELSSSQQTEINLPYITADAS----GPKHL
DNAK_BURL3       GEFKKEQG-VDLSKDVLALQRLKEAAEKAKIELSSSQQTEINLPYITADAS----GPKHL
DNAK_RALSO       GEFKKESG-VDLSKDVLALQRLKDAAEKAKIELSSTQQTEINLPYITADAS----GPKHL
DNAK_CUPPJ       GEFKKDQG-VDLSKDVLALQRLKEAAEKAKIELSSSQQTEINLPYITADAS----GPKHL
DNAK_AROAE       TEFKKEQG-VDLKKDVLALQRLKEAAEKAKIELSSGQQTEVNLPYITADAS----GPKHL
DNAK_THIDA       EEFKKEQG-VDLKKDVLALQRLKEAAEKAKIELSSGQQTEVNLPYITADAS----GPKHL
DNAK_DECAR       DEFKKESG-VNLKADVLALQRLKEAAEKAKIELSSSQQTEVNLPYITADAS----GPKHL
DNAK_NITEU       DEFRKESG-IDLKKDMLALQRLKDAAEKAKIELSSSQQTEVNLPYITADAS----GPKHL
DNAK_NEIMA       DEFKKEQG-IDLKQDVMALQRLKEAAEKAKIELSSGQQTEINLPYITMDAT----GPKHL
DNAK_NEIG1       DEFKKEQG-IDLKQDVMALQRLKEAAEKAKIELSSGQQTEINLPYITMDAT----GPKHL
DNAK_NEIMB       AEFKKEQG-IDLKQDVMALQRLKEAAEKAKIELSSGQQTEINLPYITMDAT----GPKHL
DNAK_CHRVO       TEFKKEQG-VDLKQDVMALQRLKEAAEKAKIELSSATQTEVNLPYITMDAT----GPKHL
DNAK_BUCAI       TEFKKEQG-IDLRNDPLSMQRLKESAEKAKIELSSAQQTDVNLPYITADSN----GPKHL
DNAK_BUCAP       QEFKKEQG-IDLRNDSLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADSN----GPKHL
DNAK_BUCBP       EDFKKDQG-TDLRNDSLAMQRLKESAEKAKIELSSTQQTDVNLPYITADST----GPKHL
DNAK_BLOFL       EEFKKDQG-IDLYNDPLAMQRLKESAEKSKIELSTSQQTDVNLPYITADST----GPKHM
DNAK_BLOPB       DEFKKDQR-INLYNDPLAMQRLKEAAEKAKIELSASHQTDVNLPYITADNT----GPKHM
DNAK_WIGBR       NEFKKEQG-IDLRNDPLAMQRLKESSEKAKIELSSVHQTDVNLPYITADSS----GPKHM
DNAK_ECOLI       EEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_ECOL6       EEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_ECO57       EEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_SHIBS       EEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_SHIDS       EEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_SHISS       EEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_SHIFL       EEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_SALTI       DEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_SALPA       DEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_SALTY       DEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_SALCH       DEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_YERPE       EEFKKDQG-MDLRTDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADGS----GPKHM
DNAK_YERPS       EEFKKDQG-MDLRTDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADGS----GPKHM
DNAK_PHOLL       DEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK_PECAS       DEFKKEQG-FDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHL
DNAK_PASMU       DEFKKEQG-VDLRNDPLAMQRLKEAGEKAKIELSSAQQTDVNLPYITADAT----GPKHL
DNAK_MANSM       DEFKKEQG-VDLRNDPLAMQRLKEAGEKAKIELSSAQQTDVNLPYITADAT----GPKHL
DNAK_HAEIN       DEFKKEQN-IDLRNDAMALQRVKEAAEKAKIELSSAQSTEVNLPYITADAT----GPKHL
DNAK_HAEI8       DEFKKEQN-IDLRNDAMALQRVKEAAEKAKIELSSAQSTEVNLPYITADAT----GPKHL
DNAK_HAEDU       EEFQKEQG-VDLRNDPMAMQRVKEAAEKAKIELSSAQETEVNLPYITADAT----GPKHL
DNAK2_COLP3      AEFKKDQG-MDLTSDPLAMQRLKEAAEKAKCELSSAQQTDVNLPYITADGS----GPKHM
DNAK_PSEHT       AEFKKDQG-LDLKTDPLAMQRVKEAAEKAKIELSSAQSTEVNLPYVTADAT----GPKHM
DNAK_SHEON       DEFKKEQG-LDLRKDPLAMQRLKEAAEKAKIELSSTNQTEVNLPYITADAT----GPKHL
DNAK_VIBVU       AEFKKDQG-IDLKNDPLAMQRVKEAAEKAKIELSSTNQTDVNLPYITADAT----GPKHM
DNAK_VIBVY       AEFKKDQG-IDLKNDPLAMQRVKEAAEKAKIELSSTNQTDVNLPYITADAT----GPKHM
DNAK_VIBPA       DEFKKEQG-IDLKNDPLAMQRVKEAAEKAKIELSSTSQTDVNLPYVTADAT----GPKHM
DNAK_VIBCH       DEFKKDQG-IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK1_ALIF1      DEFKKEQG-FDLKNDPLAMQRVKEAAEKAKIELSSAQQTDVNLPYVTADAT----GPKHM
DNAK2_ALIF1      SEFEKEQG-INLKNDPLAMQRVKEAAEKAKIELSSAQQTDVNLPYVTADAT----GPKHM
DNAK1_PHOPR      EEFKKEQG-MDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADAT----GPKHM
DNAK2_PHOPR      GEFKKEQG-IDLKSDPLAMQRVKEAAEKAKIELSSAQQTDVNLPYVTADAA----GPKHM
DNAK_IDILO       EQFQKDQG-MDLRKDPLAMQRLKEAAEKAKIELSSAQQTEVNLPYITADNA----GPKHM
DNAK_XANAC       DEFNKDQG-IDLRKDPLALQRLKDAAERAKIELSSSQQTEVNLPYVTADAS----GPKHL
DNAK_XANC5       DEFNKDQG-IDLRKDPLALQRLKDAAERAKIELSSSQQTEVNLPYVTADAS----GPKHL
DNAK_XANCP       DEFNKDQG-IDLRKDPLALQRLKDAAERAKIELSTSQQTEVNLPYVTADAS----GPKHL
DNAK_XANC8       DEFNKDQG-IDLRKDPLALQRLKDAAERAKIELSTSQQTEVNLPYVTADAS----GPKHL
DNAK_XANOR       DEFNKDQG-IDLRKDPLALQRLKDAAERAKIELSSSQQTEVNLPYVTADAS----GPKHL
DNAK_XYLFA       DEFNKDQG-IDLRKDPLALQRLKDAAERAKIELSSSQQTEVNLPYITADAS----GPKHL
DNAK_XYLFT       DEFNKDQG-IDLRKDPLALQRLKDAAERAKIELSSSQQTEVNLPYITADAS----GPKHL
DNAK_PSEPK       DEFKKESG-MDLKNDPLALQRLKEAAEKAKIELSSAQSTDVNLPYITADAT----GPKHL
DNAK_PSEPF       DEFKKESG-MDLKNDPLALQRLKEAAEKAKIELSSSQSTDVNLPYITADAT----GPKHL
DNAK_PSE14       DEFKKESG-MNLKGDPLAMQRLKEAAEKAKIELSSSTQTEVNLPYITADAT----GPKHL
DNAK_PSEU2       DEFKKESG-MNLKGDPLAMQRLKEAAEKAKIELSSSTQTEVNLPYITADAT----GPKHL
DNAK_PSESM       DEFKKESG-MSLKGDPLAMQRLKEAAEKAKIELSSSTQTEVNLPYITADAT----GPKHL
DNAK_PSEF5       DEFKKESG-MNLKGDPLAMQRLKEAAEKAKIELSSSQQTDVNLPYITADAT----GPKHL
DNAK_PSEAE       DEFKKESG-INLKGDPLAMQRLKEAAEKAKIELSSTQQTDVNLPYVTADAS----GPKHL
DNAK_ACIAD       EEFKKEQS-VNLKNDPLALQRLKEAAEKAKIELSSSSSTEINLPYITADAT----GPKHL
DNAK_PSYA2       AEFKKDQD-VNLKGDSLAMQRLKEAAEKAKIELSSAQSTEVNLPYITADSS----GPKHL
DNAK_FRATT       DEFKKEQG-IDLHNDKLALQRVREAAEKAKVELSSAQQTDVNLPYITADAT----GPKHL
DNAK_LEGPH       SEFKKDTG-IDLHNDPLALQRLKEAAEKAKIELSSAQQTDVNLPYITADAS----GPKHL
DNAK_LEGPL       SEFKKDTG-IDLHNDPLALQRLKEAAEKAKIELSSAQQTDVNLPYITADAS----GPKHL
DNAK_LEGPA       SEFKKDTG-IDLHNDPLALQRLKEAAEKAKIELSSAQQTDVNLPYITADAS----GPKHL
DNAK_COXBU       GEFKKDEG-VDLHNDPLALQRLKEAAEKAKIELSSSQQTDVNLPYITADAS----GPKHL
DNAK_METCA       DEFRKEQG-IDLHNDPLALQRLKESAEKAKIELSSSQQTEINLPYITADAT----GPKHL
DNAK_NITOC       EEFKKEQS-IDLRGDPLAMQRLKDAAEKAKIELSSSQQTEVNLPYVTADAS----GPKHL
DNAK1_COLP3      DEFKKESG-IDIHQDTLALQRIKEAAEKAKIELSSALQTEVNLPYVTADAS----GPKHL
DNAK_DESAG       EEFRRENG-IDLSRDRMALQRLKEAAEKAKKDLSTSMETEINLPFITADQT----GPKHL
DNAK_DESVH       DEFRRENGGIDLARDRMALQRLKEAAEKAKKDLSTSMETEVNLPFITADQT----GPKHL
DNAK_GEOSL       DEFKKDQG-IDLRGDKMALQRLKEAAEKAKCELSTSMETDINLPFITADAT----GPKHL
DNAK_PELCD       DEFKKEQG-IDLRNDKMALQRLKEACEKAKCELSTSMETDINLPFITADQS----GPKHL
DNAK_DESPS       DEFKREQG-IDLRSDKMALQRLKEEAEKAKMELSTTVETDINLPFITADAS----GPKHL
DNAK_CAMJE       NEFKDETG-IDLKNDVMALQRLKEAAENAKKELSSANETEINLPFITADAS----GPKHL
DNAK_CAMJR       NEFKDETG-IDLKNDVMALQRLKEAAENAKKELSSANETEINLPFITADAS----GPKHL
DNAK_HELHP       EEFKSDEG-IDLKNDVMALQRLKDAAENAKKELSSAQETEINLPFITADAS----GPKHL
DNAK_WOLSU       KEFEAENG-IDLKKDVMALQRLKDAAENAKKELSSANETEINLPFITADAT----GPKHL
DNAK_HELPY       SEFKSETG-IEIKNDVMALQRLKEAAENAKKELSSAMETEINLPFITADAT----GPKHL
DNAK_HELPJ       AEFKNETG-IEIKNDVMALQRLKEAAENAKKELSSAMETEINLPFITADAT----GPKHL
DNAK_FUSNN       AEFKKETG-IDLSNDKMAYQRLKDAAEKAKKELSTLMETSISLPFITMDAT----GPKHL
DNAK_RHOBA       SEFQKDNG-IDLRNDAMALQRLQEACEKAKKELSTLPETDINLPFITMDAS----GPKHL
DNAK_BACFN       QEFKNDEG-ADLTQDPMAMQRLKEAAEKAKIELSSSTSTEINLPYIMPVGG----VPKHL
DNAK_BACFR       QEFKNDEG-ADLTQDPMAMQRLKEAAEKAKIELSSSTSTEINLPYIMPVGG----VPKHL
DNAK_BACTN       QEFKNDEG-ADLTQDPMALQRLKEAAEKAKIELSSSTSTEINLPYIMPVNG----VPKHL
DNAK_PORGI       EEFKSQEG-VDLRQDPMAMQRLKEAAEKAKIELSSTSSTEINLPYIMPVNG----IPKHL
DNAK_CHLTE       DEFKKQEG-IDLRKDAIALQRLKEAAEKAKIELSSRTDTEINLPFITATQE----GPKHL
DNAK_CHLCH       EEFKKQEG-IDLRKDAITLQRLKEAAEKAKIELSSRSDTEINLPFITATQE----GPKHL
DNAK_BORBU       SEFKKESA-IDLSNDKMALQRLKEAAEKAKIELSGAQEASINLPFITADAN----GPKHL
DNAK_BORBP       SEFKKESA-IDLSNDKMALQRLKEAAEKAKIELSGAQEASINLPFITADAN----GPKHL
DNAK_TREPA       QGFKSDTG-IDLGNDRMALQRLREAAEKAKIALSSSASTEINLPFITADAN----GPKHL
DNAK_TREDE       DEFKKDTG-IDLSKDRMALQRLREAAEKAKIELSSVANTEVNLPFITADAN----GPKHL
DNAK_LEPIC       SEFKNQTG-IDISADKNTVQRLKEAAEKAKIELSGTMSTQINLPFITADAS----GPKHL
DNAK_LEPIN       SEFKNQTG-IDISADKNTVQRLKEAAEKAKIELSGTMSTQINLPFITADAS----GPKHL
DNAK_BDEBA       TEFKKDQA-IDLKNDKMALQRLKEAAEKAKIELSSAQETEINLPFITADQS----GPKHL
DNAK_CHLAB       EEFQKQEG-IDLSKDNMALQRLKDAAEKAKIELSGMSSTEINQPFITMDAN----GPKHL
DNAK_CHLCV       EEFKKQEG-IDLSKDNMALQRLKDAAEKAKIELSGVSSTEINQPFITMDAS----GPKHL
DNAK_CHLPN       EEFKKQEG-IDLSKDNMALQRLKDAAEKAKIELSGVSSTEINQPFITMDAQ----GPKHL
DNAK_CHLTR       DEFKKQEG-IDLSKDNMALQRLKDAAEKAKIELSGVSSTEINQPFITIDAN----GPKHL
DNAK_CHLTA       DEFKKQEG-IDLSKDNMALQRLKDAAEKAKIELSGVSSTEINQPFITIDAN----GPKHL
DNAK_CHLMU       GEFKKQEG-IDLSKDNMALQRLKDAAEKAKIELSGVSSTEINQPFITIDAN----GPKHL
DNAK_PARUW       ETFKQEQG-IDLRNDKMALQRLRDAAEKAKIELSGVQQTEINQPFITMDAS----GPKHL
DNAK_DEHM1       AEYKKDQG-IDLSKDKTALQRLKEAAEKAKIELSTVQQAEINLPFITADAS----GPKHL
DNAK_DEHMC       AEYKKDQG-IDLSKDKTALQRLKEAAEKAKIELSTVQQTEINLPFITADAS----GPKHL
DNAK_CLOPE       EDFKAQNG-IDLRQDKMALQRLKEAAEKAKIELSSSTQTLINLPFITADATG----PKHI
DNAK_CLOTE       ETFKKDSG-IDLRTDKMALQRLKEAAEKAKIELSSSTQTNINLPFITADATG----PKHI
DNAK_CLOAB       EEFKKDNG-IDLRNDKMALQRLKEAAEKAKIELSSSTQTNINLPFITADATG----PKHI
DNAK_METAC       AEFKKTEG-IDLSKDKAILQRLKDAAEKAKIELSGVTVTNINLPFLTVGPDGE---PKHM
DNAK_METMA       AEFKKSEG-IDLSKDKAVLQRLKDAAEKAKIELSGVANTNINLPFLTVGTDGE---PKHM
DNAK_METBF       AEFRKIEG-IDLSKDKAVLQRLTDAAEKAKIELSGVASTNINLPFLTVGADGE---PKHL
DNAK_CALS4       DNFQKEHG-IDLRKDRMALQRLKEAAERAKIELSSAMVTNINLPFITADASG----PKHI
DNAK_CARHZ       ENFKKEHG-IDLRNDKMAMQRLKEAAEKAKIELSGVLETQINLPFIAANQNG----PLHI
DNAK_SYMTH       DRFQREHG-IDLRKDKQALQRLREAAEKAKIELSSVTTTNINLPFISMTADG----PVHM
DNAK_AQUAE       EEFKKETG-IDLRKDRTALQRLKEASEQAKKELSFKMETEINLPFITIDPNT-N-QPLHL
DNAK_THEMA       EEFKKQHG-IDLREDRQALQRLRDAAEKAKIELSTKMETDVSLPFIAVSP-S-G-QPLHL
DNAK_THEAC       DDFQKKEG-IDLRKDRSAYIRLRDAAEKAKIELSTTLSTDIDLPYITVTN---S-GPKHI
DNAK_THEVO       DDFQKKEG-IDLRKDRGAYIRLRDAAEKAKIELSTTLSSDIDLPYITVTS---S-GPKHI
DNAK_PICTO       DNFQRENG-IDLRKDHSAYIRLRDAAEKAKIELSTVLETEINLPYITATQ---D-GPKHL
DNAK_METTH       EEFKMETG-IDLMEDDQAVQRLREAAEKAKIELSTTLTTEVNLPYITVAQ---D-GPKHL
DNAK3_NOSS1      ERFQQQEK-IDLAQDKMALQRLREAAEKAKIELSSMASTSINLPFITADETG----PKHL
DNAK1_THEEB      ACFKEQEG-IDLSKDKMALQRLREAAEKAKVELSGTLSTSINLPFITADETG----PKHL
DNAK3_SYNP6      DNFLKAES-IDLRQDKMAIQRLREASEQAKIDLSTLPTTTINLPFIATATVDGAPEPKHI
DNAK1_NOSS1      EQFLETEG-VDLRRDRQALQRLMEAAEKAKIELSAVSITDINLPFITATEDG----PKHL
DNAK3_SYNY3      EKFLEAEK-VDLRQDRQALQRLTEAAEKAKIELSGVGTTEINLPFITATEDG----PKHL
DNAK3_THEEB      EDFLAKEG-IDLRRDRQSLQRLTDAAEKAKIELSGLLETNIDLPFVTATAEG----PKHI
DNAK1_SYNP6      EQFLEAEG-IDLRRDRQALQRLIEAAEKAKIELSGVSVTDINLPFITATEDE----PKHL
DNAK1_PROMM      EAFKTKHG-LDLRRDRQALQRLIEAAEKAKQELSGVLSTPISLPFIATGPDG----PLHI
DNAK1_SYNPX      DAFQAEHG-VDLRRDRQALQRLTEAAEKAKQELSGVLTTPISLPFIATGENG----PLHV
DNAK1_PROMA      NDFKKEHN-IDLRRDRQSLQRLNEVAEKAKQELSGLNSTPISLPFIATGPNG----PLHI
DNAK1_PROMP      ERFLEKHK-IDLRRDRQALQRLTEAAEKAKCELSGLQKTKISLPFITTSDDG----PLHI
DNAK_THET8       EEFKKEHG-VDLKADRQALQRLIEAAEKAKIELSSTLETTISLPFIALDPASKT--PLHL
DNAK_THET2       EEFKKEHG-VDLKADRQALQRLIEAAEKAKIELSSTLETTISLPFIALDPASKT--PLHL
DNAK_DEIRA       GEFQKEHN-FDLRKDKQALQRLIEAAEKAKIDLSNASETSISLPFITFDPETRT--PMHL
DNAK2_NOSS1      EQFRKDEG-IDLRKDKQALQRLTEAAEKAKIELSSVTQAEINLPFITATQDG----PKHL
DNAK2_SYNY3      GEFQKAEG-IDLRKDKQALQRLTEAAEKAKIELSGVSQTEINLPFITATQDG----PKHL
DNAK2_THEEB      ESFRAQEG-IDLRKDRQALQRLTEAAEKAKIELSSVMQTEINLPFITATQDG----PKHL
DNAK2_PROMA      ATFKANEG-IDLRQDKQALQRLTEAAEKAKIELSNATQSEINLPFITATPEG----PKHV
DNAK_PROMT       STFKGNEG-IDLRQDKQALQRLTEAAEKAKIELSNATQSEINLPFITATPEG----PKHL
DNAK2_PROMP      SIFKSNEG-IDLRQDKQALQRLTEAAEKAKIELSNATQSEINLPFITATPEG----PKHL
DNAK2_PROMM      ATFKANEG-IDLRQDKQALQRLTEAAEKAKIELSSATQSEINLPFITATSEG----PKHL
DNAK2_SYNPX      ETFKSNEG-IDLRQDKQALQRLTEAAEKAKIELSSATQSEINLPFITATPEG----PKHL
DNAK2_SYNP6      GEFQKNEG-IDLRKDKQALQRLTEAAEKAKIELSSATQTEINLPFITATQDG----PKHL
DNAK_GLOVI       DEFKKLEG-VDLRTDRQALQRLTEAAEKAKIELSGVTQTQINLPFITAGADG----AKHL
DNAK2_STRAW      DDFQQENG-IDLRKDPQALQRLFEAAEKAKTELSSVTQTQVSLPFITADASG----PKHL
                               :     *: :  *.:*  **      :   ::          .   

DNAK_MYCH7       ELELKRSEFEKMTAHLIDRTRKPIVDALKQAKI-EASDLDEVLLVGGSTRMPAVQSMIEH
DNAK_MYCHJ       ELELKRSEFEKMTAHLIDRTRKPIVDALKQAKI-EASDLDEVLLVGGSTRMPAVQSMIEH
DNAK_MYCPU       DLELKRSEFEKMTTHLVDRTRKPIEDALREAKI-KASDLSEVLLVGGSTRIPAVQSMVEH
DNAK_MYCMO       EVELKRSDFEKMTQHLVERTRKPVRDALKEAKL-KSEDLHEVLLVGGSTRIPAVQEMLQH
DNAK_MYCS5       ELSLKRSEFEAMTSHLLDRTRKPIEDALKEAKL-SANDIHEVLLVGGSTRMPAVQDMVKR
DNAK_MYCHO       ELEITRATFESMTEHLLQRTRKPLLDVLSEAKL-TWNDINEVLLVGGSTRMPAVQKLVAE
DNAK_UREPA       EKELNRATFDNLTKNLIERLKKPVLDAMKESKL-SLVDIDQVLMVGGSTRMPAVQNLVKE
DNAK_MYCGE       ELKLTRAKFEELTKPLLERTRNPISDVIKEAKI-KPEEINEILLVGGSTRMPAVQKLVES
DNAK_MYCPN       ELKLTRAKFEEITKQLLERTRNPISDVLREAKI-KPEEINEILLVGGSTRMPAVQKLVES
DNAK_MYCGA       ELTLSRAKFEELTKDLLERTRNPIADVLKEAKV-DPSQVDEILLVGGSTRMPAVQKLVES
DNAK_MYCPE       DLKLTRAKFEDLTRDLLERTIKPVEDALKEAKL-SASDIHKVLLVGGSTRMPAVEELVKS
DNAK_MESFL       STQFSRTEFDKITKDLVERTSKPVKDALQAAKL-SASDIDEVLLVGGSTRIPAVQKIVKE
DNAK_MYCMS       ATTLTRSEFNKITKHLVDLTIQPVKDALSAAKK-TPSEINEVLLVGGSTRIPAVQELVKS
DNAK_BACAN       ELTLTRAKFEELSAGLVERTLEPTRRALKDAGF-APSELDKVILVGGSTRIPAVQEAIKR
DNAK_BACCZ       ELTLTRAKFEELSAGLVERTLEPTRRALKDAGF-APSELDKVILVGGSTRIPAVQEAIKR
DNAK_BACHK       ELTLTRAKFEELSAGLVERTLEPTRRALKDAGF-APSELDKVILVGGSTRIPAVQEAIKR
DNAK_BACCR       ELTLTRAKFEELSAGLVERTLEPTRRALKDAGF-APSELDKVILVGGSTRIPAVQEAIKR
DNAK_BACC1       ELTLTRAKFEELSANLVERTLEPTRRALKDAGL-SASELDRVILVGGSTRIPAVQEAIKR
DNAK_BACSU       ELTLTRAKFEELSSHLVERTMGPVRQALQDAGL-SASEIDKVILVGGSTRIPAVQEAIKK
DNAK_BACLD       ELTLTRAKFEELSSHLVERTMGPVRQALQDAGL-SASEIDKVILVGGSTRIPAVQEAIKK
DNAK_GEOKA       EMTLTRAKFEELSAHLVERTMGPVRQALQDAGL-TPADIDKVILVGGSTRIPAVQEAIKR
DNAK_OCEIH       EMTMSRAKFDELSSDLVERTMQPTRKALSDASL-SKSDIDKVILVGGSTRIPAVQEAIKK
DNAK_BACHD       ELTLTRAKFEELSSHLVERTLGPTRQALQDSGL-SASEIDKVVLVGGSTRIPAVQEAIKN
DNAK_BACSK       ELTLTRAKFDELSADLVERTLGPTRRALSDAGL-SASDIDKVVLVGGSTRIPAVQEAIKK
DNAK_STRA3       EMSLSRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRA5       EMSLSRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRA1       EMSLSRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRP1       EMSLSRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRP6       EMSLSRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRP8       EMSLSRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRPM       EMSLSRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRP3       EMSLSRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRMU       ETSLSRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVDAVKA
DNAK_STRPN       EMTLTRAKFDDLTRDLVERTKVPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRR6       EMTLTRAKFDDLTRDLVERTKVPVRQALSDAGL-SLSEIDEVILVGGSTRIPAVVEAVKA
DNAK_STRT1       EMTLTRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSDIDEVILVGGSTRIPAVVEAVKA
DNAK_STRT2       EMTLTRAKFDDLTRDLVERTKTPVRQALSDAGL-SLSDIDEVILVGGSTRIPAVVEAVKA
DNAK_LACLA       EMALTRAKFDELTHDLVEATRQPVRQALSDAGL-STSDIDEVLLVGGSTRIPAVVELVRH
DNAK_ENTFA       EMNLTRAKFDELTSDLVERTKVPVRQALKDAGL-NPSEIDEVILVGGSTRIPAVVEAVRK
DNAK_LISMF       EVTLTRAKFDELTHDLVERTIAPTRQALKDANL-SASDIDQVILVGGSTRIPAVQETIKK
DNAK_LISMO       EVTLTRAKFDELTHDLVERTIAPTRQALKDANL-SASDIDQVILVGGSTRIPAVQETIKK
DNAK_LISIN       EVTLTRAKFDELTHDLVERTIAPTRQALKDANL-SASDIDQVILVGGSTRIPAVQETIKK
DNAK_STAAC       EVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGL-TNSDIDEVILVGGSTRIPAVQEAVKK
DNAK_STAAM       EVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGL-TNSDIDEVILVGGSTRIPAVQEAVKK
DNAK_STAAN       EVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGL-TNSDIDEVILVGGSTRIPAVQEAVKK
DNAK_STAAR       EVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGL-TNSDIDEVILVGGSTRIPAVQEAVKK
DNAK_STAAS       EVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGL-TNSDIDEVILVGGSTRIPAVQEAVKK
DNAK_STAAW       EVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGL-TNSDIDEVILVGGSTRIPAVQEAVKK
DNAK_STAES       EISLTRSKFEELADSLIKKTMEPTRQALKDAGL-STSEIDEVILVGGSTRIPAVQEAVKK
DNAK_STAEQ       EISLTRSKFEELADSLIKKTMEPTRQALKDAGL-STSEIDEVILVGGSTRIPAVQEAVKK
DNAK_STAHJ       EISLTRSKFEELADSLIRRTMEPTRQALKDAGL-STSEIDEVILVGGSTRIPAVQEAVKK
DNAK_STAS1       ELTLTRSKFEELADSLIRRTMEPTRQAMKDAGL-SSSDIDEVILVGGSTRIPAVQEAVKK
DNAK_LACAC       EADLTRAKFDELTNDLVEKTKIPFDNALKDAGL-TVNDIDKVILNGGSTRIPAVQKAVKE
DNAK_LACJO       EADLTRAKFDELTDDLVQKTKVAFDNALSDAGL-TVNDIDKVILNGGSTRIPAVQKAVKD
DNAK_LACSK       EMTLSRTEFDRLTSDLVDRTKAPVMNALKDAGL-DANEIDKVILNGGSTRIPAVQEAVKN
DNAK_LACSS       EMTLSRTEFDRLTSDLVDRTKAPVMNALKDAGL-DANEIDKVILNGGSTRIPAVQEAVKN
DNAK_LACPL       ETTLTRAKFNELTADLVEKTRIPVENALKDADL-SASDLDVVILNGGSTRIPAVQEAVEK
DNAK_ONYPE       EYNMTRAKFNELTKDLIDRCLAPVKRALGDAKL-DIEKIDQVLLVGGSTRIPAVQDLVKN
DNAK_TROWT       DTTITRAQFEKMTEDLLERTKNPFRDVLKEAGV-SVDKISHVVLVGGSTRMPAVSDLVKR
DNAK_TROW8       DTTITRAQFEKMTEDLLERTKNPFRDVLKEAGV-SVDKISHVVLVGGSTRMPAVSDLVKR
DNAK_LEIXX       DETLTRAQFEQMTSDLLDRTKKPFKDVIKEAGI-EVSDIAHVVLVGGSTRMPAVSELVKQ
DNAK_BIFLO       DETLTRAHFEEMTSDLLGRCRTPFNNVLHDAGI-SVSDIDHVVLVGGSTRMPAVKELVKE
DNAK_COREF       DENLSRAEFQRITQDLLDRTKTPFNQVIKDAGI-SVSEIDHVVLVGGSTRMPAVTDLVKE
DNAK_CORGL       DETLSRAEFQRITQDLLARTKTPFNQVVKDAGV-SVSEIDHVVLVGGSTRMPAVTELVKE
DNAK_CORDI       DETLSRTEFQRITQDLLDRTKTPFNQVIKDAGV-TVSEIDHVVLVGGSTRMPAVSELVKE
DNAK_CORJK       DETLTRTEFQKITQDLLDRTKTPFQAVLKDAEI-SVDEIDHVVLVGGSTRMVAVSELVTE
DNAK_MYCLE       DEQLIRAEFQRITQDLLDRTRQPFQSVVKDAGI-SVSEIDHVVLVGGSTRMPAVTDLVKE
DNAK_MYCPA       DEQLTRAEFQRITQDLLDRTRQPFKSVIADAGI-SVSDIDHVVLVGGSTRMPAVTDLVKE
DNAK_MYCTU       DEQLTRAEFQRITQDLLDRTRKPFQSVIADTGI-SVSEIDHVVLVGGSTRMPAVTDLVKE
DNAK_MYCBO       DEQLTRAEFQRITQDLLDRTRKPFQSVIADTGI-SVSEIDHVVLVGGSTRMPAVTDLVKE
DNAK_NOCFA       DEQLSRAEFQKITSDLLDRTRAPFQQVIKDAGI-SVSDIDHVVLVGGSTRMPAVSDLVRE
DNAK1_STRAW      DEKLTRAQFQQLTADLLERCKTPFHNVIKDAGI-NLSEIDHVVLVGGSTRMPAVAELVKE
DNAK_STRCO       DEKLTRAQFQQLTSDLLERCKTPFHNVIKDAGI-QLSEIDHVVLVGGSTRMPAVAELVKE
DNAK_THEFY       DEKLTRAEFQRLTSHLLERTKGPFFQVIKDAGI-SVDQIDHVVLVGGSTRMPAVVDLVRE
DNAK_CUTAK       DEKLTRAEFQRMTSDLLERCRTPFNAVMKDAGL-NVSQIDEVILVGGSTRMPAVAELVKE
DNAK_HALMA       EQKITRAKFESLTEDLIERTVGPTEQALADADY-TKSDIDEVILVGGSTRMPQVQDQVEE
DNAK_NATPD       EESISRAKFESLTSDLVERTVGPTEQALDDAGY-SKGDIDEVILVGGSTRMPMVQEKVEE
DNAK_HALSA       EQDITRATFESITEDLIERTVGPTEQALEDAGL-SKSDIDDVILVGGSTRMPQVQAQVED
DNAK_AGRFC       TLKLTRAKFESLVDDLVQRTVAPCKAALKDAGV-TAAEIDEVVLVGGMSRMPKVQEVVKQ
DNAK_RHIME       TMKLSRAKFESLVEDLIQKTIAPCKAALKDAGV-SAAEIDEVVLVGGMTRMPKVQETVKQ
DNAK_RHILO       TLKLTRAKFESLVEDLVQRTIDPCKAALKDAGL-KAGEIDEVVLVGGMTRMPKIQEIVKQ
DNAK_BRUME       AIKLSRAKFESLVDDLVQRTVEPCKAALKDAGL-KAGEIDEVVLVGGMTRMPKIQEVVKA
DNAK_BRUAB       AIKLSRAKFESLVDDLVQRTVEPCKAALKDAGL-KAGEIDEVVLVGGMTRMPKIQEVVKA
DNAK_BRUSU       AIKLSRAKFESLVDDLVQRTVEPCKAALKDAGL-KAGEIDEVVLVGGMTRMPKIQEVVKA
DNAK_BARHE       TMKLTRAKFESLVDDLVKRTVEPCKAALKDAGL-KAGEIDEVVLVGGMTRMPKIQEVVQS
DNAK_BARQU       TMKLTRAKFESLVDDLVQRTIEPCKAALKDAGL-KAGEIDEVVLVGGMTRMPKIQEVVQS
DNAK_BRADU       TMKLTRAKFEALVDDLIQKTVEPCRKALKDAGV-TAGEIGEVVLVGGMSRMPKVQEVVKQ
DNAK_NITWN       TMKLTRAKFEALVDDLVQKTIEPCRKALKDAGL-TAGEIGEVVLVGGMTRMPKVQEVVKQ
DNAK_RHOPA       TMKLTRAKFEALVDDLVQKTIEPCRKALKDAGL-TAGEISEVVLVGGMTRMPKVQEVVKQ
DNAK_CAUVC       NIKLSRAKLEALVDDLIARTIGPCEQALKDAGL-KKSDIDEVILVGGMSRMPKVQQAVQD
DNAK_ZYMMO       VKTISRAELERLVADLIDRTLEPVKKALADAGV-KASDIDDVVMVGGMTRMPKVRQVVKE
DNAK_RHOS4       VMKLTRAKLESLVGDLIKKSLKPCEAALKDAGV-SKSDIDEVVLVGGMTRMPRVVEEVTK
DNAK_RUEPO       VMKLTRAKLESLVGDLIKKSMDPCKAALKDAGI-SPSDVDEVVLVGGMTRMPKVFEEVTK
DNAK_RICFE       NIKFTRAELEKLVDDLIEKTIEPCRQALKDAGF-KPTDIQEVVLVGGMTRMPKVQEAVKK
DNAK_RICTY       NIKFTRAELEKLVDDLIEKTIEPCRQALKDAGF-KPTDIQEVVLVGGMTRMPKVQEAVKK
DNAK_RICPR       NIKFTRAELEKLVDDLIEKTIEPCRQALKDAGF-KPNDIQEVVLVGGMTRMPKVQEAVKK
DNAK_RICCN       NIKFTRAELEKLVDDLIEKTIEPCRKALQDAGF-KASDIQEVVLVGGMTRMPKVQEAVKK
DNAK_PELUB       NLKMTRAKLEALVEDLISRTLPPCKTALKDAGL-TASEIDEIVMVGGMTRMPKVLSEVKN
DNAK_EHRRG       SLKLTRATFENLVSDLVKRTIEPCKKALKDAGI-SADKIDEVVLVGGMTRVPKIIQTVKE
DNAK_EHRRW       SLKLTRATFENLVSDLVKRTIEPCKKALKDAGI-SADKIDEVVLVGGMTRVPKIIQTVKE
DNAK_EHRCJ       SLKLTRAKFENLVDDLIQRTIEPCKKALKDAGI-SADKIDEVVLVGGMTRVPKVIQKVKE
DNAK_ANAMM       SLKLTRAKFEGLVSELIERTIEPCKKALDDAGIKDTSKIDEVVLVGGMTRMPKVIQRVKD
DNAK_WOLPM       NMKLTRAKLESLVNDLIERTMAPCKKALEDAGL-SASQIGEVVLVGGMTRMPKVIEKVKE
DNAK_WOLTR       NMKLTRAKLESLVNDLIERTMTPCKKALEDTGL-SANQIGEVVLVGGMTRMPRVIEKVKE
DNAK_BORBR       NLKITRAKLEALVEELIERTIEPCRVAIKDAGV-KVSDIDDVILVGGMTRMPKVQDKVKE
DNAK_BORPE       NLKITRAKLEALVEELIERTIEPCRVAIKDAGV-KVSDIDDVILVGGMTRMPKVQDKVKE
DNAK_BORPA       NLKITRAKLEALVEELIERTIEPCRVAIKDAGV-KVSDIDDVILVGGMTRMPKVQDKVKE
DNAK_BURPS       NLKVTRAKLEALVEDLVERTIEPCRTAIKDAGV-KVSDIDDVILVGGQTRMPKVQEKVKE
DNAK_BURMA       NLKVTRAKLEALVEDLVERTIEPCRTAIKDAGV-KVSDIDDVILVGGQTRMPKVQEKVKE
DNAK_BURP1       NLKVTRAKLEALVEDLVERTIEPCRTAIKDAGV-KVSDIDDVILVGGQTRMPKVQEKVKE
DNAK_BURL3       NLKITRAKLEALVEDLVERTIEPCRIAIKDAGV-KVSDIDDVILVGGQTRMPKVLEKVKE
DNAK_RALSO       NLKITRAKLEALVEDLIARTIEPCRTAIKDAGV-KVSDIHDVILVGGMTRMPKVQEKVKE
DNAK_CUPPJ       NLKITRAKLEALVEDLITRTIEPCRTAIKDAGV-KVSEIDDVILVGGMTRMPKVQEQVKE
DNAK_AROAE       AVKITRAKFESLVEDLVQRTIEPCRVALKDAGL-KINDIDDVILVGGQSRMPKVQEKVKE
DNAK_THIDA       AVKITRAKFESLVEELITRTIEPCKLALKDAGL-TTSQIDDVILVGGQTRMPKVMDAVKD
DNAK_DECAR       ALKITRAKFESLVDELIERTMAPCVTALKDAGC-KISDIDDIILVGGQSRMPKVQEKVKE
DNAK_NITEU       AVKITRAKLESLVEELIERTAGPCRTALKDAGL-SVSDINDVILVGGQTRMPKVQEKVKE
DNAK_NEIMA       AMKITRAKFESLVEDLIARSIEPCRTALKDAGL-STGDIDDVILVGGQSRMPKVQEAVRD
DNAK_NEIG1       AMKITRAKFESLVEDLIARSIEPCRTALKDAGL-STGDIDDVILVGGQSRMPKVQEAVKD
DNAK_NEIMB       AMKITRAKFESLVEDLITRSIEPCKIALKDAGL-STGDIDDVILVGGQSRMPKVQEAVKA
DNAK_CHRVO       AMKITRAKFESLVDDLIARSIEPCRVALKDAGV-SLSDITDVILVGGQTRMPKVQDAVKE
DNAK_BUCAI       NIKVTRAKLESLVEDLILRSIEPLKVALKDAGL-SVTDINDVILVGGQTRMPMVQSKVAD
DNAK_BUCAP       NIKVTRSKLESLVEDLVMRSIEPLKVALKDAGL-SVGDINDVILVGGQTRMPMVQSKVAD
DNAK_BUCBP       NIKVTRSKLESLVEDLITRSIEPLKIALKDAKL-SISDIDDVILVGGQTRMPMVQKKVAE
DNAK_BLOFL       NLRVTRAKLESLVEDLVNRTLDPLKTALKDANL-SVSSVNDVILVGGQTRMPLVQKKVSE
DNAK_BLOPB       NIRVTRAKLESLVEDLVNRTMEPLKVALKDANL-SVSNINDVILVGGQTRMPLVQKKVSE
DNAK_WIGBR       NIKVTRAKLESLVEELIYKTLEPVKTSLKDAKL-KIIDIKDVILVGGQTRMPLVQKKVSD
DNAK_ECOLI       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIDDVILVGGQTRMPMVQKKVAE
DNAK_ECOL6       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIDDVILVGGQTRMPMVQKKVAE
DNAK_ECO57       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIDDVILVGGQTRMPMVQKKVAE
DNAK_SHIBS       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIDDVILVGGQTRMPMVQKKVAE
DNAK_SHIDS       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIDDVILVGGQTRMPMVQKKVAE
DNAK_SHISS       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIDDVILVGGQTRMPMVQKKVAE
DNAK_SHIFL       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIDDVILVGGQTRMPMVQKKVAE
DNAK_SALTI       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDINDVILVGGQTRMPMVQKKVAE
DNAK_SALPA       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDINDVILVGGQTRMPMVQKKVAE
DNAK_SALTY       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDINDVILVGGQTRMPMVQKKVAE
DNAK_SALCH       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDINDVILVGGQTRMPMVQKKVAE
DNAK_YERPE       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIQDVILVGGQTRMPMVQKKVAD
DNAK_YERPS       NIKVTRAKLESLVEDLVNRSIEPLKVALQDAGL-SVSDIQDVILVGGQTRMPMVQKKVAD
DNAK_PHOLL       NIKVTRAKLESLVEDLVKRSMEPVRVALQDAGL-SVSDVNDVILVGGQTRMPMVQKVVAD
DNAK_PECAS       NIKVTRAKLESLVEELVNRSLEPLKVALQDAGL-SVSEIQDVILVGGQTRMPLVQKKVAD
DNAK_PASMU       NIKLTRAKLESLVEDLVSRSLEPVKIALADAGL-SVSQIDDVILVGGQTRMPLVQQKVEA
DNAK_MANSM       NIKLTRAKLEALVEDLVARSMEPVKVALSDAGL-SVSQIDDVILVGGQTRMPLVQQKVAE
DNAK_HAEIN       ALNITRAKLEALVEDLVASSIESLKAVLKDADK-GVSEIHDIILVGGQTRMPLVQQKVAE
DNAK_HAEI8       ALNITRAKLEALVEDLVASSIESLKAVLKDADK-GVSEIHDIILVGGQTRMPLVQQKVAE
DNAK_HAEDU       NIKVTRAKLEALVEDLVSRSLEPLKTALADAGL-SVSEINDVILVGGQTRMPLVQKKVAD
DNAK2_COLP3      NIKVTRAKLESLVEDMVKATLEPLKQALKDADL-SVSKIDDVILVGGQSRMPLVQKTVTD
DNAK_PSEHT       NVKLTRAKLESLVEDLVTKSIEPLKRALADADL-SVSDINDIILVGGQTRMPLVQKTVAE
DNAK_SHEON       VVKITRAKLESLVEDLIIRTLEPLKVALADADL-SVSDINEVILVGGQTRMPKVQEAVTN
DNAK_VIBVU       NIKVTRAKLESLVEDLVQRSLEPLKVALADADL-SVGDITDVILVGGQTRMPMVQAKVTE
DNAK_VIBVY       NIKVTRAKLESLVEDLVQRSLEPLKVALADADL-SVGDITDVILVGGQTRMPMVQAKVTE
DNAK_VIBPA       NIKVTRAKLESLVEDLVQRSLEPLKVALADADL-SVNDITDVILVGGQTRMPMVQAKVAE
DNAK_VIBCH       NIKVTRAKLEALVEDLVQRSLEPLKVALADADL-SVNDITDVILVGGQTRMPMVQKKVAE
DNAK1_ALIF1      NIKVTRAKLESLVEDLVVRTLEPLKVALADADL-TIDGITDVILVGGQTRMPMVQAKVAE
DNAK2_ALIF1      NVKVTRAKLESLVEDLVLRSLEPLKVALADADL-SVDEITDVILVGGQTRMPMVQAKVAE
DNAK1_PHOPR      NIKVTRAKLESLVEDLVQRSLEPLKVALSDAGL-SVSEITDIIVVGGQTRMPMVQAKVAE
DNAK2_PHOPR      NVKVTRAKLESLVEDLVQRTLEPLKIALTDANL-SITDITDVILVGGQTRMPMVQAKVTE
DNAK_IDILO       AIKVTRAKLESLVEDLIKKSLEPLKQALADADL-SVSDIQDIIMVGGQTRMPKVQAAVTD
DNAK_XANAC       NIKLTRAKLEALVEDLVKKSIEPCRTALNDAGL-RASDINEVILVGGQTRMPKVQQAVAD
DNAK_XANC5       NIKLTRAKLEALVEDLVKKSIEPCRTALNDAGL-RASDINEVILVGGQTRMPKVQQAVAD
DNAK_XANCP       NIKLTRAKLEALVEDLVKKSIEPCRTALNDAGL-RASDINEVILVGGQTRMPKVQQAVAD
DNAK_XANC8       NIKLTRAKLEALVEDLVKKSIEPCRTALNDAGL-RASDINEVILVGGQTRMPKVQQAVAD
DNAK_XANOR       NIKLTRAKLEALVEDLVKKSIEPCRTALNDAGL-RASDINEVILVGGQTRMPKVQQAVAD
DNAK_XYLFA       NIKLTRAKLEALVDDLVRKSIEPCRIALNDAGL-RTSDVQEVILVGGQTRMPKVQQAVAD
DNAK_XYLFT       NIKLTRAKLEALVDDLVRKSIEPCRIALNDAGL-RTSDVQEVILVGGQTRMPKVQQAVAD
DNAK_PSEPK       NVKISRAKLESLVEDLVKRTIEPCRIALKDAGI-DASKIDDVILVGGQTRMPLVQKEVAD
DNAK_PSEPF       NVKISRAKLESLVEDLVTRTIEPCRIALKDAGI-DASKIDDVILVGGQTRMPMVQKAVSD
DNAK_PSE14       VVKISRSKLESLVEDLVQRTIAPCEMALKDAGI-DRSKINDVILVGGQTRMPLVQKLVTE
DNAK_PSEU2       VVKISRSKLESLVEDLVQRTIAPCEMALKDAGI-DRSKINDVILVGGQTRMPLVQKLVTE
DNAK_PSESM       VVKISRSKLESLVEDLVQRTIEPCRIALKDAGI-DIGKINDVILVGGQTRMPLVQKLVTE
DNAK_PSEF5       NVKISRAKLESLVEDLVQRTIEPCRIALKDAGI-DVGSINDVILVGGQTRMPLVQKTVTD
DNAK_PSEAE       NVKVSRAKLESLVEDLVQRTIEPCRTALKDAGL-DVSDIHEVILVGGQTRMPLVQKTVAE
DNAK_ACIAD       VINVTRAKLEGLVADLVARTIEPCRIALKDAGL-STSDISDVILVGGQSRMPMVQQKVQE
DNAK_PSYA2       VVTISRSKLESLTEELVQRTMGPCKMALEDAGI-KIGDIDDVILVGGQTRMPLVQQKVQE
DNAK_FRATT       NIKVTRAKFESLVSDLVMRSLEPCKKALEDAGL-SKSDITEVLLVGGQTRMPLVQEKVKE
DNAK_LEGPH       NIKLTRAKLESLVEKLVERTIEPCKTALKDAGL-TVSQINEVILVGGQTRMPLVQKTVEE
DNAK_LEGPL       NIKLTRAKLESLVEKLVERTIEPCKTALKDAGL-TVSQINEVILVGGQTRMPLVQKTVEE
DNAK_LEGPA       NIKLTRAKLESLVEKLVERTIEPCKTALKDAGL-TVSQINEVILVGGQTRMPLVQKTVEE
DNAK_COXBU       NIRLTRAKLESLVEDLVERTIEPCKVAIKDAGL-KVSEIDDVILVGGQTRMPKVQEAVKN
DNAK_METCA       NVKLTRAKLEALVEDLILRTRGPCETALKDAGL-KSADIDEVILVGGQTRMPKVQEFVKE
DNAK_NITOC       NVRITRAKLESLVEDLINRTIGPCKTALQDAKL-SASDIDEVILVGGQTRMPKVQEAAKE
DNAK1_COLP3      NVKVTRAKLESLVDDLVKSTIAPCEQALKDAGL-SKADVSEVILVGGQTRMPKVQEAVKT
DNAK_DESAG       MIKLSRAKLEKLVEDLVERTIEPCRKALSDAGL-SASEVDEVVLVGGMTRMPLVQKKVAD
DNAK_DESVH       MMKLSRAKLEKLVEDLVERTVEPCRKALADAGL-TAAQIDEVVLVGGMTRMPLVQKRVSE
DNAK_GEOSL       TMKLSRAKLEALCADLLNKLEGPCRTALKDAGL-SPSEVDEVILVGGMTRMPAVQKRVQE
DNAK_PELCD       NLRLTRSKLESICSSLLAKLVEPCRMALKDAGL-SASDVDEVLLVGGMTRMPAVQAKVQE
DNAK_DESPS       NIKLSRSKFETLVEDLVERTVGPCKTALKDAGL-SASQIDEVILVGGMSRMPMVQKKVVE
DNAK_CAMJE       VKKLTRAKFEGMIDSLVAETITKINEVVSDAGL-KKDEIKEIVMVGGSTRVPLVQEEVKK
DNAK_CAMJR       VKKLTRAKFEGMIDSLVAETITKINEVVSDAGL-KKDEIKEIVMVGGSTRVPLVQEEVKK
DNAK_HELHP       VKKITRAKFESLIDDLIEDTIKKIEFVIKDAGL-SQSDISEVVMVGGSTRIPKVQERVKA
DNAK_WOLSU       VKKISRAKFESLIDDLIEQTIQKIDFVIKDAGL-AKSDIAEVVMVGGSTRIPKVQQRVKD
DNAK_HELPY       VKKLTRAKFESLTEDLMKETISKIESVIKDAGL-TKNEISEVVMVGGSTRIPKVQERVKA
DNAK_HELPJ       VKKLTRAKFESLTEDLVEETISKIESVIKDAGL-TKNEISEVVMVGGSTRIPKVQERVKA
DNAK_FUSNN       EMKLTRAKFNDLTKHLVEATQGPTKTALKDASL-EANQIDEILLVGGSTRIPAVQEWVEN
DNAK_RHOBA       TMKITRSKFEELIDALVERCRGPVLQALKDAGM-DPKDIDEVVLVGGSTRVPKVREVVKS
DNAK_BACFN       VKTLTRAKFESLAHNLIQACLEPCKKAMQDAGL-SNSDIDEVILVGGSSRIPAVQKLVED
DNAK_BACFR       VKTLTRAKFESLAHNLIQACLEPCKKAMQDAGL-SNSDIDEVILVGGSSRIPAVQKLVED
DNAK_BACTN       VKTLTRAKFESLAHGLIQACLEPCKKAMSDAGL-SNSDIDEVILVGGSSRIPAVQKLVED
DNAK_PORGI       VMTLTRAKFEQLADRLIQACVAPCETALKDAGM-SRGDIDEVILVGGSTRIPAIQEIVEK
DNAK_CHLTE       VINLTRAKFEAMSAALFDKLFEPCRRAIKNSKF-DIKEIDEVVLVGGSTRIPKVQALVKE
DNAK_CHLCH       VINLTRAKFEAISADLFNKVLDPCRRAVKNAKI-EMREIDEVVLVGGSTRIPKIQALVKE
DNAK_BORBU       QYTLTRAKFEQMVDHLVQKTKEPCLKAIKDAGL-KASDINEVILVGGSTRIPAIQKIVKD
DNAK_BORBP       QYTLTRAKFEQMVDHLVQKTKEPCLKAIKDAGL-KASDINEVILVGGSTRIPAIQKIVKD
DNAK_TREPA       QRTLSRSEFEKMTDDLFERTKEPCRKALKDAGI-SADRIDEILLVGGSTRMPKVAHVIKD
DNAK_TREDE       QKSLSRAKFEQMTEDLFERTKEPCRKALKDAGI-TPDKIDDILLVGGSTRMPKVLQIIKE
DNAK_LEPIC       DMTLTRAKFDQLTKSLVDRTRIPCENALRDAGL-KASDINEVILVGGSIRIPAVQELVKQ
DNAK_LEPIN       DMTLTRAKFDQLTKSLVDRTRIPCENALRDAGL-KASDINEVILVGGSIRIPAVQELVKQ
DNAK_BDEBA       QTRLSRAKFDQMTEDLVKRSMEPCRKALADSGL-KASEIDEVVLVGGSTRIPAIQKAVKD
DNAK_CHLAB       TLTLTRAHFEKLASNLIERTKAPCQKALADAKL-AASDIDDVLLVGGMSRMPAVQEVVKS
DNAK_CHLCV       TLTLTRAHFEKLASTLLERTKAPCQKALADAKL-SASDIDDVLLVGGMSRMPAVQEVVKS
DNAK_CHLPN       ALTLTRAQFEKLAASLIERTKSPCIKALSDAKL-SAKDIDDVLLVGGMSRMPAVQETVKE
DNAK_CHLTR       ALTLTRAQFEHLASSLIERTKQPCAQALKDAKL-SASDIDDVLLVGGMSRMPAVQAVVKE
DNAK_CHLTA       ALTLTRAQFEHLASSLIERTKQPCAQALKDAKL-SASDIDDVLLVGGMSRMPAVQAVVKE
DNAK_CHLMU       ALTLTRAQFEHLASSLIERTKQPCAQALKDAKL-SASDIDDVLLVGGMSRMPAVQAVVKE
DNAK_PARUW       TMTLTRSKLESLTHDLIERTREPCLKALKDSGL-NKDDISEVILVGGMSRMPAVQEVVKS
DNAK_DEHM1       NIILTRAKLEQMVMDLVDKSLEPCRQALKDSGK-TASEINEVILVGGQTRMPLVQQKVKE
DNAK_DEHMC       NIILTRSKLEQMVMDLVEKSLEPCRQALKDSGK-TSAEINEVILVGGQTRMPLVQQKVKD
DNAK_CLOPE       DMTLTRAKFNELTHDLVERTINIMKEALKSGNV-SLNDIDKVILVGGSTRIPAVQEAVKN
DNAK_CLOTE       DMNLTRAKFNELTQDLVEGTLTPMKKALQDAEM-SIGEIDKVILVGGSTRIPAVQDAVKN
DNAK_CLOAB       DMNLTRAKFNELTEGLVQDTIEPMKKALSDAGL-SINDIDKIVLVGGSTRIPAVQEAVKN
DNAK_METAC       DIDLTRAQFQKMTEDLLEKTLVSMRRALSDSKL-TPNDLDKVILVGGATRMPAVVELVEN
DNAK_METMA       DIDLTRAQFQKMTEDLLEKTLVSMRRALSDAKL-TPNDLDKVILVGGATRMPAVVELVEN
DNAK_METBF       DIDLTRAQFQKMTEDLLEKTLVSMRQALSDAKL-TPNDLDKVILVGGATRMPAVVELVEN
DNAK_CALS4       DVNLTRAKFEELISDLVESTVGPVKQALSDAGL-KPEDIDKVLLVGGSTRIPLVQETVKK
DNAK_CARHZ       DVTLTRAKFNELTADLVEATMGPTRQALADAGL-KPEDIDKILLVGGSTRIPAVQEAIRK
DNAK_SYMTH       DETLTRAKFEELTADLVEATMGPTRQALQDAGL-EPGEIDKVLLVGGSTRIPAVQEAVRR
DNAK_AQUAE       QKKLTRARLEEMIKDIVDRTIDIVKQALEDAKL-KPSDIDEVVLVGGSTRIPLVQQRIKE
DNAK_THEMA       EMRITRSLFESLTRDLVEMTRGPIEQALNDAKL-SPQDIDEIILVGGMTRVPMVQRFIKE
DNAK_THEAC       KMTLTRAKLEELISPIVERVKGPIDKALEGAKL-KKTEITKLLFVGGPTRIPYVRKYVED
DNAK_THEVO       KMTLTRAKLEELISPIVERVKAPIDKALEGAKL-KKTDITKLLFVGGPTRIPYVRKYVED
DNAK_PICTO       QYTLTRAKFEELIAPIVDRSKVPLDTALEGAKL-KKGDIDKIILIGGPTRIPYVRKYVED
DNAK_METTH       IKTITRAKLEELVDPIVQKCAGPMEQALRDAGM-TREDVDKIILVGGPTRMPIVQKFVED
DNAK3_NOSS1      EMELSRSKFEELVGQLIEATIQPMIQALKDADL-KPQDIDKIILVGGSTRIPAVQNALIK
DNAK1_THEEB      EMELTRSKFEELCAHLVQATLEPMQQAIADAGL-TVEEIDRVLLVGGSTRIPAIQE-LVK
DNAK3_SYNP6      EVELQREQFEVLASNLVQATIEPIQQALKDSNL-TIDQIDRILLVGGSSRIPAIQQAVQK
DNAK1_NOSS1      ETRLTRSQFEGLCVDLLGRVRNPVKRALKDAGL-RPDDIEEVVLVGGSTRMPMVKQLVRD
DNAK3_SYNY3      ETQLSRSEFEDLCGDLVTRLQRPVKRVLKDAGL-SPVQIDEVVLVGGGTRMPMVKGLVRS
DNAK3_THEEB      ETTLSRRQFEDLSQGLLQRLRYPVEQALMDAHL-TPSQIDAVVLVGGATRMPMVQDLVRQ
DNAK1_SYNP6      ETRLTRSEFEALCEDLLERMMRPLRRALKDARL-QPQDIDEVVLVGGSTRMPMVQQLVRS
DNAK1_PROMM      ETSLDRPTFEGLCPDLLDRLLNPVQTALRDSGW-SADDVDDVVLVGGGTRMPMVQQLLRT
DNAK1_SYNPX      ETNLDRSTFEGLCPDLLDRLLMPVQSALRDSGW-AADDIDDVVLVGGATRMPMVQQLVRT
DNAK1_PROMA      ETKLDRKTFESLCKDLIDRLLQPVEVALQDSGW-TADDINDVVLVGGGTRMPMVQQLVKT
DNAK1_PROMP      EEEFDRKLFESLSDDLLDRLLEPVQIALEDSGW-DAEQIDEVVLVGGSTRIPMVQQLVKT
DNAK_THET8       EKKLTRAKFEELIQPLLKRLRGPVEQALKDAGL-TPAQIDEVILVGGATRVPAVQQVVRE
DNAK_THET2       EKKLTRAKFEELIQPLLKRLRGPVEQALKDAGL-TPAQIDEVILVGGATRVPAVQQVVRE
DNAK_DEIRA       ERSLSRAKFEELTADLLRRVRQPVEQALSDAKL-SAGDINEVILVGGSTRIPAVKRIVQD
DNAK2_NOSS1      DMTLTRAKFEELCADLIDRCRIPVEQALRDAKL-KKENIDEVVLVGGSTRIPAVQQLVKN
DNAK2_SYNY3      DTTLSRAKFEEICSDLIDRCGIPVENAIRDAKI-DKSALDEIVLVGGSTRIPAVQEVVKK
DNAK2_THEEB      DMTLTRAKFEELCSDLIDRCRVPVEQALKDAKL-SKDQIDEVVLVGGSTRIPAIQELVKR
DNAK2_PROMA      DLTLTRAKFEELASNLIDRCRVPVEQALKDAKL-STGEIDEIVMVGGSTRMPAVKELVKR
DNAK_PROMT       DLTLTRGKFEELASNLIDRCRVPVEQALKDAKL-STGEIDEIVMVGGSTRMPAVKELVKR
DNAK2_PROMP      DLNLTRANFEELASKLIDRCRVPVEQALKDAKL-STGEIDEIVMVGGSTRMPAVQELVKR
DNAK2_PROMM      DLTLTRAKFEELASKLIDRCRVPVEQALKDAKL-SSGELDEIVMVGGSSRMPAVQELVKR
DNAK2_SYNPX      DLTLTRAKFEELAANLIDRCRIPVEQALKDAKL-SSSELDEIVMVGGSTRIPAVLELVKR
DNAK2_SYNP6      DLTLTRAKFEELASDLIDRCRIPVEQAIKDAKL-ALSEIDEIVLVGGSTRIPAVQAIVKQ
DNAK_GLOVI       DMSLTRAKFESLCADLLRRVEKPVEQALRDAKL-SKENIDEVVLVGGSTRIPAVQELVKR
DNAK2_STRAW      TDTVMRSTFEQITSDLVERCLGPVQQAMADAKV-GESDIDEVILVGGSTRIPAVQALVRR
                    . *  :: :   :.          :          :  ::. **  *:  :      

DNAK_MYCH7       TL-NKKPNRSINPDEVVAIGAAIQGGVLAGEIS---DVL-LLDVTPLTLGIETLGGIATP
DNAK_MYCHJ       TL-NKKPNRSINPDEVVAIGAAIQGGVLAGEIS---DVL-LLDVTPLTLGIETLGGIATP
DNAK_MYCPU       VL-GKKPNRSINPDEVVAIGAAIQGGVLAGDIN---DVL-LLDVTPLTLGIETLGGVATP
DNAK_MYCMO       EL-NKKPNHSINPDEVVAIGAAIQGAVLSGDIN---DVL-LLDVTPLTLGIETQGGIATP
DNAK_MYCS5       TL-GKEPNRSINPDEVVSIGAAIQGGVLAGHID---DIL-LLDVTPLTLGIETLGGVATP
DNAK_MYCHO       VT-NKKPNNSINPDEVVSVGAAIQGAILAGEIQ---DVL-LLDVTPLTLGIVVEGDVVAP
DNAK_UREPA       LT-GKEPNHSLNPDEVVAIGAAIQGGVLAGEID---DIL-LLDVTPLTLSIETMGGVATP
DNAK_MYCGE       MVPGKKPNRSINPDEVVAIGAAIQGGVLRGDVK---DVL-LLDVTPLTLSIETLGGVATP
DNAK_MYCPN       MVPGHSPNRSINPDEVVAIGAAIQGGVLRGDVK---DVL-LLDVTPLTLSIETLGGVATP
DNAK_MYCGA       MIPNKAPNRTINPDEVVAIGAAVQGGVLRGDVK---DIL-LLDVTPLTLAIETLGGVATP
DNAK_MYCPE       KL-GKSPDKNINPDEVVAAGAAIQGGVLMGDVK---DIL-LLDVTPLTLSIETMGGVSTP
DNAK_MESFL       LL-GKEPNRSINPDEVVAMGAAIQGGVLAGDVT---DVL-LLDVTPLSLGIETMGGVMTK
DNAK_MYCMS       LL-NKEPNRSINPDEVVAMGAAVQGGVLAGEVT---DIL-LLDVTPLSLGIETMGGVMTK
DNAK_BACAN       ET-GKEPYKGVNPDEVVALGAAVQGGVLTGDVE---GVL-LLDVTPLSLGIETMGGVFTK
DNAK_BACCZ       ET-GKEPYKGVNPDEVVALGAAVQGGVLTGDVE---GVL-LLDVTPLSLGIETMGGVFTK
DNAK_BACHK       ET-GKEPYKGVNPDEVVALGAAVQGGVLTGDVE---GVL-LLDVTPLSLGIETMGGVFTK
DNAK_BACCR       ET-GKEPYKGVNPDEVVALGAAVQGGVLTGDVE---GVL-LLDVTPLSLGIETMGGVFTK
DNAK_BACC1       ET-GKEPYKGVNPDEVVALGAAVQGGVLTGDVE---GVL-LLDVTPLSLGIETMGGVFTK
DNAK_BACSU       ET-GKEAHKGVNPDEVVALGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_BACLD       ET-GKEAHKGVNPDEVVALGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_GEOKA       EL-GKEPHKGVNPDEVVAIGAAIQGGVIAGEVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_OCEIH       EL-GQDPSKGVNPDEVVALGAAIQGGVLQGDVK---DVL-LLDVTPLSLGIETMGAVTTK
DNAK_BACHD       LT-GKEPHKGVNPDEVVALGAAVQAGVLTGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_BACSK       LT-GKDPHKGVNPDEVVALGAAVQAGVLTGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRA3       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRA5       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRA1       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRP1       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRP6       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRP8       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRPM       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRP3       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRMU       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRPN       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRR6       ET-GKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRT1       ET-GKEPNKSVNPDEVVAMGAAIQGGVISGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_STRT2       ET-GKEPNKSVNPDEVVAMGAAIQGGVISGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_LACLA       ET-NKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_ENTFA       ET-NKEPNKSVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_LISMF       EL-GKEPHKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVMTT
DNAK_LISMO       EL-GKEPHKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVMTT
DNAK_LISIN       EL-GKEPHKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVMTT
DNAK_STAAC       EI-GKEPNKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIEILGGRMNT
DNAK_STAAM       EI-GKEPNKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIEILGGRMNT
DNAK_STAAN       EI-GKEPNKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIEILGGRMNT
DNAK_STAAR       EI-GKEPNKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIEILGGRMNT
DNAK_STAAS       EI-GKEPNKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIEILGGRMNT
DNAK_STAAW       EI-GKEPNKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIEILGGRMNT
DNAK_STAES       EI-GKEPHKGVNPDEVVAMGAAIQAGVITGDVK---DVV-LLDVTPLSLGIEIMGGRMNT
DNAK_STAEQ       EI-GKEPHKGVNPDEVVAMGAAIQAGVITGDVK---DVV-LLDVTPLSLGIEIMGGRMNT
DNAK_STAHJ       EI-GKDPHKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIEIMGGRMNT
DNAK_STAS1       EV-GKDPHKGVNPDEVVAMGAAIQGGVITGDVK---DVV-LLDVTPLSLGIEIMGGRMNT
DNAK_LACAC       WA-GKEPDHSINPDEAVALGAAIQGGVISGDVK---DIV-LLDVTPLSLGIETMGGVFTK
DNAK_LACJO       WA-GKEPDHSINPDEAVALGAAIQGGVISGDVK---DIV-LLDVTPLSLGIETMGGVFTK
DNAK_LACSK       WT-GKEPDHSINPDEAVALGAAVQGGVISGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_LACSS       WT-GKEPDHSINPDEAVALGAAVQGGVISGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_LACPL       WT-GKESNHSINPDEAVALGAAVQGGVITGDVK---DVV-LLDVTPLSLGIETMGGVFTK
DNAK_ONYPE       EL-KKTPNKSINPDEVVGIGAAIQGGILSGDVK---DILTLLDVTPLSLGIETLGNVFTK
DNAK_TROWT       ETG-KEPNKGVNPDEVVAVGAALQAGVLRGERK---DVL-LIDVTPLSLGIETKGGIMTK
DNAK_TROW8       ETG-KEPNKGVNPDEVVAVGAALQAGVLRGERK---DVL-LIDVTPLSLGIETKGGIMTK
DNAK_LEIXX       ETGGQEPNKGVNPDEVVAVGAALQAGVLKGERK---DVL-LIDVTPLSLGIETKGGIMTK
DNAK_BIFLO       LTGGKEANQSVNPDEVVAVGAAVQSGVIKGDRK---DVL-LIDVTPLSLGIETKGGIMTK
DNAK_COREF       LTGGREPNKGVNPDEVVAVGAALQAGVLRGEVK---DVL-LLDVTPLSLGIETKGGVMTK
DNAK_CORGL       LTGGREPNKGVNPDEVVAVGAALQAGVLRGEVK---DVL-LLDVTPLSLGIETKGGVMTK
DNAK_CORDI       LTGGREPNKGVNPDEVVAVGAALQAGVLRGEVK---DVL-LLDVTPLSLGIETKGGVMTK
DNAK_CORJK       LTNGKEPNKGVNPDEVVAVGAALQAGVLRGEVK---DVL-LLDVTPLSLGIETKGGVMTK
DNAK_MYCLE       LTGGKEPNKGVNPDEVVAVGAALQAGVLKGEVK---DVL-LLDVTPLSLGIETKGGVMTK
DNAK_MYCPA       LTGGKEPNKGVNPDEVVAVGAALQAGVLKGEVK---DVL-LLDVTPLSLGIETKGGVMTK
DNAK_MYCTU       LTGGKEPNKGVNPDEVVAVGAALQAGVLKGEVK---DVL-LLDVTPLSLGIETKGGVMTR
DNAK_MYCBO       LTGGKEPNKGVNPDEVVAVGAALQAGVLKGEVK---DVL-LLDVTPLSLGIETKGGVMTR
DNAK_NOCFA       LTGGKEPNKGVNPDEVVAVGAALQAGVLKGEVK---DVL-LLDVTPLSLGIETKGGVMTK
DNAK1_STRAW      LTGGQDANKGVNPDEVVAIGAALQAGVLKGEVK---DVL-LLDVTPLSLGIETKGGIMTK
DNAK_STRCO       LTGGKDANKGVNPDEVVAIGAALQAGVLKGEVK---DVL-LLDVTPLSLGIETKGGIMTK
DNAK_THEFY       LTGGKEPNKGVNPDEVVAVGAALQAGVLKGDVK---DVL-LLDVTPLSLGIETKGGVFTK
DNAK_CUTAK       LAG-KDPHKGVNPDEVVALGASLQAGVLKGEVK---DVL-LLDVTPLSLGIETKGGVMTK
DNAK_HALMA       MTG-QEPKKNVNPDEAVALGAAIQAGVLSGDVD---DIV-LLDVTPLSLGVEVKGGLFER
DNAK_NATPD       LTG-QEPKKNVNPDEAVGLGAAIQGGVLSGDVD---DIV-LLDVTPLSLGIEVKGGLFER
DNAK_HALSA       LVG-QEPKKNVNPDEAVALGAAVQGGVLSGEVD---DIV-LVDVTPLSLGIEVKGGLFER
DNAK_AGRFC       LFG-KEPHKGVNPDEVVAMGAAIQAGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_RHIME       LFG-KEPHKGVNPDEVVAMGAAIQAGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_RHILO       FFG-KEPHKGVNPDEVVALGAAIQAGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_BRUME       FFG-KEPHKGVNPDEVVAMGAAIQGGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_BRUAB       FFG-KEPHKGVNPDEVVAMGAAIQGGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_BRUSU       FFG-KEPHKGVNPDEVVAMGAAIQGGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_BARHE       FFG-KDPHKGVNPDEVVAMGAAIQGGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_BARQU       FFG-KDPHKGVNPDEVVAMGAAIQGGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_BRADU       LFG-KEPHKGVNPDEVVAIGAAIQAGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_NITWN       LFG-KEPHKGVNPDEVVAIGAAIQAGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_RHOPA       LFG-KEPHKGVNPDEVVAIGAAIQAGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_CAUVC       FFG-REPHKGVNPDEVVALGAAVQAGVLQGDVK---DVL-LLDVTPLTLGIETLGGVFTP
DNAK_ZYMMO       FFG-KEPHTGVNPDEVVAMGAAIQAGVLQGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_RHOS4       FFG-KEPHKGVNPDEVVALGAAIQAGVLQGDVK---DVV-LLDVTPLSLGIETLGGVFTR
DNAK_RUEPO       FFG-KEPHKGVNPDEVVAMGAAIQAGVLQGDVK---DVV-LLDVTPLSLGIETLGGVFTR
DNAK_RICFE       FFG-REPHKGVNPDEVVALGAAIQGGVLNKEVT---DIL-LLDVTPLSLGIETLGGVFTR
DNAK_RICTY       FFG-REPHKGVNPDEVVALGAAIQGGVLNKEVT---DIL-LLDVTPLSLGIETLGGVFTR
DNAK_RICPR       FFG-REPHKGVNPDEVVALGAAIQGGVLNKEVT---DIL-LLDVTPLSLGIETLGGVFTR
DNAK_RICCN       FFG-REPHKGVNPDEVVALGAAIQGGVLNKEVT---DIL-LLDVTPLSLGIETLGGVFTR
DNAK_PELUB       FFG-KEPNKSVNPDEVVAMGAAIQAGVLQGDVK---DVL-LLDVTPLSLGIETLGGVSTK
DNAK_EHRRG       FFG-KEPHKGVNPDEVVAIGAAIQGGILAGDVR---DVL-LLDVTPLSLGIETLGGVFTP
DNAK_EHRRW       FFG-KEPHKGVNPDEVVAIGAAIQGGILAGDVR---DVL-LLDVTPLSLGIETLGGVFTP
DNAK_EHRCJ       FFG-REPHKGVNPDEVVAIGAAIQGSILAGDVR---DVL-LLDVTPLSLGIETLGGVFTP
DNAK_ANAMM       FFGGKEPCKGVNPDEVVAIGAAIQGGILTGDVR---DVL-LLDVAPLSLGIETLGGVFTP
DNAK_WOLPM       FFG-KDPHRGVNPDEVVAIGAAIQAGIIQGDVR---DVL-LLDVTPLSLGIETLGGVFTP
DNAK_WOLTR       FFG-KDPHRGVNPDEVVAIGAAIQAGIVQGDVR---DVL-LLDVTPLSLGIETLGGVFTP
DNAK_BORBR       FFG-REPRKDVNPDEAVAAGAAIQGSVLSGERK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_BORPE       FFG-REPRKDVNPDEAVAAGAAIQGSVLSGERK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_BORPA       FFG-REPRKDVNPDEAVAAGAAIQGSVLSGERK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_BURPS       FFG-KEPRRDVNPDEAVAVGAAIQGQVLSGDRK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_BURMA       FFG-KEPRRDVNPDEAVAVGAAIQGQVLSGDRK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_BURP1       FFG-KEPRRDVNPDEAVAVGAAIQGQVLSGDRK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_BURL3       FFG-KDPRRDVNPDEAVAVGAAIQGQVLSGDRK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_RALSO       FFG-KEARKDVNPDEAVAVGAAIQGQVLGGDRK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_CUPPJ       FFG-KEARKDVNPDEAVAVGAAIQGSVLSGDRK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_AROAE       FFG-KEARRDVNPDEAVAVGAAIQGGVLQGEVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_THIDA       FFG-KEPRRDVNPDEAVAVGAAIQGGVLQGEVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_DECAR       IFG-KEPRKDVNPDEAVAVGAAIQGGVLQGEVK---DVL-LLDVTPLSLGIETLGGIMTK
DNAK_NITEU       IFG-KEPRKDVNPDEAVAIGAAIQGGVLKGDVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_NEIMA       FFG-KEPRKDVNPDEAVAVGAAIQGEVLSGGRS---DVL-LLDVTPLSLGIETMGGVMTK
DNAK_NEIG1       FFG-KEPRKDVNPDEAVAVGAAIQGEVLSGGRS---DVL-LLDVTPLSLGIETMGGVMTK
DNAK_NEIMB       FFG-KEPRKDVNPDEAVAVGAAIQGEVLSGGRS---DVL-LLDVTPLSLGIETMGGVMTK
DNAK_CHRVO       FFG-KEPRKDVNPDEAVAVGAAIQGSVLSGDRK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_BUCAI       FFG-KEPRKDVNPDEAVAVGAAVQGGVLSGDVK---DVL-LLDVTPLSLGIETMGGIMTS
DNAK_BUCAP       FFG-KEPRKDVNPDEAVAVGAAVQGGVLSGDVK---DVL-LLDVTPLSLGIETMGGIMTS
DNAK_BUCBP       FFK-KEPRKDVNPDEAVAVGAAVQGGVLSGEVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_BLOFL       FFN-KEPRKDVNPDEAVAIGAAVQGGVLSGDVK---DVL-LLDVTPLSLGIETMGGVMTS
DNAK_BLOPB       FFR-KEPRRDVNPDEAVAIGAAVQGGVLSGDVK---DVL-LLDVTPLSLGIETMGGVMTS
DNAK_WIGBR       FFG-KEPRKDVNPDEAVAIGAAVQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_ECOLI       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_ECOL6       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_ECO57       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_SHIBS       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_SHIDS       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_SHISS       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_SHIFL       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_SALTI       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTP
DNAK_SALPA       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTP
DNAK_SALTY       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTP
DNAK_SALCH       FFG-KEPRKDVNPDEAVAIGAAVQGGVLTGDVK---DVL-LLDVTPLSLGIETMGGVMTP
DNAK_YERPE       FFG-KEPRKDVNPDEAVAIGAAVQGGVLSGEVK---DVL-LLDVTPLSLGIETMGGVMTP
DNAK_YERPS       FFG-KEPRKDVNPDEAVAIGAAVQGGVLSGEVK---DVL-LLDVTPLSLGIETMGGVMTP
DNAK_PHOLL       FFG-KEPRKDVNPDEAVAMGAAVQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVMTS
DNAK_PECAS       FFG-KEPRKDVNPDEAVAIGAAVQGGVLSGDVK---DVL-LLDVSPLSLGIETMGGVMTA
DNAK_PASMU       FFG-KAPRKDVNPDEAVAIGAAVQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_MANSM       FFG-KEPRKDVNPDEAVAVGAAVQGGVLAGNVT---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_HAEIN       FFG-KEARKDVNPDEAVAIGAAVQGGVLKGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_HAEI8       FFG-KEARKDVNPDEAVAIGAAVQGGVLKGDVK---DVL-LLDVTPLSLGIETMGGVMTT
DNAK_HAEDU       FFG-KEPRKDVNPDEAVAIGAAVQGGVLAGDVT---DVL-LLDVTPLSLGIETMGGVMTS
DNAK2_COLP3      FFG-KEPRKDVNPDEAVASGAAIQAGVLSGDVT---DVL-LLDVTPLSLGIETMGGVMTK
DNAK_PSEHT       FFG-KEPRKDVNPDEAVAVGAAIQGGVLAGDVK---DVL-LLDVSPLSLGIETMGSVMTA
DNAK_SHEON       FFG-KEPRKDVNPDEAVAVGAAIQAGVLSGDVK---DVL-LLDVTPLSLGIETMGSVMTK
DNAK_VIBVU       FFG-KEPRRDVNPDEAVAVGAAVQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVMTK
DNAK_VIBVY       FFG-KEPRRDVNPDEAVAVGAAVQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVMTK
DNAK_VIBPA       FFG-KEARRDVNPDEAVAMGAAVQGGVLAGEVK---DVL-LLDVTPLSLGIETMGGVMTK
DNAK_VIBCH       FFG-KEPRKDVNPDEAVAVGAAVQGGVLAGEVK---DVL-LLDVTPLSLGIETMGGVMTK
DNAK1_ALIF1      FFG-KEARRDVNPDEAVAMGAAVQGGVLAGDVK---DVL-LLDVTPLSFGIETMGGVMTK
DNAK2_ALIF1      FFG-KEARRDVNPDEAVAMGAAVQGGVLAGDVK---DVL-LLDVTPLSFGIETMGGVMTK
DNAK1_PHOPR      FFG-KEPRKDVNPDEAVAVGAAVQAGVLAGDVK---DVL-LLDVTPLSLGIETMGGVMTK
DNAK2_PHOPR      FFG-KEPRKDVNPDEAVAVGAAIQAGVLAGEVK---DVL-LLDVTPLSLGIETMGGVMTK
DNAK_IDILO       FFG-KEPRRDVNPDEAVAVGAAVQAGVLQGDVK---DVL-LLDVCPLSLGIETMGGVMTK
DNAK_XANAC       FFG-KEPRKDVNPDEAVAVGAAIQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVFTK
DNAK_XANC5       FFG-KEPRKDVNPDEAVAVGAAIQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVFTK
DNAK_XANCP       FFG-KEPRKDVNPDEAVAVGAAIQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVFTK
DNAK_XANC8       FFG-KEPRKDVNPDEAVAVGAAIQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVFTK
DNAK_XANOR       FFG-KEPRKDVNPDEAVAVGAAIQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVFTK
DNAK_XYLFA       FFG-KEPRKDVNPDEAVALGAAIQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVFTK
DNAK_XYLFT       FFG-KEPRKDVNPDEAVALGAAIQGGVLAGDVK---DVL-LLDVTPLSLGIETMGGVFTK
DNAK_PSEPK       FFG-KEARKDVNPDEAVAMGAAIQGAVLAGDVK---DVL-LLDVSPLTLGIETMGGVMTA
DNAK_PSEPF       FFG-KEARKDVNPDEAVAMGAAIQGAVLAGDVK---DVL-LLDVSPLTLGIETMGGVMTA
DNAK_PSE14       FFG-KEARKDVNPDEAVAMGAAIQGAVLAGDVK---DVL-LLDVSPLTLGIETMGGVMTA
DNAK_PSEU2       FFG-KEARKDVNPDEAVAMGAAIQGAVLAGDVK---DVL-LLDVSPLTLGIETMGGVMTA
DNAK_PSESM       FFG-KEARKDVNPDEAVAMGAAIQGAVLAGDVK---DVL-LLDVSPLTLGIETMGGVMTA
DNAK_PSEF5       FFG-KEARKDVNPDEAVAMGAAIQGAVLAGDVK---DVL-LLDVSPLTLGIETMGGVMTA
DNAK_PSEAE       FFG-KEARKDVNPDEAVAVGAAIQGAVLAGDVK---DVL-LLDVTPLTLGIETLGGVMTG
DNAK_ACIAD       FFG-KEPRKDVNPDEAVAIGAAIQGAVLSGDKT---DVL-LLDVTPLTLGIETMGGVLTP
DNAK_PSYA2       FFG-QEPRKDVNPDEAVAAGAAIQGAVLSGEKT---DVL-LLDVTPLTLGIETMGGILTP
DNAK_FRATT       FFG-KEPRKDVNPDEAVAVGAAIQGGVLAGDVK---DIL-LLDVTPLSLGIETMGGVMTK
DNAK_LEGPH       FFG-KEPRKDVNPDEAVAVGAAIQAAVLSGEVK---DIL-LLDVTPLSLGIETMGGVMTK
DNAK_LEGPL       FFG-KEPRKDVNPDEAVAVGAAIQAAVLSGEVK---DIL-LLDVTPLSLGIETMGGVMTK
DNAK_LEGPA       FFG-KEPRKDVNPDEAVAVGAAIQAAVLSGEVK---DIL-LLDVTPLSLGIETMGGVMTK
DNAK_COXBU       FFG-KEARKDVNPDEAVAIGAAIQGAVLSGEVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_METCA       IFG-REPRKDVNPDEAVAVGAAIQAGVLGGQVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_NITOC       FFG-KEPRKDVNPDEAVAVGAAIQAGVLGGEVK---EVL-LLDVTPLSLGIETLGGVMTK
DNAK1_COLP3      FFS-KEPRKDVNPDEAVAMGAAIQAGVMSGAVD---DVL-LLDVAPLSLGIETLGGVMTK
DNAK_DESAG       FFG-KEPNRSMNPDEVVSMGAAIQGGILAGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_DESVH       FFG-KEPNRSVNPDEVVAMGAAIQGGILAGDVK---DVL-LLDVTPLSLGIETLGGVFTR
DNAK_GEOSL       IFG-KVPNKGVNPDEVVAIGAAIQGGVLRGDVK---DVL-LLDVTPLSLGIETLGSVMTK
DNAK_PELCD       IFG-KTPNKGVNPDEVVAIGAAIQGGVLKGEVK---DVL-LLDVTPLSLGIETLGSIMTK
DNAK_DESPS       IFG-KEPHKGVNPDEVVAIGAAIQGGVLQGDVK---DVL-LLDVTPLSLGIETLGGVTTK
DNAK_CAMJE       AFN-KDLNKSVNPDEVVAIGAAIQGAVIKGDVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_CAMJR       AFN-KDLNKSVNPDEVVAIGAAIQGAVIKGDVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_HELHP       FIS-KDLNKSVNPDEVVAVGAAIQGGVLKGDVK---DVL-LLDVTPLSLGIETAGGISTK
DNAK_WOLSU       FIG-KELNKSVNPDEVVALGAAIQGGVLKGDVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_HELPY       FIN-KDLNKSVNPDEVVAVGASIQGGVLKGDVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_HELPJ       FIN-KELNKSVNPDEVVAVGASIQGGVLKGDVK---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_FUSNN       FFG-KKPNKGINPDEVVAAGAAIQGGVLMGDVK---DVL-LLDVTPLSLGIETLGGVFTK
DNAK_RHOBA       IFG-KDPHQGVNPDEVVAVGAAIQGSVLAGDRN---DVL-LLDVTPLTLGIETEGGVMTA
DNAK_BACFN       FFG-KTPSKGVNPDEVVAVGAAVQGAVLTDEIK---GVV-LLDVTPLSMGIETLGGVMTK
DNAK_BACFR       FFG-KTPSKGVNPDEVVAVGAAVQGAVLTDEIK---GVV-LLDVTPLSMGIETLGGVMTK
DNAK_BACTN       FFG-KTPSKGVNPDEVVAVGAAVQGAVLTDEIK---GVV-LLDVTPLSMGIETLGGVMTK
DNAK_PORGI       IFG-KAPSKGVNPDEVVAVGAAIQGGVLTGEVK---DVL-LLDVTPLSLGIETMGGVMTR
DNAK_CHLTE       FFG-KEPNKSVNPDEVVAIGAAIQGGVLQGDVT---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_CHLCH       FFG-KEPNKSVNPDEVVAIGAAIQGGVLKGDVT---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_BORBU       IFG-QDPNKGVNPDEAVAIGAAIQGGILTGETK---DMV-LLDVTPLSLGIETLGGVMTK
DNAK_BORBP       IFG-QDPNKGVNPDEAVAIGAAIQGGILTGETK---DMV-LLDVTPLSLGIETLGGVMTK
DNAK_TREPA       VFG-KEGSKGVNPDEAVAIGAAIQGGILGGDVK---DVL-LLDVTPLSLGIETMGGVFTP
DNAK_TREDE       IFG-KEGSKSVNPDEAVAMGAAIQGGILGGDVK---DVL-LLDVTPLSLGIETMGGVFTP
DNAK_LEPIC       VFG-KEPNKSVNPDEVVAIGAAIQGGVLAGEVS---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_LEPIN       VFG-KEPNKSVNPDEVVAIGAAIQGGVLAGEVS---DVL-LLDVTPLSLGIETLGGVMTK
DNAK_BDEBA       FFG-KEPNRSVNPDEVVAIGAAVQGGVLAGDVK---DVL-LLDVTPLSLGIETLGGVMTT
DNAK_CHLAB       IFG-KEPNKGVNPDEVVAIGAAIQGGVLGGEVK---DVL-LLDVIPLSLGIETLGGVMTP
DNAK_CHLCV       IFG-KEPNKGVNPDEVVAIGAAIQGGVLGGEVK---DVL-LLDVIPLSLGIETLGGVMTP
DNAK_CHLPN       LFG-KEPNKGVNPDEVVAIGAAIQGGVLGGEVK---DVL-LLDVIPLSLGIETLGGVMTT
DNAK_CHLTR       IFG-KEPNKGVNPDEVVAIGAAIQGGVLGGEVK---DVL-LLDVIPLSLGIETLGGVMTP
DNAK_CHLTA       IFG-KEPNKGVNPDEVVAIGAAIQGGVLGGEVK---DVL-LLDVIPLSLGIETLGGVMTP
DNAK_CHLMU       IFG-KEPNKGVNPDEVVAIGAAIQGGVLGGEVK---DVL-LLDVIPLSLGIETLGGVMTP
DNAK_PARUW       IFG-KEGHKGVNPDEVVAVGAAIQGGVLTGVVK---DVL-LLDVTPLTLGIETLGGVMTP
DNAK_DEHM1       FFG-KEPNKGVNPDEVVAIGAAIQAGVLKGEVS---DVL-LLDVIPLTLGIETLGGVSTA
DNAK_DEHMC       FFG-KEPNKGVNPDEVVAIGAAIQAGVLKGEVS---DVL-LLDVIPLTLGIETLGGVSTA
DNAK_CLOPE       FTG-KEPSKGVNPDECVAMGAAIQAGVLTGDVK---DVL-LLDVTPLTLGIETLGGVATP
DNAK_CLOTE       FTG-KEPSKDVNPDECVAMGAAVQAGVLTGDVK---DVL-LLDVTPLTLGIETLGGVATP
DNAK_CLOAB       YTG-KDPSKGVNPDECVAIGAAIQAGVLTGDVK---DVL-LLDVSPLTLGIETLGGVATP
DNAK_METAC       FTG-KKPYKNINPDEAVAIGAAIQAGVLGGEVK---DVL-LLDVTPLTLGIETLGGIATP
DNAK_METMA       FTG-KKPYKNINPDEAVAIGAAIQAGVLGGEVK---DVL-LLDVTPLTLGIETLGGIATP
DNAK_METBF       FTG-KKPYKNINPDEAVAIGAAIQAGVLGGEVK---DVL-LLDVTPLTLGIETLGGIATP
DNAK_CALS4       IMG-KEPHKGINPDEAVAIGAAIQAAVLAGEIK---DIL-LLDVTPLSLGIETLGGVFTK
DNAK_CARHZ       FFN-KEPHKGINPDECVAIGAAIQAAVLAGEVK---DVV-LLDVTPLSLGIETLGGVFTK
DNAK_SYMTH       FFG-KEPYKGINPDEVVAMGAAIQAAVIKGDVK---DVL-LLDVTPLSLGIETLGGVFTK
DNAK_AQUAE       FFG-KEPHKGLNPDEVVAMGAAIQAGVLAGEV----KEIVLVDVTPLSLGVETYGGVMTV
DNAK_THEMA       FFG-KEPNKSVNPDEAVAIGAAIQAAILAGTEGAKGRDIVLVDVTPLTLGIEVKGGLFEP
DNAK_THEAC       YLG-IKAEGGVDPMEAVAIGAAIQGAVLKGEI----KDIVLLDVTPLTLSVETLGGIATP
DNAK_THEVO       YLG-IKAEGGVDPMEAVAIGAAIQGAVLKGEI----KDIVLLDVTPLTLSVETLGGIATP
DNAK_PICTO       YFG-RKAEGGVDPMEAVAMGAAIQGAVLAGEV----KDIVLLDVTPLTLGIETLGGVMTP
DNAK_METTH       FIG-KPVERGIDPMECVAMGAAIQGGVLAGEI----KDLVLLDVTPLSLGIETLGGVFTK
DNAK3_NOSS1      FFNGKAPDRSVNPDEAVALGAAIQAGVLGGE----VDNLLLLDVTPLSLGIETLGEVFTK
DNAK1_THEEB      QFCGKNPDRSVNPDEAVAIGAAIQGGILGKETT--VKDLLLLDVTPLSLGLETLGGVFTK
DNAK3_SYNP6      FFGGKTPDLTINPDEAIALGAAIQAGVLGGE----VKDVLLLDVIPLSLGLETLGGVFTK
DNAK1_NOSS1      LIG-IEPSENVNPDEVVAMGAAIQAGILAGE---FKDVL-LLDVTPLSLGLEAIGGVMKK
DNAK3_SYNY3      FID-REPNENVNPDEVVAIGAAIQAGILDGE---VKDIL-LLDVTPLSFGLETIGGVMKK
DNAK3_THEEB      MIG-REPKQNVNPDEVVAVGAAIQAGILAGD---VKDIL-LLDVTPLSLGVETIGGVTKV
DNAK1_SYNP6      LIG-REPNQNVNPDEVVAIGAAIQAGILAGE---VKDIL-LLDVTPLSLGLETIGGVMKK
DNAK1_PROMM      LVA-SEPCQSVNPDEVVAVGGAVQAGILTGE---LRDLM-LNDVTPLSLGLETVGGLMKV
DNAK1_SYNPX      LVP-LDPCQSVNPDEVVAIGAAVQAGILTGE---LRDLL-LNDVTPLSLGLETVGGLMRV
DNAK1_PROMA      IVP-VTPSQSVNPDEVVAIGAAVQAGILTGE---LRDLL-LNDVTPLSLGLETIGGLMKV
DNAK1_PROMP      LVP-NEPCQSVNPDEVVAIGAAIQSGIISGD---LRDLL-LNDVTPLSLGLETIGGLMKV
DNAK_THET8       LLG-KEPNRSVNPDEVVAMGAAIQAGVLMGE---VRDVV-LLDVTPLSLGVETKGGVMTV
DNAK_THET2       LLG-KEPNRSVNPDEVVAMGAAIQAGVLMGE---VRDVV-LLDVTPLSLGVETKGGVMTV
DNAK_DEIRA       LVG-KTPNESVNPDEAVALGAAVQAGIIQGDSS-LGDIV-LVDVTPLTLGVEVKGGMIAP
DNAK2_NOSS1      LLG-REPNQTVNPDEVVAVGAAIQAGVLGGE---VTGIL-LLDVTPLSLGVETLGGVMTK
DNAK2_SYNY3      ILG-KDPNQGVNPDEVVAVGAAIQGGVLSGE---VKDIL-LLDVSPLSLGVETLGGVMTK
DNAK2_THEEB      LLG-KDPNQSVNPDEVVAVGAAIQAGVLAGE---VKDIL-LLDVTPLSLGVETLGGVMTK
DNAK2_PROMA      VTG-KDPNQTVNPDEVVAVGAAIQGGVLAGE---VKDIL-LLDVTPLSLGVETLGGVMTK
DNAK_PROMT       VTT-KDPNQTVNPDEVVAVGAAIQGGVLAGE---VKDIL-LLDVTPLSLGVETLGGVMTK
DNAK2_PROMP      VTG-KDPNQTVNPDEVVAVGAAIQGGVLAGE---VKDIL-LLDVTPLSLGVETLGGVMTK
DNAK2_PROMM      VTG-KDPNQTVNPDEVVAVGAAIQGGVLAGE---VKDIL-LLDVTPLSLGVETLGGVMTK
DNAK2_SYNPX      TTS-KDPNQTVNPDEVVAVGAAIQGGVLAGE---VKDIL-LLDVTPLSLGVETLGGVMTK
DNAK2_SYNP6      MTG-KEPNQSVNPDEVVAIGAAIQGGVLAGE---VKDIL-LLDVTPLSLGVETLGGVMTK
DNAK_GLOVI       IIG-KDPNQSVNPDEVVAVGAAIQAGVLSGE---VRDVV-LLDVTPLSLGVETLGGVATP
DNAK2_STRAW      LTGGKDPNMSVNPDEVVALGAAIQAGVLKGE---VKDVL-LLDVTPLSLGVETRGGVMTK
                           ::* * :. *.::*. ::          : * ** **::.:   *     

DNAK_MYCH7       LIPRNTTIPVTKSQIFSTAEDNQTEVTISVVQGERQLAADNKMLGRFNLSGIEAAPRGLP
DNAK_MYCHJ       LIPRNTTIPVTKSQIFSTAEDNQTEVTISVVQGERQLAADNKMLGRFNLSGIEAAPRGLP
DNAK_MYCPU       LIPRNTTIPVTKSQVFSTAADNQSEVTISVVQGERPMASDNKQLGQFNLSGIEPAPRGVP
DNAK_MYCMO       LIQRNTTIPTTKSQIFSTAADNQSEVTINVVQGERQMAADNKSLGQFNLGGIEKAPRGTP
DNAK_MYCS5       LIPRNTTIPATKSQVFSTAADNQTEVTISVIQGERQMASDNKMLGRFNLTGIEAAPRGVP
DNAK_MYCHO       LIPRNTTIPVTKSQIFSTAVDNQTAVTIVITQGERQLARDNKILGQFNLEGIEPAPRGIP
DNAK_UREPA       LIPRNTKIPVSKSQIFSTAADNQPSVDIRIVQGERSLAADNKLLGNFELSGIEPAPRGVP
DNAK_MYCGE       LIKRNTTIPVSKSQIFSTAQDNQESVDVVVCQGERPMSRDNKSLGRFNLGGIQPAPKGKP
DNAK_MYCPN       LIKRNTTIPVSKSQIFSTAQDNQESVDVVVCQGERPMARDNKSLGRFNLGGIQPAPKGKP
DNAK_MYCGA       IIKRNTTIPVSKSQIFSTAQDNQESVDVSIYQGERPMARENKSLGTFSLGGIQPAPKGKP
DNAK_MYCPE       LIKRNSTIPISKSQIFSTAADNQPAVDVHVLQGERQMAADNKSLGRFILDGIEPAPRGVP
DNAK_MESFL       LIDRNTTIPTEKSQIFSTAVDNQPAVDINVLQGERPMAADNKSLGQFQLTGIKPAPKGTP
DNAK_MYCMS       LIERNTTIPAKRTQIFSTATDNQPAVDINVLQGERAMAADNKSLGQFQLTGIQPAPRGVP
DNAK_BACAN       LIERNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMSADNKTLGRFQLTDLPPAPRGIP
DNAK_BACCZ       LIERNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMSADNKTLGRFQLTDLPPAPRGIP
DNAK_BACHK       LIERNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMSADNKTLGRFQLTDLPPAPRGIP
DNAK_BACCR       LIERNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMSADNKTLGRFQLTDLPPAPRGIP
DNAK_BACC1       LIERNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMSADNKTLGRFQLTDIPPAPRGIP
DNAK_BACSU       LIDRNTTIPTSKSQVFSTAADNQTAVDIHVLQGERPMSADNKTLGRFQLTDIPPAPRGVP
DNAK_BACLD       LIERNTTIPTSKSQVFSTAADNQTAVDIHVLQGERPMAADNKTLGRFQLTDIPPAPRGVP
DNAK_GEOKA       LIERNTTIPTSKSQVFTTAADNQTTVDIHVLQGERPMAADNKSLGRFQLTGIPPAPRGVP
DNAK_OCEIH       LIERNTTIPTSASQTFSTAADNQTAVDIHVLQGEREMASDNKTLGRFQLTDIPPAPRGMP
DNAK_BACHD       LIERNTTIPTSKSQIFSTAADNQPSVDIHVLQGEREMAADNKTLGRFQLTDIPPAPRGVP
DNAK_BACSK       LIERNTTIPTSKSQVFSTAADNQPSVDIHVLQGEREMAADNKTLGRFQLTDIPPAPRGVP
DNAK_STRA3       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRA5       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRA1       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRP1       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRP6       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRP8       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRPM       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRP3       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRMU       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGVP
DNAK_STRPN       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRR6       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_STRT1       LIERNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGVP
DNAK_STRT2       LIERNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGVP
DNAK_LACLA       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIP
DNAK_ENTFA       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGVP
DNAK_LISMF       LIERNTTIPTSKSQTFSTAADNQPAVDIHVLQGERPMAKDNKTLGRFQLADIPPAPRGIP
DNAK_LISMO       LIERNTTIPTSKSQTFSTAADNQPAVDIHVLQGERPMAKDNKTLGRFQLADIPPAPRGIP
DNAK_LISIN       LIERNTTIPTSKSQTFSTAADNQPAVDIHVLQGERPMAKDNKTLGRFQLADIPPAPRGIP
DNAK_STAAC       LIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAADNKTLGRFQLTDIPPAERGKP
DNAK_STAAM       LIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAADNKTLGRFQLTDIPPAERGKP
DNAK_STAAN       LIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAADNKTLGRFQLTDIPPAERGKP
DNAK_STAAR       LIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAADNKTLGRFQLTDIPPAERGKP
DNAK_STAAS       LIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAADNKTLGRFQLTDIPPAERGKP
DNAK_STAAW       LIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAADNKTLGRFQLTDIPPAERGKP
DNAK_STAES       LIERNTTIPTSKSQVYSTAADNQPAVDIHVLQGERPMASDNKTLGRFQLTDIPPAPRGVP
DNAK_STAEQ       LIERNTTIPTSKSQVYSTAADNQPAVDIHVLQGERPMASDNKTLGRFQLTDIPPAPRGVP
DNAK_STAHJ       LIERNTTIPTSKSQVYSTAADNQPAVDIHVLQGERPMASDNKTLGRFQLTDIPPAPRGVP
DNAK_STAS1       LIERNTTIPTSKSQVYSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGVP
DNAK_LACAC       LIDRNTTIPTSKSQIFSTAADNQPAVDVHVLQGERPMAADDKTLGRFELTDIPPAPRGVP
DNAK_LACJO       LIDRNTTIPTSKSQIFSTAADNQPAVDVHVLQGERPMAADDKTLGRFELTDIPPAPRGVP
DNAK_LACSK       LIDRNTTIPTSKAQTFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGVP
DNAK_LACSS       LIDRNTTIPTSKAQTFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGVP
DNAK_LACPL       LIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGVP
DNAK_ONYPE       LIERNSTIPTSEKQVFSTAADNLPAVDIHVLQGERPLAADNKTLGRFQLTDRPPHRAEFL
DNAK_TROWT       LIERNTAIPTKRSEVFTTAEDNQPSVSIQVFQGERELTQDNKNLGTFELTGIAPAPRGLP
DNAK_TROW8       LIERNTAIPTKRSEVFTTAEDNQPSVSIQVFQGERELTQDNKNLGTFELTGIAPAPRGLP
DNAK_LEIXX       LIERNTAIPTKRSETFTTADDNQPSVAIQVFQGEREFTRDNKPLGTFELTGIAPAPRGIP
DNAK_BIFLO       LIDRNTAIPTKRSEVFSTAEDNQPSVLIQVYQGEREFARDNKPLGTFELTGIAPAPRGVP
DNAK_COREF       LIERNTTIPTKRSETFTTAEDNQPSVQIQVFQGEREIASANKLLGSFELGGIAPAPRGVP
DNAK_CORGL       LIERNTTIPTKRSETFTTAEDNQPSVQIQVFQGEREIATANKLLGSFELGGIAPAPRGVP
DNAK_CORDI       LIERNTTIPTKRSETFTTADDNQPSVQIQVFQGEREIAAHNKLLGSFELGGIAPAPRGVP
DNAK_CORJK       LIERNTTIPTKRSETFTTAEDSQPSVQIQVFQGEREMAAHNKLLGSFELAGIAPAPRGVP
DNAK_MYCLE       LIERNTTIPTKRSETFTTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVP
DNAK_MYCPA       LIERNTTIPTKRSETFTTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGVP
DNAK_MYCTU       LIERNTTIPTKRSETFTTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGIP
DNAK_MYCBO       LIERNTTIPTKRSETFTTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGIP
DNAK_NOCFA       LIERNTTIPTKRSETFTTADDNQPSVQIQVFQGEREIAAHNKLLGSFELTGIPPAPRGVP
DNAK1_STRAW      LIERNTTIPTKRSEIFTTAEDNQPSVQIQVYQGEREIAAYNKKLGMFELTGLPPAPRGVP
DNAK_STRCO       LIERNTTIPTKRSEIFTTAEDNQPSVQIQVYQGEREIAAYNKKLGMFELTGLPPAPRGVP
DNAK_THEFY       LIERNTAIPTKRSEIFTTAEDNQPSVQIQVYQGEREIAKYNKKLGVFDLTGIPPAPRGVP
DNAK_CUTAK       IIERNTTIPTKRSEVFTTAEDNQPSVMIQVFQGEREFVRDNKSLGNFELTGLMPAPRGIP
DNAK_HALMA       LIDKNTTIPTEESKIFTTAQDNQTQVQIRVFQGEREIAEENELLGAFALSGIPPAPAGTP
DNAK_NATPD       LIDKNTTIPTEASKVFTTAADNQTSVNIRVFQGEREIAEENELLGAFQLTGIPPAPAGTP
DNAK_HALSA       LIEKNTAIPTTASKVFTTAADNQTSVQIRVFQGEREIASENELLGDFHLTGIPPAPAGTP
DNAK_AGRFC       LIDRNTTIPTKKSQTFSTAEDNQSAVTIRVSQGEREMAQDNKLLGQFDLVGLPPSPRGVP
DNAK_RHIME       LIERNTTIPTKKSQVFSTADDNQSAVTIRVSQGEREMAADNKLLGQFDLVGIPPAPRGVP
DNAK_RHILO       LIERNTTIPTKKSQVFSTAEDSQSAVTIRVFQGEREMAADNKALGQFDLVGIPPAPRGVP
DNAK_BRUME       LIERNTTIPTKKSQTFSTAEDNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVP
DNAK_BRUAB       LIERNTTIPTKKSQTFSTAEDNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVP
DNAK_BRUSU       LIERNTTIPTKKSQTFSTAEDNQSAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVP
DNAK_BARHE       LIERNTTIPTKKSQVFSTADDNQNAVTIRVFQGEREMANDNKLLGQFDLVGIPPAPRGVP
DNAK_BARQU       LIERNTTIPTKKSQVFSTADDNQNAVTIRVFQGEREMANDNKLLAQFDLVGIPPAPRGVP
DNAK_BRADU       IIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIPPAPRGMP
DNAK_NITWN       IIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFDLMGIPPAPRGMP
DNAK_RHOPA       IIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIPPAPRGMP
DNAK_CAUVC       LIERNTTIPTKRSQTFSTADDNQSAVTIRVFQGERPMAQDNKMLGQFDLVGIPPAPRGVP
DNAK_ZYMMO       MIDRNTTIPTKKSQVYSTAEDNQNAVTIRVFQGEREMAADNKLLGQFDLVGIPPAPRGVP
DNAK_RHOS4       LIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKLLGQFNLEDIPPAPRGMP
DNAK_RUEPO       LIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKILGQFNLEDIPPAPRGMP
DNAK_RICFE       LIDRNTTIPSKKSQVFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPPAPRGVP
DNAK_RICTY       LIDRNTTIPSKKSQVFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPPAPRGVP
DNAK_RICPR       LIDRNTTIPSKKSQVFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPPAPRGVP
DNAK_RICCN       LIDRNTTIPTKKSQIFSTADDNQHAVTIRVFQGEREMAKDNKLLGQFNLEGIPLAPRGLP
DNAK_PELUB       LIEKNTTIPTKKSQVFSTADDNQPAVSIRVLQGEREMASDNKMLGNFELVGIAPAPRGVP
DNAK_EHRRG       LIERNTTIPTKKSQVFSTAEDGQTAVTIKVFQGERKMANDNKLLGQFSLEGIPPAPRGMP
DNAK_EHRRW       LIERNTTIPTKKSQVFSTAEDGQTAVTIKVFQGERKMANDNKLLGQFSLEGIPPAPRGMP
DNAK_EHRCJ       LIERNTTIPTKKSQVFSTAEDGQTAVTIKVYQGERKMAADNKLLGQFSLEGIPSAPRGMP
DNAK_ANAMM       LIERNTTIPTKKSQVFSTAEDGQTAVTIKVYQGERKMAVDNKLLGQFSLEGIPSAPRGIP
DNAK_WOLPM       LIERNTTIPTKKSQVFSTAEDNQTAVTIKVHQGERKLAVDNKLLGQFSLEGIPPAPRGRP
DNAK_WOLTR       LIERNTTIPTKKSQVFSTAEDNQTAVTIKVHQGERKLAVDNKLLGQFSLEGIPPAPRGIP
DNAK_BORBR       MIQKNTTIPTRYSQTFSTADDNQPAVTIKVFQGEREIAAGNKGLGEFNLEGIPPAPRGLP
DNAK_BORPE       MIQKNTTIPTRYSQTFSTADDNQPAVTIKVFQGEREIAAGNKGLGEFNLEGIPPAPRGLP
DNAK_BORPA       MIQKNTTIPTRYSQTFSTADDNQPAVTIKVFQGEREIAAGNKGLGEFNLEGIPPAPRGLP
DNAK_BURPS       MINKNTTIPTKHAQVYSTADDNQGAVTIKVFQGEREMAAGNKLLGEFNLEGIPPAPRGVP
DNAK_BURMA       MINKNTTIPTKHAQVYSTADDNQGAVTIKVFQGEREMAAGNKLLGEFNLEGIPPAPRGVP
DNAK_BURP1       MINKNTTIPTKHAQVYSTADDNQGAVTIKVFQGEREMAAGNKLLGEFNLEGIPPAPRGVP
DNAK_BURL3       MISKNTTIPTKHAQVYSTADDNQGAVTIKVFQGEREMAAGNKLLGEFNLEGIPPAPRGVP
DNAK_RALSO       MIGKNTTIPTKFSQTFSTADDNQPAVTIKVYQGEREMASGNKMLGEFNLEGIPPAPRGTP
DNAK_CUPPJ       MITKNTTIPTKHAQVFSTADDNQPAVTIKVYQGEREMATGNKLLGEFNLEGIPPSPRGTP
DNAK_AROAE       LIQKNTTVPTKASQVFSTADDNQSAVTIHVLQGEREMASGNKSLGQFNLSDIPPAPRGMP
DNAK_THIDA       LIPKNTTIPTKASQVFSTADDNQSAVTVHVLQGEREMASGNKSLGQFNLSDIPPAPRGMP
DNAK_DECAR       LIQKNTTIPTKASQTFSTADDNQAAVTIHVLQGEREVASGNKSLGQFNLEGIPPAPRGTP
DNAK_NITEU       LIQKNTTIPTKAQQVFSTADDNQTAVTIHVLQGEREVASGNKSLGQFNLTDIPSAPRGMP
DNAK_NEIMA       LIQKNTTIPTKASQVFSTAEDNQSAVTIHVLQGERERASANKSLGQFNLGDIAPAPRGMP
DNAK_NEIG1       LIQKNTTIPTKASQVFSTAEDNQSAVTIHVLQGERERASANKSLGQFNLGDIAPAPRGMP
DNAK_NEIMB       LIQKNTTIPTKASQVFSTAEDNQSAVTIHVLQGERERASANKSLGQFNLGDIAPAPRGMP
DNAK_CHRVO       LIQKNTTIPTKASQTFSTADDNQTAVTIHVLQGEREKAAANKSLGQFNLGDIPPAPRGIP
DNAK_BUCAI       LINKNTTIPTKHSQIFSTAEDNQSAVTIHVLQGERKRSSDNKSLGQFNLDGINPAPRGTA
DNAK_BUCAP       LINKNTTIPTKHSQVFSTAEDNQSAVTIHILQGERKRALDNKSLGQFNLDGIEPAPRGTA
DNAK_BUCBP       LISKNTTIPTKHSQIFSTAEDNQTAVTIHVLQGERKRSIDNKSLGQFNLDGIQPAPRGMA
DNAK_BLOFL       LIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFNLDGIAPAMRGIP
DNAK_BLOPB       LIAKNTTIPTKHSQIFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFNLDGIAAAMRGIP
DNAK_WIGBR       LISKNTTIPTKHSQIFSTAEDNQSAVTIHVLQGERKRSIDNKSLGQFNLDGIAPAMRGMP
DNAK_ECOLI       LIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMP
DNAK_ECOL6       LIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMP
DNAK_ECO57       LIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMP
DNAK_SHIBS       LIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMP
DNAK_SHIDS       LIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMP
DNAK_SHISS       LIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMP
DNAK_SHIFL       LIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMP
DNAK_SALTI       LITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFNLDGINPAPRGMP
DNAK_SALPA       LITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFNLDGINPAPRGMP
DNAK_SALTY       LITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFNLDGINPAPRGMP
DNAK_SALCH       LITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFNLDGINPAPRGMP
DNAK_YERPE       LITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAQDNKSLGQFNLDGIQPAPRGMA
DNAK_YERPS       LITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAQDNKSLGQFNLDGIQPAPRGMA
DNAK_PHOLL       LIVKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAGDNKSLGQFNLDGIQAAPRGMP
DNAK_PECAS       LIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAHDNKSLGQFNLDGIQAAPRGMP
DNAK_PASMU       LIEKNTTIPTKKSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLEGINPAPRGMP
DNAK_MANSM       LIEKNTTIPTKKSQVFSTAEDNQSAVTIHVLQGERKQASANKSLGQFNLEGINPAPRGMP
DNAK_HAEIN       LIEKNTTIPTKKSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLEGINPAPRGMP
DNAK_HAEI8       LIEKNTTIPTKKSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLEGINPAPRGMP
DNAK_HAEDU       LIEKNTTIPTKKSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLEGINPAPRGMP
DNAK2_COLP3      VIDKNTTIPTKQSQTFSTADDNQAAVTVHVCQGERKQASANKSLGQFNLEGIEPAQRGTP
DNAK_PSEHT       LIEKNTTIPTKKSQTFSTAEDNQSAVTIHVLQGERKRSSDNKSLGQFNLEGIRPAQRGTP
DNAK_SHEON       LIEKNTTIPTKAQQVFSTADDNQSAVTIHVLQGERKQASANKSLGQFNLDGIEPAPRGMP
DNAK_VIBVU       LVEKNTTIPTKANQVFSTAEDNQSAVTIHVLQGERKQAMYNKSLGQFNLEGINPAPRGMP
DNAK_VIBVY       LVEKNTTIPTKANQVFSTAEDNQSAVTIHVLQGERKQAMYNKSLGQFNLEGINPAPRGMP
DNAK_VIBPA       LVEKNTTIPTKANQVFSTAEDNQSAVTIHVLQGERKQAMYNKSLGQFNLEGIQPAPRGMP
DNAK_VIBCH       LIEKNTTIPTKANQVFSTAEDNQSAVTIHVLQGERKQAMYNKSLGQFNLEGINPAPRGMP
DNAK1_ALIF1      LIEKNTTIPTKADQTFSTAEDNQSAVTIHVLQGERKQASYNKSLGQFNLEGIQAAPRGMP
DNAK2_ALIF1      LIEKNTTIPTKADQTFSTAEDNQSAVTIHVLQGERKQATYNKSLGQFNLEGIQPAPRGMP
DNAK1_PHOPR      LIEKNTTIPTKANQVFSTAEDNQSAVTIHVLQGERKQSSYNKSLGQFNLEGIQAAARGMP
DNAK2_PHOPR      LIEKNTTIPTKANQVFSTAEDNQSAVTIHVLQGERKQSSYNKSLGQFNLEGIQAGSRGTA
DNAK_IDILO       LIEKNTTIPTKESQTFSTAEDNQSAVTIHVIQGERKRAGDNKSLGQFNLEGIRAAARGVP
DNAK_XANAC       IIEKNTTIPTKASQTFSTAEDNQSAVTVHVLQGEREQARFNKSLAKFDLSGIEPAPRGMP
DNAK_XANC5       IIEKNTTIPTKASQTFSTAEDNQSAVTVHVLQGEREQARFNKSLAKFDLSGIEPAPRGMP
DNAK_XANCP       IIEKNTTIPTKASQTFSTAEDNQSAVTVHVLQGEREQARFNKSLAKFDLSGIEPAPRGMP
DNAK_XANC8       IIEKNTTIPTKASQTFSTAEDNQSAVTVHVLQGEREQARFNKSLAKFDLSGIEPAPRGMP
DNAK_XANOR       IIEKNTTIPTKASQTFSTAEDNQSAVTVHVLQGEREQARFNKSLAKFDLSGIEPAPRGMP
DNAK_XYLFA       IIEKNTTIPTKASQVFSTAEDGQSAVTVHVLQGEREQARFNKSLAKFDLAGIEPAPRGQP
DNAK_XYLFT       IIEKNTTIPTKASQVFSTAEDGQSAVTVHVLQGEREQARFNKSLAKFDLAGIEPAPRGQP
DNAK_PSEPK       LIEKNTTIPTKKSQVFSTADDNQSAVTIHVLQGERKQAAQNKSLGKFDLADIPPAPRGVP
DNAK_PSEPF       LIEKNTTIPTKKSQVFSTADDNQGAVTIHVLQGERKQAAQNKSLGKFDLADIPPAPRGVP
DNAK_PSE14       LIEKNTTIPTKKSQVFSTADDNQNAVTIHVLQGERKQAGQNKSLGKFDLAEIPPAPRGVP
DNAK_PSEU2       LIEKNTTIPTKKSQVFSTADDNQNAVTIHVLQGERKQAAQNKSLGKFDLAEIPPAPRGVP
DNAK_PSESM       LIEKNTTIPTKKSQVFSTADDNQNAVTIHVLQGERKQAGQNKSLGKFDLAEIPPAPRGVP
DNAK_PSEF5       LIEKNTTIPTKKSQVFSTADDNQGAVTIHVLQGERKQAAQNKSLGKFDLADIPPAPRGVP
DNAK_PSEAE       LIEKNTTIPTKKSQVFSTADDNQGAVTIHVLQGERKQAAQNKSLGKFDLADIPPAPRGVP
DNAK_ACIAD       IIEKNTTIPAKKSQVFSTAADNQPAVDISVYQGERKMAQQNKLLGNFQLGDIPPAPRGVP
DNAK_PSYA2       IIEKNTMIPTKKSQVFSTAEDNQPAVSIQVYQGERKIANQNKQLGRFDLTDIPPAPRGLP
DNAK_FRATT       LIERNTTIPTKKSQVFSTAEDNQPAVTIHVLQGEREMASANKSLGRFDLADIPPAPRGMP
DNAK_LEGPH       LIEKNTTIPTKATQVFSTADDNQTAVTVHVLQGEREQASANKSLGRFDLRDIPPAPRGVP
DNAK_LEGPL       LIEKNTTIPTKATQVFSTADDNQTAVTVHVLQGEREQASANKSLGRFDLRDIPPAPRGVP
DNAK_LEGPA       LIEKNTTIPTKATQVFSTADDNQTAVTVHVLQGEREQASANKSLGRFDLRDIPPAPRGVP
DNAK_COXBU       LIEKNTTIPTKANQVFSTADDNQTAVTVHVLQGEREMASANKSLGRFDLSDIPPAPRGVP
DNAK_METCA       LIEKNTTIPTKATQVFSTAEDNQTAVTIHVLQGEREMARDNKSLGRFDLSDIPMAPRGVP
DNAK_NITOC       LIEKNTTIPTRKTQVFSTAEDNQTAVTVHVLQGEREQAVGNKSLGRFDLVGIPPAHRGMP
DNAK1_COLP3      LIEKNTTIPTRASETFSTAEDNQAAVTVHVLQGQREMATDNKSLGQFNLTDINPGPRGSV
DNAK_DESAG       LIERNTTIPTKKSQTFTTAADNQPSVSIHVMQGERPMASDNMTLGRFELTGIPAAPRGMP
DNAK_DESVH       LIERNTTIPTRKSQTFTTAADNQPSVSIHVLQGERPMASDNMTLGRFELTGIPPAMRGVP
DNAK_GEOSL       LIEKNTTIPCRKSQVFSTASDNQPAVTIHVLQGEREMAIDNKTLGNFELTGIPPAPRGVP
DNAK_PELCD       LIEKNTTIPCKKSQIFSTAADNQPAVSVHVLQGEREMAGDNKTIGRFELVGIPPAPRGVP
DNAK_DESPS       LIEKNTTVPTKKSQVFSTAADNQPAVSIHVLQGEREMAEGNKTIGRFELADIPTAPRGVP
DNAK_CAMJE       IIEKGTTIPTKKEQVFSTAEDNQSAVTINVLQGEREFSRDNKSLGNFNLEGIPPAPRGMP
DNAK_CAMJR       IIEKGTTIPTKKEQVFSTAEDNQSAVTINVLQGEREFSRDNKSLGNFNLEGIPPAPRGMP
DNAK_HELHP       VVERGVTIPTKKTQIFSTYEDNQPAVSINVLQGERELARDNKSLGRFDLSGIPAAPRGVP
DNAK_WOLSU       IIDRGTTIPVKKSQVFSTAEDNQPAVTIQVLQGERELARDNKSLGMFELSGIPAAPRGVP
DNAK_HELPY       VIDRGTTIPAKKSQVFSTAEDNQPAVSIMVLQGERELARDNKSLGKFDLQGIAPAPRGVP
DNAK_HELPJ       VIDRGTTIPAKKSQVFSTAEDNQPAVSIMVLQGERELARDNKSLGKFDLQGIAPAPRGMP
DNAK_FUSNN       MIEKNTTIPVKKSQVYSTAVDNQPAVTINVLQGERSRATDNHKLGEFNLEGIPAAPRGVP
DNAK_RHOBA       LVERNTTIPAEKKNVFSTAADNQTAVTVRVFQGERKMANANRLLAEFNLEDIPAAPRGVP
DNAK_BACFN       LIDANTTIPARKSETFSTAADNQTEVTIHVLQGERPMAAQNKSIGQFNLTGIAPARRGVP
DNAK_BACFR       LIDANTTIPARKSETFSTAADNQTEVTIHVLQGERPMAAQNKSIGQFNLTGIAPARRGVP
DNAK_BACTN       LIDANTTIPARKSETFSTAADNQSEVTIHVLQGERPMAAQNKSIGQFNLSGIAPARRGVP
DNAK_PORGI       LIDANTTIPTKKSEIFTTAVDNQPSVEIHVLQGERSLAKDNKSIGRFNLDGIAPAPRQTP
DNAK_CHLTE       LIEANTTIPTRKQEIFSTAADNQTSVEVHVLQGERPMASDNKTLGRFHLSDIPPAPRGVP
DNAK_CHLCH       LIEANTTIPTKKQEVFSTASDNQTSVEVHVLQGERPMAADNKTLGRFHLGDIPPAPRGIP
DNAK_BORBU       LIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMAAQNRILGNFILDGIPAAPRGVP
DNAK_BORBP       LIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMAAQNRILGNFILDGIPAAPRGVP
DNAK_TREPA       LISRNTTIPTRKSQVFSTAADGQTAVSIHVLQGERGMANQNRTLGNFDLVGIPPAPRGVP
DNAK_TREDE       LINRNTTIPTRKSQVFSTAADGQTAVSIHVLQGERGMASQNRTLGNFDLVGIPPAPRGVP
DNAK_LEPIC       LIERNTTIPTKKSQVFSTAADNQSAVSIHVLQGEREMASANRTLGRFDLIGIPPAPRGVP
DNAK_LEPIN       LIERNTTIPTKKSQVFSTAADNQSAVSIHVLQGEREMASANRTLGRFDLIGIPPAPRGVP
DNAK_BDEBA       LIERNTAIPSKKSQVFSTAADNQPAVDIHVLQGERKMAGDNKTLGRFELVGIPPAPRGVP
DNAK_CHLAB       LVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHP
DNAK_CHLCV       LVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHP
DNAK_CHLPN       LVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHP
DNAK_CHLTR       LVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHP
DNAK_CHLTA       LVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHP
DNAK_CHLMU       LVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNKEIGRFDLTDIPPAPRGHP
DNAK_PARUW       LVERNTTIPTQKKQIFSTAADNQPAVTIRVLQGERKMANDNKEIGRFDLADIPPSPRGTP
DNAK_DEHM1       LITRNTTIPTSKSQVFSTAADNQPSVEIHVLQGERPMAADNRTLGRFMLDGILPAPRGVP
DNAK_DEHMC       LITRNTTIPTSKSQVFSTAADNQPSVEIHVLQGERPMAADNRTLGRFMLDGILPAPRGVP
DNAK_CLOPE       LIERNTTIPARKSQIFSTAADNQTSVEIHVVQGERQMAADNKTLGRFTLSGIAPAPRGIP
DNAK_CLOTE       LIERNTTIPTRKSQVFSTAADGQTSVEIHVVQGERQMAADNKTLGRFTLSGIAPAPRGIP
DNAK_CLOAB       LIERNTTIPTRKSQVFSTAADNQPSVEINIVQGERKMAADNKSLGRFTLDGIAPAPRGVP
DNAK_METAC       LIQRNTTIPTKKSQIFSTAADNQPSVEIHVLQGERGIASENKTLGRFTLDGIPPAPRGIP
DNAK_METMA       LIQRNTTIPTKKSQIFSTAADNQPSVEIHVLQGERGIASENKTLGRFILDGIPPAPRGIP
DNAK_METBF       LIPRNTTIPTKKSQVFSTAADNQPSVEIHVLQGERGVASENKTLGRFTLDGIPPAPRGIP
DNAK_CALS4       IIERNTTIPVRKSQIFTTAADNQTSVEIHVLQGERPLAKDNKSLGRFILSGIPPAPRGVP
DNAK_CARHZ       LIERNTTIPTSKSQIFTTAADNQTSVEIHVLQGERPMAADNVSLGRFTLTGIPPAPRGVP
DNAK_SYMTH       LIERNTTIPTRKSQIFSTAADGQTQVEIHVLQGEREMAAYNKTLGRFILDGIPPAPRGVP
DNAK_AQUAE       LIPRNTPIPVRKCEIFTTAHDYQTEVEIHVLQGERPLAKDNKSLAKFYLTGIPPAPRGVP
DNAK_THEMA       IIPRNTKIPVRKSKIFTTVEDGQTEVEIRVYQGERPIARENIFLGSFKLVGIPPAPRGVP
DNAK_THEAC       IIPANTTIPVRKSQIFTTAEDMQTTVTIHVVQGERPLAKDNVSLGMFNLTGIAPAPRGVP
DNAK_THEVO       IIPANTTIPVRKSQVFTTAEDMQTTVTIHVVQGERPLAKDNVSLGMFNLTGIAPAPRGIP
DNAK_PICTO       LIPANTTIPTKKSQIFTTAADMQTTVTIHVVQGERPLAKDDVSLGMFNLDGIPPAPRGVP
DNAK_METTH       LIERNTTIPTRKSQIFSTAADNQTSVDIHVLQGERPMAADNTSLGRFQLVGIPPAPRGVP
DNAK3_NOSS1      IIERNTTIPTSKSQIFSTAVDGQTSVEIHILQGERTMARDNKSLGKFLLAGIPPASRGVP
DNAK1_THEEB      IIERNTTLPTSKTQTFSTASDGQTVVEIAVYQGERPIAKDNKQLACFELTGIAPAPRGVP
DNAK3_SYNP6      IIERNTTIPTSRTQVFTTATDGQVMVEVHVLQGERALVKDNKSLGRFQLTGIPPAPRGVP
DNAK1_NOSS1      LIPRNTTIPVRRSDIFSTSENNQNSVEIHVVQGEREMAGDNKSLGRFKLYGIPPAPRGIP
DNAK3_SYNY3      LLPRNTTIPVRKSDIFSTGENNQTVVEVHVLQGEREMASDNISLGRFKLSGIPPAPRGVP
DNAK3_THEEB      LIPRNTTIPVRRSDIFSTSENNQSQVEIHVVQGERELAAHNKSLGRFKLTGIPPAPRGVP
DNAK1_SYNP6      LIPRNTAIPVRRSDIFSTAENNQTMVEIHILQGERQLAEGNKSLGRFKLTGIPPAPRGVP
DNAK1_PROMM      LIPRNTPIPVRQSDVFSTSEANQSSVEIHVWQGERQLAADNKSLGRFRLSGIPPAPRGVP
DNAK1_SYNPX      LIPRNTPIPVRQSDVFSTSEPNQSSVEIHVWQGERQMASDNKSLGRFRLSGIPPAPRGVP
DNAK1_PROMA      LIPRNTPIPVRQADVFSTSEANQSSVEINVWQGERQLASDNKSLGKFRLSGIPPAPRGVP
DNAK1_PROMP      LIPRNTPIPVRQSDVFSTSESNQSSVVVQVRQGERPLASENKSLGKFRLSGIPPAPRGIP
DNAK_THET8       LIPRNTTIPTRKCEIFTTAEHNQTAVEIHVLQGERPMAQDNKSLGRFRLEGIPPMPAGVP
DNAK_THET2       LIPRNTTIPTRKCEIFTTAEHNQTAVEIHVLQGERPMAQDNKSLGRFRLEGIPPMPAGVP
DNAK_DEIRA       MITRNTTVPAKKTEIYTTAENNQPGVEINVLQGERPMAADNKSLGRFKLEGIPPMPAGRA
DNAK2_NOSS1      IIPRNTTIPTKKSEVFSTAVDGQTNVEIHVLQGEREFANDNKSLGTFRLDGIPPAPRGVP
DNAK2_SYNY3      IIPRNTTIPTKKSETFSTAVDGQSNVEIHVLQGEREMANDNKSLGTFRLDGIPPAPRGVP
DNAK2_THEEB      IIPRNTTIPTKKSEVFSTAVDGQTNVEIHVLQGEREMAADNKSLGTFRLDGIPPAPRGVP
DNAK2_PROMA      MITRNTTVPTKKTETYSTAVDGQTNVEIHVLQGEREMASDNKSLGTFRLDGIPPSPRGVP
DNAK_PROMT       MISRNTTVPTKKAETYSTAVDGQTNVEIHVLQGEREMASDNKSLGTFRLDGIPPAPRGVP
DNAK2_PROMP      MITRNTTVPTKKSETYSTAVDGQTNVEIHVLQGEREMASDNKSLGTFRLDGIPSAPRGVP
DNAK2_PROMM      MITRNTTVPTKKSETYSTAVDGQTNVEIHVLQGEREMASDNKSLGTFRLDGIPPAPRGVP
DNAK2_SYNPX      MITRNTTVPTKKTETYSTAVDGQTNVEIHVLQGEREMASDNKSLGTFRLDGIPPAPRGVP
DNAK2_SYNP6      LIPRNTTIPTKKSETFSTAADGQTNVEIHVLQGEREMASDNKSLGTFRLDGIPPAPRGVP
DNAK_GLOVI       IIPRNTTIPTRKSETFSTAADGQTSVEIHVIQGERSMAGDNKSLGRFRLDGIPPAPRGVP
DNAK2_STRAW      IIERNTTIPVRRSETFSTAEDNQPAVDVVVLQGERERAADNRVLGRFQLTDIRPAPRGEP
                 ::  .  :*    . ::*       * : : **:*     :  :. * *           

DNAK_MYCH7       QIEVSFSIDVNGITTVSAKDKKTGKEQTITIKNTSTLSEEEINKMIQEAEENREADALKK
DNAK_MYCHJ       QIEVSFSIDVNGITTVSAKDKKTGKEQTITIKNTSTLSEEEINKMIQEAEENREADALKK
DNAK_MYCPU       QIEVSFSIDVNGITTVKAKDLKTNKEQEITIKNSSKLSDEEVEKMVKEAEENREADKAKK
DNAK_MYCMO       QIEVSFSIDVNGIIKVSATDKKTNKIQTITIENSTSLTEEEIKKMIDDAEKNKEADAKKK
DNAK_MYCS5       QIEVTFSIDVNGITKVSAKDMKTQKEQTITIENSSKLSEEEIQKFIKDAEANKEADAKRK
DNAK_MYCHO       QIEVSFSIDVNGITKVTAKDKKTNKEQTITIQNTSSLSKEEVEKMVKDAEANREADQKKR
DNAK_UREPA       QIEIKFNIDANGIMSVNAKDLKTQKETSITIKDSQGLSQDEIDKMIKEAEENKEKDAKVK
DNAK_MYCGE       QIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNIIR
DNAK_MYCPN       QIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIR
DNAK_MYCGA       QIEITFNIDANGILNVKAKDLTTGKENSITISNSSELDENEIQRMIRDAEANKERDAIVK
DNAK_MYCPE       QIEITFNIDANGILNVKAVDKKTNKEATITIKDSSGLSQEEIDKMIKEAEENKEKDAQLK
DNAK_MESFL       QIEVTFKIDVNGIVSVIAKDKATNEEKSITISNSGALSDADIEKMIKEAEANAEADEIKR
DNAK_MYCMS       QIEVTFEIDANGIVSVSAKDKNTNEEKTITISNSGNLSEAEVERMIKEAQENAANDEVKK
DNAK_BACAN       QIEVTFDIDANGIVNVRAKDLGTSKEQAITIQSSSGLSDEEVERMVQEAEANADADQKRK
DNAK_BACCZ       QIEVTFDIDANGIVNVRAKDLGTSKEQAITIQSSSGLSDEEVERMVQEAEANADADQKRK
DNAK_BACHK       QIEVTFDIDANGIVNVRAKDLGTSKEQAITIQSSSGLSDEEVERMVQEAEANADADQKRK
DNAK_BACCR       QIEVTFDIDANGIVNVRAKDLGTSKEQAITIQSSSGLSDEEVERMVQEAEANADADQKRK
DNAK_BACC1       QIEVTFDIDANGIVNVRAKDLGTSKEQAITIQSSSGLSDEEVDRMVKEAEANADADQKRK
DNAK_BACSU       QIEVSFDIDKNGIVNVRAKDLGTGKEQNITIKSSSGLSDEEIERMVKEAEENADADAKKK
DNAK_BACLD       QIEVSFDIDKNGIVNVSAKDLGTGKEQNITIKSSSGLSDDEIERMVKEAEENAEADAKKK
DNAK_GEOKA       QIEVTFDIDANGIVHVRAKDLGTNKEQSITIKSSSGLSEEEIQRMIKEAEENAEADRKRK
DNAK_OCEIH       QIEVSFDIDANGIVNVRAKDLGTNKEQSITIKSSSGLSDDEVDRMVKEAEENADADKQRR
DNAK_BACHD       QIEVTFDIDANGIVNVKAKDLGTNKEQSITITSSSGLTDEEIDQMVKDAEANAEADKKRR
DNAK_BACSK       QIEVTFDIDANGIVNVKAKDLGTNKEQSITITSSSGLSEEEIDKMVQEAEANAEADKKRR
DNAK_STRA3       QIEVTFDIDKNGIVSVKAKDLGTQKEQHIVIQSNSGLTDEEIDKMMKDAEANAEADAKRK
DNAK_STRA5       QIEVTFDIDKNGIVSVKAKDLGTQKEQHIVIQSNSGLTDEEIDKMMKDAEANAEADAKRK
DNAK_STRA1       QIEVTFDIDKNGIVSVKAKDLGTQKEQHIVIQSNSGLTDEEIDKMMKDAEANAEADAKRK
DNAK_STRP1       QIEVTFDIDKNGIVSVKAKDLGTQKEQHIVIKSNDGLSEEEIDRMMKDAEANAEADAKRK
DNAK_STRP6       QIEVTFDIDKNGIVSVKAKDLGTQKEQHIVIKSNDGLSEEEIDRMMKDAEANAEADAKRK
DNAK_STRP8       QIEVTFDIDKNGIVSVKAKDLGTQKEQHIVIKSNDGLSEEEIDRMMKDAEANAEADAKRK
DNAK_STRPM       QIEVTFDIDKNGIVSVKAKDLGTQKEQHIVIKSNDGLSEEEIDRMMKDAEANAEADAKRK
DNAK_STRP3       QIEVTFDIDKNGIVSVKAKDLGTQKEQHIVIKSNDGLSEEEIDRMMKDAEANAEADAKRK
DNAK_STRMU       QIEVTFDIDKNGIVSVKAKDLGTQKEQTIVIQSNSGLTDEEIDKMMKDAEANAEADAKRK
DNAK_STRPN       QIEVTFDIDKNGIVSVKAKDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRK
DNAK_STRR6       QIEVTFDIDKNGIVSVKAKDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRK
DNAK_STRT1       QIEVTFDIDKNGIVSVKAKDLGTQKEQTIVIQSNSGLTDEEIERMMKDAEANAEADAKRK
DNAK_STRT2       QIEVTFDIDKNGIVSVKAKDLGTQKEQTIVIQSNSGLTDEEIERMMKDAEANAEADAKRK
DNAK_LACLA       QIEVTFDIDKNGIVSVKAKDLGTQKEQTIVIKSNSGLSDEEIDKMMKDAEANADADAKRK
DNAK_ENTFA       QIEVSFDIDKNGIVNVRAKDLGTQKEQTITIKSSSGLSDDEIERMVKDAEANAEADKQRK
DNAK_LISMF       QIEVSFDIDKNGIVTVRAKDLGTGKEQNIVIKSSSGLTDEEIEKMVQDAEANAEEDKKNK
DNAK_LISMO       QIEVSFDIDKNGIVTVRAKDLGTGKEQNIVIKSSSGLTDEEIEKMVQDAEANAEEDKKNK
DNAK_LISIN       QIEVSFDIDKNGIVTVRAKDLGTGKEQNIVIKSSSGLTDEEIEKMVQDAEANAEEDKKNK
DNAK_STAAC       QIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDEEIDRMVKDAEVNAEADKKRR
DNAK_STAAM       QIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDEEIDRMVKDAEVNAEADKKRR
DNAK_STAAN       QIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDEEIDRMVKDAEVNAEADKKRR
DNAK_STAAR       QIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDEEIDRMVKDAEVNAEADKKRR
DNAK_STAAS       QIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDEEIDRMVKDAEVNAEADKKRR
DNAK_STAAW       QIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDEEIDRMVKDAEVNAEADKKRR
DNAK_STAES       QIEVTFDIDKNGIVNVTAKDLGTNKEQNITIQSSSSLSDEEIDRMVKDAEENAEADKKRR
DNAK_STAEQ       QIEVTFDIDKNGIVNVTAKDLGTNKEQNITIQSSSSLSDEEIDRMVKDAEENAEADKKRR
DNAK_STAHJ       QIEVTFDIDKNGIVNVTAKDLGTNKEQNITIQSSSALSDEEIDRMVKDAEENAEADKKRR
DNAK_STAS1       QIEVTFDIDKNGIVNVTAKDLGTNKEQNITIQSSSALSDDEIDRMVKDAEENAEADKKRR
DNAK_LACAC       QIQVTFDIDKNGIVNVSAKDMGTGKEQKITIKSSSGLSDEEIKRMQKDAEEHAEEDKKRK
DNAK_LACJO       QIQVTFDIDKNGIVNVSAKDMGTGKEQKITIKSSSGLSDEEIKKMQKDAEEHAEEDKKRK
DNAK_LACSK       QIEVKFDIDKNGIVNVSAKDLGTNKEQKITIKSNSGLSDEEIDRMMKEAQENEEADTKRK
DNAK_LACSS       QIEVKFDIDKNGIVNVSAKDLGTNKEQKITIKSNSGLSDEEIDRMMKEAQENEEADTKRK
DNAK_LACPL       QIEVKFDIDKNGIVNVSAKDMGTNKEQKITIKSSSGLSDDEIDQMVKEAKENEEADKKRK
DNAK_ONYPE       KLKITFDLDANGIVSVKAKDLGTNKEQKITISGSGALKEEEIQRMIREAEENAEVDRVKK
DNAK_TROWT       QIEVTFDIDANGIVHVSAKDKGTGKEQSMTITGGSGLSQDEIDRMIKEAEEHAAEDKNRR
DNAK_TROW8       QIEVTFDIDANGIVHVSAKDKGTGKEQSMTITGGSGLSQDEIDRMIKEAEEHAAEDKNRR
DNAK_LEIXX       QVEVTFDIDANGIVHVSAKDKGTGKEQSMTITGGSSLPKDDIERMVREAEEHAAEDKKRR
DNAK_BIFLO       QIEVTFDIDANGIVHVSAKDKGTGKEQSMTITGGSGLPKDEIDRMVKEAEAHEAEDKKRK
DNAK_COREF       QIEVTFDIDANGIVHVTAKDKGTGKENTITIQDGSGLSQEEIDRMIKDAEAHAEEDKKRR
DNAK_CORGL       QIEVTFDIDANGIVHVTAKDKGTGKENTITIQDGSGLSQDEIDRMIKDAEAHADEDKKRR
DNAK_CORDI       QIEVTFDIDANGIVHVTAKDKGTGKENTIKIQDGSGLSQEEIDRMVKDAEAHAEEDKKRR
DNAK_CORJK       QIEVTFDIDANGIVSVSAKDKATGKENTIKIQDGSGLSQEEIDRMVKDAETHAEEDKKRR
DNAK_MYCLE       QIEVTFDIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMVKDAEAHAEEDRKRR
DNAK_MYCPA       QIEVTFDIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMIKDAEAHAEEDRKRR
DNAK_MYCTU       QIEVTFDIDANGIVHVTAKDKGTGKENTIRIQEGSGLSKEDIDRMIKDAEAHAEEDRKRR
DNAK_MYCBO       QIEVTFDIDANGIVHVTAKDKGTGKENTIRIQEGSGLSKEDIDRMIKDAEAHAEEDRKRR
DNAK_NOCFA       QIEVTFDIDANGIVHVTAKDKGTGKENTIKIQDGSGLSKEEIDRMIKDAEQHAAEDKARR
DNAK1_STRAW      QIEVAFDIDANGIMHVTAKDLGTGKEQKMTVTGGSSLPKDEVDRMRQEAEQYADEDHRRR
DNAK_STRCO       QIEVAFDIDANGIMHVTAKDLGTGKEQKMTVTGGSSLPKDEVDRMRQEAEKYAEEDHARR
DNAK_THEFY       QIEVTFDIDANGIVNVTAKDLGTGKEQSVTITGGSALPKEDIERMIREAEEYAEQDRKRR
DNAK_CUTAK       QIEVSFDIDANGIVHVHAKDMATGKEQSMTVTGGSALGKDEIDRMVKEAEANAEADKKRR
DNAK_HALMA       QIEVSFNIDENGIVNVEAEDKGSGNKEDITIEGGAGLSDDQIEEMQQEAEQHAEEDEQRR
DNAK_NATPD       QIEVTFNIDENGIVNVEAEDQGSGNKEDITIEGGVGLSDEEIEEMQEEAEKHAEEDEKRR
DNAK_HALSA       QIEVTFEIDADGIVNVEAEDQGSGNAESITIEGGAGLSDEQIDEMQEDAEAHAEEDEQRR
DNAK_AGRFC       QIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIEKMVKDAEANAEADKKRR
DNAK_RHIME       QIEVTFDIDANGIVQVSAKDKGTGKEHQIRIQASGGLSDAEIEKMVKDAEANAEADKKRR
DNAK_RHILO       QIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEANAETDKKRR
DNAK_BRUME       QIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEANAEADKKRR
DNAK_BRUAB       QIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEANAEADKKRR
DNAK_BRUSU       QIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLTDADIEKMVKDAEANAEADKKRR
DNAK_BARHE       QIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEEHAAEDKKRR
DNAK_BARQU       QIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIEKMVKDAEEHAAEDKKRR
DNAK_BRADU       QIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSEADIEKMVKDAEANAEADKKRR
DNAK_NITWN       QIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSEADIEKMVKDAEANAAEDKKRR
DNAK_RHOPA       QIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSDSEIDKMVKDAEANAAEDKKRR
DNAK_CAUVC       QIEVTFDIDANGIVQVHAKDKATNKEQSIRIQANGGLSDSDIERMVKEAEANKAADEKKK
DNAK_ZYMMO       QIEVTFDIDANGIVNVSAKDKGTGKEQQIRIQASGGLSEGDIDKMVKDAEKFAADDKHRR
DNAK_RHOS4       QIEVTFDIDANGIVSVSAKDKGTGKSQNITIQASGGLSDEDIEKMVRDAEANAEADKKRR
DNAK_RUEPO       QIEVTFDIDANGIVSVSAKDKGTGKEHKITIQASGGLSDEDIEKMVKDAEENAEADKARK
DNAK_RICFE       QIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDSEIEQMVKDAEHNADEDKKRK
DNAK_RICTY       QIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDSEIEQMVKDAEHNADEDKKRK
DNAK_RICPR       QIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDAEIEQMVKDAEHNADEDKKRK
DNAK_RICCN       QIEVTFDIDANGIVHVSAKDKASGKEQKVTIQASGGLSDAEIEQMVKDAEQNADEDKKRK
DNAK_PELUB       QIEVTFDIDANGIVSVSAKDKGTGKEQKIQIQASGGLSDEEIEKMVKDAEANKEEDKKKR
DNAK_EHRRG       QIEVTFDIDANGIVHVSAKDKASGKEQAIRIQSSGGLTDDEIQNMIKEAESKAEEDEKRK
DNAK_EHRRW       QIEVTFDIDANGIVHVSAKDKASGKEQAIRIQSSGGLTDDEIQNMIKEAESKAEEDEKRK
DNAK_EHRCJ       QIEVTFDIDANGIVHVSAKDKASGKEQAIKIQSSGGLSDDEIQRMIKEAEQKAGEDEKRK
DNAK_ANAMM       QIEVTFDIDANGIVHVSAKDKASGKEQTIKIQSSGGLSEEEIKKMVQDAQDRAEEDEKRK
DNAK_WOLPM       QIEVTFDIDANGIAHVSAKDKATGKEQKIRIQSSGGLSDNEINRMVKEAEEKAQEDEKRK
DNAK_WOLTR       QIEVTFDIDANGIVHVSAKDKATGKEQKIRIQSSGGLSESEINRMIREAEEKAQEDEKRK
DNAK_BORBR       QIEVTFDIDANGILHVSAKDKGTGKENKITIKANSGLSEDEIQRMVKDAEANAEEDHRLA
DNAK_BORPE       QIEVTFDIDANGILHVSAKDKGTGKENKITIKANSGLSEDEIQRMVKDAEANAEEDHRLA
DNAK_BORPA       QIEVTFDIDANGILHVSAKDKGTGKENKITIKANSGLSEDEIQRMVKDAEANAEEDHRLA
DNAK_BURPS       QIEVTFDIDANGILHVGAKDKATGKENKITIKANSGLSEAEIEKMVKDAEANAAEDHKLR
DNAK_BURMA       QIEVTFDIDANGILHVGAKDKATGKENKITIKANSGLSEAEIEKMVKDAEANAAEDHKLR
DNAK_BURP1       QIEVTFDIDANGILHVGAKDKATGKENKITIKANSGLSEAEIEKMVKDAEANAAEDHKLR
DNAK_BURL3       QIEVTFDIDANGILHVGAKDKATGKENKITIKANSGLSEAEIDQMIKDAEANAAEDHKLR
DNAK_RALSO       QIEVSFDIDANGILHVGAKDKATGKENKITIKASSGLSEAEIERMVKDAEANAEEDKKLR
DNAK_CUPPJ       QIEVSFDIDANGILHVGAKDKATGKENRITIKANSGLSEDEIQRMVKDAEANAEEDKKAR
DNAK_AROAE       QIEVTFDIDANGILHVSAKDKATGKENKIKIQANSGLSEDEIQRMVQDAAAHAEEDKKAH
DNAK_THIDA       QIEVTFDIDANGILHVSAKDKATGKENKIRIQASSGLSEEEIQRMVKDAEANAAEDHKAF
DNAK_DECAR       QIEVIFDIDANGIMHVTAKDKATGKENKITIKANSGLSEAEIQAMVKDAELHAEEDKKAH
DNAK_NITEU       QIEVIFDIDANGILHVSAKDKATGKENKIKIQASSGLSEDEIQKMVKDAEAHAEEDKKAL
DNAK_NEIMA       QIEVTFDIDANGILHVSAKDKGTGKAANITIQGSSGLSEEEIERMVKDAEANAEEDKKLT
DNAK_NEIG1       QIEVTFDIDANGILHVSAKDKGTGKAANITIQGSSGLSEEEIERMVKDAEANAEEDKKLT
DNAK_NEIMB       QIEVTFDIDANGILHVSAKDKGTGKAANITIQGSSGLSEEEIERMVKDAEANAEEDKKLT
DNAK_CHRVO       QIEVEFNIDANGILHVSAKDKATGKQANITIQASSGLSEAEIERMVKDAEANAEEDKKLH
DNAK_BUCAI       QIEVTFDIDSDGILHVSAKDKKTGKEQKITIKASSGLNEEEIKKMVNDAEANSEADQKFE
DNAK_BUCAP       QIEVTFDIDSDGILHVSAKDKKTGKEQKITIKASSGLNEEEIKKMINDAEANSEADRKFE
DNAK_BUCBP       QIEVTFDIDSDGILHVSAKDKNTGKEQKITIKASSGLNETEIKKMILDAEQNSESDQKFE
DNAK_BLOFL       QIEVTFDIDADGILHVSAKDKNSGREQKITIKASSGLNEEEIKKMVQEAEANAESDRKFE
DNAK_BLOPB       QIEVTFDIDADGILHVSAKDKNSGREQKITIKASSGLNEEEINKMVQEAEANAESDRKFE
DNAK_WIGBR       QIEVTFDIDADGILHVSAKDKNSGREQKITIKASSGLSENEIDKMLKESEANAELDIKFE
DNAK_ECOLI       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFE
DNAK_ECOL6       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFE
DNAK_ECO57       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFE
DNAK_SHIBS       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFE
DNAK_SHIDS       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFE
DNAK_SHISS       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFE
DNAK_SHIFL       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFE
DNAK_SALTI       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVRDAEANAESDRKFE
DNAK_SALPA       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVRDAEANAESDRKFE
DNAK_SALTY       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVRDAEANAESDRKFE
DNAK_SALCH       QIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVRDAEANAESDRKFE
DNAK_YERPE       QIEVTFDIDADGILHVSAKDKNTGREQKITIKASSGLNEEEIQKMVRDAEANAEADRKFE
DNAK_YERPS       QIEVTFDIDADGILHVSAKDKNTGREQKITIKASSGLNEEEIQKMVRDAEANAEADRKFE
DNAK_PHOLL       QIDVTFDIDADGILHVSAKDKNSGREQQITIKASSGLNEEEIQRMVRDAEANAESDRKFE
DNAK_PECAS       QIEVTFDIDADGILHVSAKDKNSGREQKITIKASSGLNEEEIQKMVRDAEANAEADRKFE
DNAK_PASMU       QIEVTFDIDADGIIHVSAKDKGTNKEQKITIKASSGLTDEEIQQMVRDAEANAEADRKFE
DNAK_MANSM       QIEVTFDIDADGIIHVSAKDKGTGKEQQITIKASSGLSDEEIQQMVRDAEANAEADRKFE
DNAK_HAEIN       QIEVTFDIDANGVINVSAKDKNTGKEQQIRIQASSGLSDEEIQQMVRDAEANADADRKFE
DNAK_HAEI8       QIEVTFDIDANGVINVSAKDKNTGKEQQIRIQASSGLSDEEIQQMVRDAEANADADRKFE
DNAK_HAEDU       QIEVTFDIDANGIINVSAKDKNTGKEQQIKIQASSGLSDEEVEQMVRDAEANAESDRQFE
DNAK2_COLP3      QIEVTFDIDADGILHVTAKDKNTGKEQKITIKASSGLSDEEVEQMVRDAEANADADAKFE
DNAK_PSEHT       QIEVTFDVDADGILHVSAKDKDTGKEQKITIQASSGLSDEEVEQMIRDAEAHAEDDKKFE
DNAK_SHEON       QIEVMFDIDADGILHVSATDKKTGKKQNITIKASSGLSEEEVAQMVRDAEAHAEEDKKFE
DNAK_VIBVU       QIEVTFDLDADGILHVSAKDKQTGKEQKITIQASGGLSDAEIEKMVQEAEANKEADKKFE
DNAK_VIBVY       QIEVTFDLDADGILHVSAKDKQTGKEQKITIQASGGLSDAEIEKMVQEAEANKEADKKFE
DNAK_VIBPA       QIEVTFDLDADGILHVSAKDKQTGKEQKITIQASGGLSDDEIEKMVQEAEANKEADKKFE
DNAK_VIBCH       QIEVIFDLDADGILHVSAKDKQTGKEQKITIQASGGLSDAEIEKMVQEAEANKEADKKFE
DNAK1_ALIF1      QIEVTFDLDADGILNVSAKDKSTGKEQKITIQASGGLTDEEIEAMVQEAEANKDADKKFE
DNAK2_ALIF1      QIEVTFDLDADGILNVSAKDKATGKEQKITIQASGGLTDEEIEAMVQEAEANKDADKKFE
DNAK1_PHOPR      QIEVTFDLDADGILHVSAKDKSTGKEQKITIQSSSGLSEEDIEKMVQEAEANKESDKKFE
DNAK2_PHOPR      QIDVTFDLDADGILHVSATDKATNKEQKITIQASGGLSNDDIEKMVQEAEANKEADKMFE
DNAK_IDILO       QIEVTFDIDADGILHVSAKDKDTGKEQKITIKASSGLDESEVDKMVKDAEAHAEEDKKFE
DNAK_XANAC       QVEVSFDIDANGILHVSAKDKKTNKEQKVEIKAGSGLSDEEIQRMVADAEANREEDKKFQ
DNAK_XANC5       QVEVSFDIDANGILHVSAKDKKTNKEQKVEIKAGSGLSDEEIQRMVADAEANREEDKKFQ
DNAK_XANCP       QVEVSFDIDANGILHVSAKDKKTNKEQKVEIKAGSGLSDEEIQRMVADAEANREEDKKFQ
DNAK_XANC8       QVEVSFDIDANGILHVSAKDKKTNKEQKVEIKAGSGLSDEEIQRMVADAEANREEDKKFQ
DNAK_XANOR       QVEVSFDIDANGILHVSAKDKKTNKEQKVEIKAGSGLSDEEIQRMVADAEANREEDKKFH
DNAK_XYLFA       QIEVSFDIDANGILHVSAKDKKTNKEQKVEVKAGSGLSDSEIQQMVADAEAHREEDKKFQ
DNAK_XYLFT       QIEVSFDIDANGILHVSAKDKKTNKEQKVEVKAGSGLSDSEIQQMVADAEAHREEDKKFQ
DNAK_PSEPK       QIEVTFDIDANGILHVGAKDKATGKTQSIVIKANSGLSDEEIERMVRDAEANAEEDRKFE
DNAK_PSEPF       QIEVTFDIDANGILHVGAKDKATGKEQKITIKANSGLSDEEIQKMVRDAELNAEEDRKFE
DNAK_PSE14       QIEVTFDIDANGILHVGAKDKATGKQQSIVIKANSGLSEEEIQQMVRDAEVNSEEDRKFE
DNAK_PSEU2       QIEVTFDIDANGILHVGAKDKATGKQQSIVIKANSGLSEEEIQQMVRDAEVNSEEDRKFE
DNAK_PSESM       QIEVTFDIDANGILHVGAKDKATGKQQSIVIKANSGLSEEEIQQMVRDAEVNSEEDRKFE
DNAK_PSEF5       QIEVTFDIDANGILHVGAKDKATGKTQSIVIKANSGLSDEEIQQMIRDAEANSEEDRKFE
DNAK_PSEAE       QIEVTFDIDANGILHVSAKDKATGKQQSIVIKASSGLSEDEIQQMVRDAEANAEEDRKFE
DNAK_ACIAD       QIEVSFDINADGILKVSAKDKSTGKEQSIQIKANSGLSDAEIEAMIKDAEANAEEDRKFE
DNAK_PSYA2       QIEVSFDINADGIMNISATDKGTGKAQSIQIKADSGLSDEEVEQMIRDAEANAAEDEKFA
DNAK_FRATT       QIEVTFDIDANGILNVSAKDKATGKEQNIVIKSSSGLSEEDIEKMVQDAEANAEADKKFH
DNAK_LEGPH       QIEVTFDIDANGILNVSAKDKATGKAQSIVIKASSGLSEEEVAAMVKDAQSHAEEDKKFK
DNAK_LEGPL       QIEVTFDIDANGILNVSAKDKATGKAQSIVIKASSGLSEEEVAAMVKDAQSHAEEDKKFK
DNAK_LEGPA       QIEVTFDIDANGILNVSAKDKATGKAQSIVIKASSGLSEEEVAAMVKDAQSHAEEDKKFK
DNAK_COXBU       QIEVTFDIDANGILHVSAKDKATGKEQSIVIKASSGLSDEEVEKMVKDAEAHRDSDRKFH
DNAK_METCA       QIEVTFDIDANGILNVSAKDKATGKQQSIVIRASSGLSEDEIKRMVKDAELHAEEDRRMH
DNAK_NITOC       QIEVTFDIDANGILNVSAKDKATGKEQSIVIKASSGLAEGEIERMVSDAEAHVEEDRKFR
DNAK1_COLP3      QVEVTFDIDVNGILNVSAKDKATGKEQSIKITASSGLTEDEINRMVKEAELHASEDKQKR
DNAK_DESAG       QIEVSFDIDANGIVNVSAKDLGTGKEQSIRITASSGLSEDEIQNLVKEAEAHADEDKKKK
DNAK_DESVH       QIEVSFDIDANGIVNVAAKDLGTGKEQSIRITASSGLSEDEIQRLVKEAEAHADDDKKKQ
DNAK_GEOSL       QIEVTFDIDANGIVHVSAKDLGTGKEQSIRITASSGLSKEEIDKMVKEAEAHSAEDKKKR
DNAK_PELCD       QVEVTFDIDANGILHVSAKDLGTGKEQSIRITASSGLSDEEIDKMVKDAEAHSSEDKKKR
DNAK_DESPS       QIEVTFDLDANGILNVSAKDMGTGKEQSIKITASSGLTDEEIDRMTKDAELHADEDKKRK
DNAK_CAMJE       QIEVTFDIDANGILTVSAKDKATGKAQEIKITGSSGLSEEEINNMVKDAELHKEEDKKRK
DNAK_CAMJR       QIEVTFDIDANGILTVSAKDKATGKAQEIKITGSSGLSEEEINNMVKDAELHKEEDKKRK
DNAK_HELHP       QIEVTFDIDANGILTVSAKDKATGKSQEIKISGSSGLSDAEIEKMVKEAELHKEEDTKKK
DNAK_WOLSU       QIEVTFDIDANGILTVSAKDKATGKSQEIKITGSSGLSDSEIEKMVKDAELHKEEDSKRK
DNAK_HELPY       QIEVTFDIDANGILTVSAQDKNTGKSQEIKISGSSGLSDSEIEKMVKDAELHKEEDAKKK
DNAK_HELPJ       QIEVTFDIDANGILTVSAQDKNTGKSQEIKISGSSGLSDSEIEKMVKDAELHKEEDARKK
DNAK_FUSNN       QIEVTFDIDANGIVHVSAKDLGTGKENKVTISGSSNLSKEEIERMTKEAEAHAEEDKKFQ
DNAK_RHOBA       QIEVKFDIDQNGILSVSAKELKTGKEANVEIKDSGALSDSDIEQMQKDAEANAEEDKRQF
DNAK_BACFN       QIEVTFDIDANGILKVSAKDKATGKEQAIRIEASSGLSKEEIEKMKAEAEANAEADKKER
DNAK_BACFR       QIEVTFDIDANGILKVSAKDKATGKEQAIRIEASSGLSKEEIEKMKAEAEANAEADKKER
DNAK_BACTN       QIEVTFDIDANGILKVSAKDKATGKEQAIRIEASSGLSKEEIEKMKAEAEANAEADKKER
DNAK_PORGI       QIEVTFDIDANGILNVTAHDKATGKKQNIRIEASSGLSDDEIKRMKEEAQANAEADKKEK
DNAK_CHLTE       QIEVTFDIDANGILNVSAKDKATGKEQSIKIEASGKLTEAEIEKMKEDAKAHAAEDQKRK
DNAK_CHLCH       QVEVIFDIDANGILHVSAKDKATGKEQSIRIEASSKLSDAEINKMKDDAKQHADEDKKRK
DNAK_BORBU       QIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSESEIDRMVKDAEAHAEEDKKLK
DNAK_BORBP       QIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSESEIDRMVKDAEAHAEEDKKLK
DNAK_TREPA       QIEVTFDIDANGIVHVSAKDLGTGKEQHIRIESSSGLSESEIDRMVKEAEANAESDKRER
DNAK_TREDE       QIEVTFDIDANGIVHVSAKDLGTGKEQHIRIESSSGLSESEIDRMVKEAEANAENDKLEK
DNAK_LEPIC       QIEVTFDIDANGIVHVSAKDLGTGKEQKIRIESSSGLSEDEIQKMVKDAEAHAAADKAQR
DNAK_LEPIN       QIEVTFDIDANGIVHVSAKDLGTGKEQKIRIESSSGLSEDEIQKMVKDAEAHAAADKAQR
DNAK_BDEBA       QVEVTFDIDANGILHVSAKDMSSGKSQQIKITAQSGMSEDEIKRAVADAEGHAEEDKRKA
DNAK_CHLAB       QIEVTFDIDANGILHVSAKDAASGREQKIRIEASSGLKEDEIQRMINDAEKNKEEDKKRR
DNAK_CHLCV       QIEVTFDIDANGILHVSAKDAASGREQKIRIEASSGLKEDEIQRMINDAEKHKEEDKKRR
DNAK_CHLPN       QIEVSFDIDANGIFHVSAKDVASGKEQKIRIEASSGLQEDEIQRMVRDAEINKEEDKKRR
DNAK_CHLTR       QIEVTFDIDANGILHVSAKDAASGREQKIRIEASSGLKEDEIQQMIRDAELHKEEDKQRK
DNAK_CHLTA       QIEVTFDIDANGILHVSAKDAASGREQKIRIEASSGLKEDEIQQMIRDAELHKEEDKQRK
DNAK_CHLMU       QIEVTFDIDANGILHVSAKDAASGREQKIRIEASSGLKEEEIQQMIRDAELNKEEDKKRR
DNAK_PARUW       QIEVAFDIDADGILHVSAKDLSSGKEQKIRIEAQSGLQEEEIKRMVRDAEEHAEEDKKRK
DNAK_DEHM1       QIEVTFDIDANGILSVKAKDKGTGREQKITITASSGLSKEEVEKMTREAEAHAAEDSKRK
DNAK_DEHMC       QIEVTFDIDANGMLSVKAKDKGTGREQKITITASSGLSKEEVEKMTREAEAHAVEDTKRK
DNAK_CLOPE       QIEVAFDIDANGIVKVSATDKATGKEANITITASTNLSDAEIDKAVKEAEQFAEEDKKRK
DNAK_CLOTE       QIEVTFDIDANGIVNVSAKDKGTGKEANITITASTNLSDDEVEKAVNDAKKFEEEDKKRK
DNAK_CLOAB       QIEVTFDIDANGIVNVSAKDKGTGKESHITITASTNLSDEEIDKAVKDAEKFAEEDKKKK
DNAK_METAC       QIEVAFDIDANGILHVNAKDLGTGKEQSISIQKPGGLSDAEIERMVKDAELHAEEDKKRK
DNAK_METMA       QIEVTFDIDANGILHVSAKDLGTGKQQSISIQKPGGLSDDEIERMVKDAEMHAEEDRKRK
DNAK_METBF       QIEVTFDIDANGILHVGAKDLGTGKEQSISIQKPGGLSDDEIDRMVKDAELHAEEDKKRK
DNAK_CALS4       QIEVTFDIDANGIVHVSAKDLATGKSQQITITGSTNLSEEEIQRMINEAKQYEEQDRKKR
DNAK_CARHZ       QIEVRFDIDVNGIVHVSAKDLGTGREQSITITNTSNLSEAEIKRMVEEAERYAEEDRKRK
DNAK_SYMTH       KIEVTFDIDVNGIVHVSAKDLGTGKEQKITIQSQTSMSKEEIERAIKEAEAMAAEDKKRR
DNAK_AQUAE       KIEVCFDIDADGILHVTAKDLGTGKEQSVRVEISSGLTPEEIERIIKEAEEHAEEDRKKK
DNAK_THEMA       QIEVTFDIDSDGIVHVSAKDLGSGKEQSMVVTGRHKLSEDEIKRMIEDAKRYEEQDKRLK
DNAK_THEAC       QIEVTFDIDSNGILNVTAVDKATGKKQGITITASTKLSKEEIERMKKEAEQYAEQDRKAK
DNAK_THEVO       QIEVTFDIDSNGILNVTAVDKATGKKQGITITASTKLSKDEIERMKKEAEQYAEQDRKMK
DNAK_PICTO       QIEVTFDIDANGILNVSAKDLGTGKQQSISITATNKLSKDEIERMKKEAEQYAEQDKKAK
DNAK_METTH       QIEVTFDIDANGILNVSAKDLGTGKEQAITITAPNKLSEEEIKQKIEEAKKHAEEDRRKQ
DNAK3_NOSS1      QIEVSFEIDVNGILKVAAQDKGTGREQSIRITNTGGLSTNEVERMRQEAEVFAEEDRRRK
DNAK1_THEEB      QIDVTFDIDANGILSVSAVDRATGRQQSVRITNRGGLSSMEIERMRQEAQIYAQVDQIKK
DNAK3_SYNP6      QIELAFDIDADGILNVSARDRGTGRAQGIRITSTGGLTSDEIEAMRRDAELYQEADQINL
DNAK1_NOSS1      QIQVAFDIDANGILQVTALDRTTGREQSITIQGASTLSESEVNRMIQEAQKYADVDRERK
DNAK3_SYNY3      QVQVSFDIDANGILQVTARDKTTGREQSITVQGASILSEGEVNRMIQEAETFAAQDRERR
DNAK3_THEEB      QIQVSFDLDANGLLQVVALDRFSGREQSVVIQGASTLSEEEIQQMLLDAESNAAGDRQRR
DNAK1_SYNP6      QVQVSFDIDANGILQVSALDKTTGREQTVTIQGASTLSQEEVKRMMKDAELYAQQDRQLK
DNAK1_PROMM      QVQVAFDIDANGLLQVSATDRTTGRKQSVNIQGGSTLNEEELQALLAEAEAKAGEDRRRR
DNAK1_SYNPX      QVQVAFDIDANGLLQVSATDRTTGRKQSVSIQGGSNLNEDEVTALLAEAEARADEDRRKR
DNAK1_PROMA      QVQVAFDIDANGMLQVSATDRTTGRKQSVSINGGSNLNEDEVNNLIEEAKDKADVDRRKR
DNAK1_PROMP      QVQVAFDIDANGLLEVSATDRTTGRKQTVSISGGSNLNEQEINMMIAEAKSKSTEDRIKR
DNAK_THET8       QIEVCFDIDANGILHVTAKERSTGREASITIQNTTTLSEEEIQRIIEEAKRHAEEDRRRR
DNAK_THET2       QIEVCFDIDANGILHVTAKERSTGREASITIQNTTTLSEEEIQRIIEEAKRHAEEDRRRR
DNAK_DEIRA       QIEVTFDIDANGILHVTAKEKTSGKESSITIENTTTLDKTDVERMVQEAEQNAAADKQRK
DNAK2_NOSS1      QIEVVFDIDANGILNVTAKDKGTGKEQSISITGASTLDKTDIDRMVREAEQNASSDKERR
DNAK2_SYNY3      QIEVTFDIDANGILNVTAKDRGTGKEQSISITGASTLPDTEVDRMVKEAESNAAADKERR
DNAK2_THEEB      QIEVTFDIDANGILNVTARDKGTGKQQSISITGASTLPKEEVERMVREAEMNAAADKAKR
DNAK2_PROMA      QIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAETNATADKEKR
DNAK_PROMT       QIEVTFDIDANGILSVNAKDKGSGKEQSISITGASTLSDNEVDKMVKDAEMNASADKEKR
DNAK2_PROMP      QIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVDKMVKDAESNASVDKEKR
DNAK2_PROMM      QIEVTFDIDANGILSVNAKDKGSGKEQSISITGASTLSENEVEKMVKDAETNASADKEKR
DNAK2_SYNPX      QIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDSEVDKMVKDAEANASADKEKR
DNAK2_SYNP6      QIEVIFVIDANGILNVTAKDKGSGKEQSISITGASTLSDNEVDRMVKDAEANAAADKERR
DNAK_GLOVI       QVEVTFDIDANGILSVTAKDKASGKAQTISITGASTLSKDDVAKMVNEAESFAGEDKKRR
DNAK2_STRAW      QVEVTFDIDANGILNVTARDKDTGKEQGITISESSNLDRSEVERMVQEAERNQGQDQALR
                 ::.: * :: :*:  : * :  : .   : :     :   ::     ::      *    

DNAK_MYCH7       DKIETTVRAEGLINQLEKSIT-----DQGEKIDPKQKELLEKQIQELKDLLKEE------
DNAK_MYCHJ       DKIETTVRAEGLINQLEKSIT-----DQGEKIDPKQKELLEKQIQELKDLLKEE------
DNAK_MYCPU       EKVEVIVRAESLISQLEKSLV-----DQGDKVDAKAKEETQKQIQELKDLIKDD------
DNAK_MYCMO       EKIDVTVRAETLINQLEKTIK-----DQGDKIDPKEKEQTEKEITNIKDLILQD------
DNAK_MYCS5       EEAETIVRAESLIDQVKKALE-----AQGDKADAKTKEESDKLIKELQDLIDKK------
DNAK_MYCHO       HEIEVIVKAEQLSNDLEKTLKS----EQAKNLGEPQKQELQKEIDEIKELINKK------
DNAK_UREPA       HERELVNRADSLINQLEQVSK-------TENVPQEQKDVFNKQIEDLTNARDAQ------
DNAK_MYCGE       ERIELRNEGEGIVNTIKEILAS----PDAKNFPKEEKEKLEKLTGNIDAAIKAN------
DNAK_MYCPN       ERIELRNEGESIVSTIKEILQS----PEAKDFPKEEKEKLDKITGGIDAAIKAN------
DNAK_MYCGA       QRIEMRYEGEGIVNTINEILGS----KEAEALPAQEKASLTKIVDGINGALKAE------
DNAK_MYCPE       EQQEIRYKAESLINMFKTSLNG----EEGKKVDAKQKEEAEKMINEFETLLKEE------
DNAK_MESFL       KNIELKHKAESYVAIIESSLT-----QEGQEIPQEQKEQAEKMVAEVKELIEKE------
DNAK_MYCMS       KNIELKNKAENYINIIENSLL-----QAGDKISAEQKEQSQKMVDEIKELVKNE------
DNAK_BACAN       EEVELRNEADQLVFQTDKVVK-----DLEGKVDAAEVAKATEAKEALQAAIEKN------
DNAK_BACCZ       EEVELRNEADQLVFQTDKVVK-----DLEGKVDAAEVAKATEAKEALQAAIEKN------
DNAK_BACHK       EEVELRNEADQLVFQTDKVVK-----DLEGKVDAAEVAKATEAKEALQAAIEKN------
DNAK_BACCR       EEVELRNEADQLVFQTDKVVK-----DLEGKVDAAEVAKATEAKEALQAAIEKN------
DNAK_BACC1       EEVELRNEADQLVFQTDKVVK-----DLEGKVDAAEVAKATEAKEALQAAIEKN------
DNAK_BACSU       EEIEVRNEADQLVFQTEKTLK-----DLEGKVDEEQVKKANDAKDALKAAIEKN------
DNAK_BACLD       EEIELRNEADQLVFTTEKTLK-----DLEGKADEAQVKKANEAKDALKAAIEKN------
DNAK_GEOKA       EAAELRNEADQLIFMTDKTLK-----EVEGKVSADEIKKAQDAKEALKAALEKN------
DNAK_OCEIH       EEVDLRNEADQLIFTTDKTIK-----DLDDKVSEEDKQKAESAKDELKQALESG------
DNAK_BACHD       EEVELRNEADQLVFTTEKTLK-----DLGDNVDEAEKTKAEEAKEKLKKAIEAN------
DNAK_BACSK       EQVELRNEADQLVFSTEKTLK-----DLGDNVDQAEKDKAEAAKDKLKKALEAD------
DNAK_STRA3       EEVDLKNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKKAQESG------
DNAK_STRA5       EEVDLKNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKKAQESG------
DNAK_STRA1       EEVDLKNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKKAQESG------
DNAK_STRP1       EEVDLKNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKAAQESG------
DNAK_STRP6       EEVDLKNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKAAQESG------
DNAK_STRP8       EEVDLKNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKAAQESG------
DNAK_STRPM       EEVDLKNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKAAQESG------
DNAK_STRP3       EEVDLKNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKAAQESG------
DNAK_STRMU       EEVDLKNEVDQAIFTTEKTIK-----ETEGKGFDTERDAAQAALDDLKKAQESG------
DNAK_STRPN       EEVDLRNEVDQAIFATEKTIK-----ETEGKGFDAERDAAQAALDDLKKAQEDN------
DNAK_STRR6       EEVDLRNEVDQAIFATEKTIK-----ETEGKGFDAERDAAQAALDDLKKAQEDN------
DNAK_STRT1       AEVELRNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKKAQESG------
DNAK_STRT2       AEVELRNEVDQAIFATEKTIK-----ETEGKGFDTERDAAQSALDELKKAQESG------
DNAK_LACLA       EEVDTRNEADALVFQTEKTLK-----DLEGKVEEAEVKKAEEAKEELKKALEGE------
DNAK_ENTFA       EEVDLRNDADALLFTVDKTLK-----ELEGKVDAEEVKKAEDARDELKAAIEAN------
DNAK_LISMF       ENAELRNNADQLVFTVDKTLK-----ELEGKVEEEEVKKAEAARDELQEALKGE------
DNAK_LISMO       ENAELRNNADQLVFTVDKTLK-----ELEGKVEEEEVKKAEAARDELQEALKGE------
DNAK_LISIN       ENAELRNNADQLVFTVDKTLK-----ELEGKVEEEEVKKAEAARDELQEALKGE------
DNAK_STAAC       EEVDLRNEADSLVFQVEKTLT-----DLGENIGEEDKKSAEEKKDALKTALEGQ------
DNAK_STAAM       EEVDLRNEADSLVFQVEKTLT-----DLGENIGEEDKKSAEEKKDALKTALEGQ------
DNAK_STAAN       EEVDLRNEADSLVFQVEKTLT-----DLGENIGEEDKKSAEEKKDALKTALEGQ------
DNAK_STAAR       EEVDLRNEADSLVFQVEKTLT-----DLGENIGEEDKKSAEEKKDALKTALEGQ------
DNAK_STAAS       EEVDLRNEADSLVFQVEKTLT-----DLGENIGEEDKKSAEEKKDALKTALEGQ------
DNAK_STAAW       EEVDLRNEADSLVFQVEKTLT-----DLGENIGEEDKKSAEEKKDALKTALEGQ------
DNAK_STAES       EEVDLRNEADSLVFQVEKTVK-----DLGENISDEDKKNAEEKKDALKTALEGE------
DNAK_STAEQ       EEVDLRNEADSLVFQVEKTVK-----DLGENISDEDKKNAEEKKDALKTALEGE------
DNAK_STAHJ       EEVDLRNEADSLVFQVEKTIT-----DLGDNISEEDKSNAESKKDALKSALEGQ------
DNAK_STAS1       EESDLRNEADSLVFQVEKTIT-----DLGENISEEDKQNAEDKKEALKSALEGE------
DNAK_LACAC       DEADLRNEVDQLIFTTEKTLK-----ETKGKVSDEDTKKVQEALDDLKKAQKDN------
DNAK_LACJO       EEVDLRNEVDQLIFTTEKTLK-----ETEGKVPETETKNVQDALDALKKAQKDN------
DNAK_LACSK       EEVDLKNDVDQLIFQTDKTLK-----ELEGKVSDEELQKAKDAKEELVKAQQEN------
DNAK_LACSS       EEVDLKNDVDQLIFQTDKTLK-----ELEGKVSDEELQKAKDAKEELVKAQQEN------
DNAK_LACPL       EEVDLKNEVDQLIFTTDKTLK-----DLEGKVSEDEVKKAKDARDALKKAQDDN------
DNAK_ONYPE       ESIDARNEAENMIFHTKKSLE-----DLKADVTPEEKDKVETQIKELEEALKGD------
DNAK_TROWT       ARVDQKNQAEQMVYTAEKLIGD-----NA-KVNEEAKKELQADIDSLKSAIQAD------
DNAK_TROW8       ARVDQKNQAEQMVYTAEKLIGD-----NA-KVNEEAKKELQADIDSLKSAIQAD------
DNAK_LEIXX       ESAETRNQAEQLVYSIEKLIKD-----NEEKLPEDIKNEVQGDVDALKAALAGE------
DNAK_BIFLO       EDAETRNQAEAFAYSTEKLVND-----NKDKLSDDIVKEVTDKVNALKEALKGD------
DNAK_COREF       EEQEIRNNAESLVYQTHKFVEE-----NDGKISEELKGKVEEAAKGVEETLKGE------
DNAK_CORGL       EEQEVRNNAESLVYQTRKFVEE-----NSEKVSEDLKAKVEEAAKGVEEALKGE------
DNAK_CORDI       EEQETRNSAESMAYQTRKFLDE-----NGEKVSEEIKTKVTEAADAVDEALKGE------
DNAK_CORJK       EEQEVRNSAESMAYQTRKFVED-----NKDKVSEDTQNKVEEAAKAVDEALKGD------
DNAK_MYCLE       EEADVRNQAETLVYQTEKFVKEQRETENGSRVPEDTLNKVEAAVAEAKTALGGT------
DNAK_MYCPA       EEADVRNQAESLVYQTEKFVKDQREAEGGSKVPEETLSKVDAAIADAKTALGGT------
DNAK_MYCTU       EEADVRNQAETLVYQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGS------
DNAK_MYCBO       EEADVRNQAETLVYQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGS------
DNAK_NOCFA       EEAETRNQAETLVHQTEKFIKD-----NEDKVPADVKSKVEAAIAEANEALAGT------
DNAK1_STRAW      EAAETRNQGEQLVYQTEKFLKD-----NEDKVPGEVKTEVEASIEELKAALKGESAEG--
DNAK_STRCO       EAAESRNQGEQLVYQTEKFLKD-----NEDKVPGEVKTEVESAVAELKEKLKGE------
DNAK_THEFY       EEAETRNNAESLVYQTEKVISE-----NEDKIPEDVKNETKEALDGLKKALEGS------
DNAK_CUTAK       EAVEMRNEADALAFRTEKLLDE-----NSDKIPEDTKTPVTEAIATLKETLKGTD-----
DNAK_HALMA       ERIEARNEAEASVRRAETLLDE-----NEEEIDEDLQSDIEAKIEDVEEVLEDEDA----
DNAK_NATPD       ERIEARNEAESTLQRAETLLDE-----NEDAVDDDLRADIEASMDDLREVVEDEDA----
DNAK_HALSA       RRIEARNEAETAIQRAESLLEE-----NEELVDEDLEADVNDAIDDVQAVLDEDEP----
DNAK_AGRFC       AGVEAKNQAESLIHSTEKSVKEYG----DK-VSETDRKAIEDAIASLKTAVEAAE-----
DNAK_RHIME       EGVEAKNQAESLVHSSEKSLQEHG----DK-VSETDRKAIEDAIAALKSAVEVSE-----
DNAK_RHILO       AVVEARNQAEALVHSSEKSLKEYG----DK-VSEAERTAISDAIAALKTAAEGD------
DNAK_BRUME       ESVEAKNQAESLVHSTEKSLAEYG----DK-VSADDKKAIEDAIAALKTSLEGE------
DNAK_BRUAB       ESVEAKNQAESLVHSTEKSLAEYG----DK-VSADDKKAIEDAIAALKTSLEGE------
DNAK_BRUSU       ESVEAKNQAESLVHSTEKSLAEYG----DK-VSADDKKAIEDAIAALKTSLEGE------
DNAK_BARHE       EGVEARNQAEALIHSTEKSLTEYG----DK-VSTEEKEQIETAISDLKSVLDST------
DNAK_BARQU       EGVEARNQAEALIHSTEKSLTEYG----DK-ISTEEKEQIETAISDLKSALDGT------
DNAK_BRADU       EAVTAKNEADGLVHSTEKALAEHG----SK-VAETERRAIEDAVSDLKEALKGD------
DNAK_NITWN       EAVDAKNQADSLVHSTEKALTEHG----SK-IEESERRAIEDAVSDLKEALKGD------
DNAK_RHOPA       EAVDAKNHADALVHSTEKALAEHG----SK-VDESERRSIEDALSDLREALKGD------
DNAK_CAUVC       QLVEAKNQGEAILHSTEKALAEHG----DK-VGAAEKTAIETGITELKTALEGE------
DNAK_ZYMMO       ELAEAKNNGDSLVHTTERQLTELG----DK-VDAALKTEVEAAVAAVKTALEGE------
DNAK_RHOS4       ELVETKNQGESLLHSTRKSIEEHG----DK-VDPSTVEAIELAMGALEEALKSE------
DNAK_RUEPO       ELVEARNQAESLIHSTEKSVEEHG----DK-VDPTTVEAIELAIAALKDDLDKDG-----
DNAK_RICFE       ELIETKNAADSLVYSTEKTLREYG----DK-LSSEEKGAVEEALASLKSALESE------
DNAK_RICTY       ELIETKNAADSLVYSTEKTLREYG----DK-LSSEEKGAVEEALASLKSALESE------
DNAK_RICPR       ELIETKNAADSLVYSTEKTLREYG----DK-LSSEEKGTVEEALTSLKAALESE------
DNAK_RICCN       ELIEAKNAADSLVYSTEKTLTEYG----DK-LSSDDKGAVEAALAALKAVLESE------
DNAK_PELUB       ESVDVRNQADTLLHSTEKNLKEHG----AK-VSDADKKAIEDASTDLKEAIKGT------
DNAK_EHRRG       KFVEVKNNAENLVHSTEKSLKEHG----DK-ISNADKLDIENAIRDLKDCISKDN--I--
DNAK_EHRRW       KFVEVKNNAENLVHSTEKSLKEHG----DK-ISNADKLDIENAIRDLKDCISKDN--I--
DNAK_EHRCJ       KFIELKNNGENLVHSTEKSLNEYG----DK-IPNSDRLEIENAIRDVRDALGNSD--V--
DNAK_ANAMM       KRVELKNSAEALIHSTEKSLNDYG----DK-ISSADKSGIEAAIKELRECLSNDD-----
DNAK_WOLPM       KFIEVKNQADSLVHSTEKSLTEYG----DK-VSPEDRSAIENAVNELKEVSKSDN--I--
DNAK_WOLTR       KFVEVKNQADSLVHSTEKSLKEYG----DK-VSPEDKSAIENAVNELKEASKSDN--I--
DNAK_BORBR       ELAQARNQADALVHATRKSLTEYG----EK-LEAAEKESIEAAIKDLEDILK-----T--
DNAK_BORPE       ELAQARNQADALVHATRKSLTEYG----EK-LEAAEKESIEAAIKDLEDILK-----T--
DNAK_BORPA       ELAQARNQADALVHATRKSLTEYG----EK-LEAAEKESIEAAIKDLEDILK-----T--
DNAK_BURPS       ELAESRNQGDALVHSTKKALTEYG----DK-LEAGEKEKIEAALKELEDVLKNA---S--
DNAK_BURMA       ELAESRNQGDALVHSTKKALTEYG----DK-LEAGEKEKIEAALKELEDVLKNA---S--
DNAK_BURP1       ELAESRNQGDALVHSTKKALTEYG----DK-LEAGEKEKIEAALKELEDVLKNA---S--
DNAK_BURL3       ELADSRNQGDALVHSTKKALTEYG----DK-LDAGEKEAIEASLKSLEELLKDS---S--
DNAK_RALSO       ELVDSRNQGEALVHSTRKALGEYG----DK-LEAGEKDKIEAAIKDLEDVLK-----G--
DNAK_CUPPJ       ELADARNQADALVHSTKKAVTEYG----DK-LEAGEKEKIEAAIKELEDAAR-----G--
DNAK_AROAE       ELVDIRNQCDALVHSVKKSLTEYG----DK-ISADEKEKIEQAMKDAEEALK-----G--
DNAK_THIDA       ELAGARNAADAMIHSVKKSLAEYG----DK-VSADEKATIESALKEAEDAVR-----E--
DNAK_DECAR       ELADARNQADGMVHMVKKSLTEYG----DK-LDASEKAAIEAAIKDVEDVLR-----D--
DNAK_NITEU       DLVNSRNQCDAMIHSVRKSLAEYG----DK-LEGDEKSRIEAALKEAEEALK-----S--
DNAK_NEIMA       ELVASRNQAEALIHSVKKSLADYG----DK-LDAAEKEKIEAALKEAEEAVK-----G--
DNAK_NEIG1       ELVASRNQAEALIHSVKKSLADYG----DK-LDAAEKEKIEAALKEAEEAVK-----G--
DNAK_NEIMB       ELVASRNQAEALIHSVKKSLADYG----DK-LDAAEKEKIEAALKEAEEAVK-----G--
DNAK_CHRVO       ELVTARNHAEGLIHSIKKSLGEHG----DK-IGADEKAKIESALKEAEEVVK-----G--
DNAK_BUCAI       ELIQTRNQGDQLVHSIKKQLNENK----NS-IEEESKKDIQLALNKLENALK-----G--
DNAK_BUCAP       ELIQVRNQGDQLIHSIRKQLDENK----NQ-IEKKELEKIKSALDELERSLK-----G--
DNAK_BUCBP       ELVKVRNQGDQISHSTKKQLKDLE----KT-INVNDQKEINEALNKLDTALK-----G--
DNAK_BLOFL       ELVQIRNQADHLLHSTRKQLKEVG----DR-ISLDDKNSIEQSLKELELVMK-----N--
DNAK_BLOPB       ELVQIRNQADHLLHSTKKQLTEVG----DN-ISLDDKSAIEGALKELESVIK-----K--
DNAK_WIGBR       ELVKTKNQADHLLHSTRKQIKEA-----KN-LPLEKKTEIEKCINELELSIK-----G--
DNAK_ECOLI       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALTALETALK-----G--
DNAK_ECOL6       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALTALETALK-----G--
DNAK_ECO57       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALTALETALK-----G--
DNAK_SHIBS       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALTALETALK-----G--
DNAK_SHIDS       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALTALETALK-----G--
DNAK_SHISS       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALTALETALK-----G--
DNAK_SHIFL       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALTALETALK-----G--
DNAK_SALTI       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALSALETALK-----G--
DNAK_SALPA       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALSALETALK-----G--
DNAK_SALTY       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALNALETALK-----G--
DNAK_SALCH       ELVQTRNQGDHLLHSTRKQVEEAG----DK-LPADDKTAIESALNALETALK-----G--
DNAK_YERPE       ELVQTRNQADHLIHGTRKQLEEAG----DK-LPAEDKTAIEEAMKGLEAALK-----G--
DNAK_YERPS       ELVQTRNQADHLIHGTRKQLEEAG----DK-LPAEDKTAIEEAMKGLEAALK-----G--
DNAK_PHOLL       ELVQVRNQADQLVHGTRKQVEEAG----DK-LPAEDKTAIESAVAELEKVAK-----G--
DNAK_PECAS       ELVQARNQGDHLLHSTRKQLEEVG----DK-LAADDKTAIDDALKALESALK-----G--
DNAK_PASMU       ELVQARNQADHLVHGTRKQLSEVG----DK-LSAEDKAPIEKAVADLEAAAK-----G--
DNAK_MANSM       ELVQARNQADALVHSTRKQLTEAG----DK-LSADDKAPIEKAVNELEAAAK-----G--
DNAK_HAEIN       EVVQARNQADGIAHATRKQIAEAG----DA-LSVADKEKIEAAVAELETAAK-----G--
DNAK_HAEI8       EVVQARNQADGIAHATRKQIAEAG----DA-LSVADKEKIEAAVAELETAAK-----G--
DNAK_HAEDU       ELVQTRNQADSIAHATRKQISEAG----DA-LTAEDKAKIETALAELETAAK-----G--
DNAK2_COLP3      ELVTARNQADGMIHATRKQVEEAG----EE-LPSEDKEKIEAALTELEEAVK-----G--
DNAK_PSEHT       ELVATRNQADAMVHGTRKQIEEAG----DA-LPSEDKEAIEAAVVDLETAIK-----S--
DNAK_SHEON       ELVQSRNQADGLVHATKKQVEEAG----DA-LPSEDKAKIEAAMSAVETAVK-----G--
DNAK_VIBVU       ELATARNQADQIIHGTRKQVEEAG----EA-LPADEKAKIETAISELEEARK-----G--
DNAK_VIBVY       ELATARNQADQIIHGTRKQVEEAG----EA-LPADEKAKIETAISELEEARK-----G--
DNAK_VIBPA       ELATARNQADQMIHGTRKQMEEAG----DA-LPAEEKEKIETAISELEEARK-----G--
DNAK_VIBCH       ELATARNQADQMIHATRKQITEAG----EA-LPADEKAKIETAINELETAKK-----G--
DNAK1_ALIF1      ELVTARNQADQMIHGTKKQIEEAG----DD-LPTDEKEKIEAAITALEGVKS-----G--
DNAK2_ALIF1      ELVTARNQADQMIHGTQKQIEEAG----DA-LPADEKEKIEAAIKALEEVKS-----G--
DNAK1_PHOPR      ELVTARNQADQLIHGTRKQVEEAG----EA-LPAEDKEKIEAAVSELEEARK-----A--
DNAK2_PHOPR      ELVTARNQADQLVHSTRKQVEELG----DA-LPADEKAKIDTAIADVETALK-----G--
DNAK_IDILO       EMVQARNQADGLVHATRNQLKEVG----DA-LSQEDKDAIEKACEELEQASK-----D--
DNAK_XANAC       ELVQARNQADGLIHATRTAITEHG----SK-VGGDVIGKVEAALSDLETAMK-----G--
DNAK_XANC5       ELVQARNQADGLIHATRTAITEHG----SK-VGGDVIGKVEAALSDLETAMK-----G--
DNAK_XANCP       ELVQTRNQADGLIHATRTAITEHG----SK-VGGDVIGKVEAALADLETAMK-----G--
DNAK_XANC8       ELVQTRNQADGLIHATRTAITEHG----SK-VGGDVIGKVEAALADLETAMK-----G--
DNAK_XANOR       ELVQARNQADGLIHATRTAITEHG----SK-VGGDVIGKVEAALSDLETAVK-----G--
DNAK_XYLFA       ELVQARNHADGLIHSTRSAIKEHG----SK-VGGEVIGRVEASLAELEAAVK-----G--
DNAK_XYLFT       ELVQARNHADGLIHSTRSAIKEHG----SK-VGGELIGRVEASLAELEAAVK-----G--
DNAK_PSEPK       ELAAARNQGDALVHSTRKMVADAG----DK-VTAEEKTAIEAAVVALEAAVK-----G--
DNAK_PSEPF       ELAAARNQGDALVHSTRKMIADAG----DK-VTAEEKTAIEAAVVALEAAVK-----G--
DNAK_PSE14       ELASARNQGDALVHSTRKMIADAG----DK-VTAEEKTAVEAALVALEAAIK-----G--
DNAK_PSEU2       ELASARNQGDALVHSTRKMIADAG----DK-VTAEEKTAVEAALVALEAAIK-----G--
DNAK_PSESM       ELASARNQGDALVHSTRKMIADAG----DK-VTAEEKTAVEAALVALEAAIK-----G--
DNAK_PSEF5       ELATARNQGDALVHSTRKMVADAG----DK-VTAEEKTAIEAAVVALEAAVK-----G--
DNAK_PSEAE       ELAAARNQGDALVHATRKMITEAG----DK-ATAEDKATIEKALGELEAAVK-----G--
DNAK_ACIAD       ELAKARNEADALVSSSNKAVKDLG----DK-VTEDEKTAITTAVSELEAATK-----E--
DNAK_PSYA2       NLAQVRNEADGRIHAVQKALKDAA----DK-VSDDEKSSVETAISELEAAAK-----E--
DNAK_FRATT       DLVTARNTADNLIHSSRKAIQELG----DK-VTAAEKEKIEEACKELEAATK-----G--
DNAK_LEGPH       EMAELRNQADSLIHSCEKSMKDLA----DE-LSEDEKRGIETAISELKEAVQ-----G--
DNAK_LEGPL       EMAELRNQADSLIHSCEKSMKDLA----DE-LSEDEKKGIETAISELKEAVQ-----G--
DNAK_LEGPA       EMAELRNQADSLIHSCEKSMKDLA----DE-LSEDEKKGIETAISELKEAVQ-----G--
DNAK_COXBU       ELVDARNQADAMIHAAEKSVKDLG----SE-VSADEKSAIEKAVNELKEAMK-----G--
DNAK_METCA       ELVSARNHADAVVHATNKTLAELG----DK-VSGEERAKIEAALNDLKDAMG-----G--
DNAK_NITOC       ELVDLRNQGDNLIHATEKSMEELG----DK-LEANEKSEIEKTIGELKTAMK-----E--
DNAK1_COLP3      ELVDQRNQADQLIHTVQTSMTSLA----QD-QQ----TELKTLIEQLKMAVN-----G--
DNAK_DESAG       ELIEARNQADSLIYTTEKSLSDLG----DK-LEADLKKEIEDKTAALKTAME-----G--
DNAK_DESVH       ELIEARNQADGLIYGTEKSIRDLG----DK-LDAALKADIETKVTALRGLLE-----S--
DNAK_GEOSL       ELVEARNHADTLSYSTEKSLKEYG----DK-IGADEKAKIEECLANLRKAME-----G--
DNAK_PELCD       EIIEARNQADGLAYSTEKSLKEHG----DK-IDEETRNNIQTALDALKAAME-----G--
DNAK_DESPS       ELVEARNSADGLIHSTEKTLKDLG----DK-VDAETKENVEKEIANVKTALE-----G--
DNAK_CAMJE       EAVDARNAADSLAHQVEKSLSELG----EK-VAAADKENIQKALDDLRETLKNQ---N--
DNAK_CAMJR       EAVDARNAADSLAHQVEKSLSELG----EK-VAAADKENIQKALDDLRETLKNQ---N--
DNAK_HELHP       AIIELRNNADSLVYQTKKSLEEFK----DK-IESAEVEKIQSAVAALEETLKNE---N--
DNAK_WOLSU       SMIEAKNQADSLLYQTEKSLGEFK----DQ-LEESERTKIESAINDLKETLKKE---N--
DNAK_HELPY       EVIEARNHADSLAHQTQKSLDEHK----TN-LNENDANEIQNAINALKDCVKND---N--
DNAK_HELPJ       EVIEARNHADSLAHQTQKSLDEHK----TN-LNENDANEIQNAINALKDCIKND---N--
DNAK_FUSNN       ELVEARNKADQLISATEKTLKENP----DK-VSEEDKKNIEAAIEELKKVKD-----G--
DNAK_RHOBA       ELVEARNKVNQQVYQLEKLMGEND----DK-LSDDDKAPMNAAIEKVKKAAE-----G--
DNAK_BACFN       EKIDKLNQADSLIFQTETQLKELG----DK-LPADKKAPIEAALQKLKDAHK-AQ--D--
DNAK_BACFR       EKIDKLNQADSLIFQTETQLKELG----DK-LPADKKAPIEAALQKLKDAHK-AQ--D--
DNAK_BACTN       EKIDKLNQADSVIFQTENQLKELG----DK-LPADKKAPIEAALQKLKDAHK-SQ--D--
DNAK_PORGI       ERIDKINQADSMIFQTEKQLKELG----DK-FPADKKAPIDTALDKLKEAHK-AQ--D--
DNAK_CHLTE       EEIELKNSADSLIFSTEKQLTELG----DK-LPADKKAAIESALEKLKEAHK-SG--R--
DNAK_CHLCH       EEIDIKNSADALIFSTEKQLTELG----EK-IPTDKKSALEGSLDKLRDAYK-NG--T--
DNAK_BORBU       ENIEAKNTANSLIYQTEKSLKEYS----EK-ISSEDKEAIESKIKELKESLE-KE--D--
DNAK_BORBP       ENIEAKNTANSLIYQTEKSLKEYS----EK-ISSEDKEAIENKIKELKESLD-KE--D--
DNAK_TREPA       EKIEARNVADSLIYQTEKTLKEAG----DG-VNAADRARIDEAIAELKTVLS-GD--D--
DNAK_TREDE       EKVEAKNNADSLIYQTEKTLKEMG----DK-IGAADKQKIEAAIADLRQALN-SD--N--
DNAK_LEPIC       EVIEAKNELDTLTYSLEKTVNEAG----DK-IGANEKQLATDEIKRAREAIE-SN--D--
DNAK_LEPIN       EVIEAKNELDTLTYSLEKTVNEAG----DK-IGANEKQLATDEIKRAREAIE-SN--D--
DNAK_BDEBA       EAATQRNNLDNLVYQTEKLIKDSG----AQ-LPESEVKSANEAVAEAKKILE-NK--S--
DNAK_CHLAB       EASDVRNEADSMIFRAEKAISDYK----EN-IPESLTKEIEERIEKVRSALK-ED--A--
DNAK_CHLCV       EASDARNEADSMIFRAEKAISDYK----DN-IPESLVKEIEERIEKVRTVLK-EE--A--
DNAK_CHLPN       EASDAKNEADSMIFRAEKAIKDYK----EQ-IPETLVKEIEERIENVRNALK-DD--A--
DNAK_CHLTR       EASDVKNEADGMIFRAEKAVKDYH----DK-IPAELVKEIEEHIEKVRQAIK-ED--A--
DNAK_CHLTA       EASDVKNEADGMIFRAEKAVKDYH----DK-IPAELVKEIEEHIEKVRQAIK-ED--A--
DNAK_CHLMU       EASDIKNEADGMIFRAEKAIKDYQ----DK-IPADLVKEIEEQIEKVRQAVK-ED--A--
DNAK_PARUW       EEVEIRNEADSLAFRAQKALDEYK----DK-VPQQIADDISNKIEAVKKAL--ET--T--
DNAK_DEHM1       EEIEARNVADNLAYNAEKTLRDNK----DK-IPAELNTELESKIAAVRTALQ-GT--D--
DNAK_DEHMC       EEIEARNVADNLAYNAEKTLRDNK----DK-IPAELNTELESKIAAVRTALQ-GN--D--
DNAK_CLOPE       EAIEVKNNAEQTVYQTEKTLNELG----DK-VSAEEKSEIEAKIEEVKKVKD-----G--
DNAK_CLOTE       ESVEVKNNAEQIFYQTEKTLNELG----DK-VSAEDKATIEEKLNALKGVKD-----G--
DNAK_CLOAB       ENIEVKNNADQIVFQTDKALKDLG----DK-VSAEDKSNIEAKKEALSKVKD-----G--
DNAK_METAC       EEVETRNNAEALINAAEKTIKEAG----DV-ATEDQKSKVNAAIEDLKKALE-----G--
DNAK_METMA       EEVEIRNNAEALINAAEKTIKEAG----DL-ATEDQKSKVNAAIEDLKKALE-----G--
DNAK_METBF       EDVETRNNAEALINAAEKTLKEAG----DA-ATEDQKSKVTAAIDDLKKALE-----G--
DNAK_CALS4       EEIEIRNRADSLIYQAEKTMKDLG----DK-MTQAEKDEINKEIENVRKALE-----G--
DNAK_CARHZ       EEVETRNQADSLIYQAEKTLKDFK----DK-ANPDLVARVEKAIAELREAMN-----S--
DNAK_SYMTH       EEAEIRNNADAAVYNAEKLIKESE----GKGIDPSLIDAVKGAIEPVKEALK-----G--
DNAK_AQUAE       ELIEAKNQLDHLVYQLEKALKEAG-----DKVPADVKSEAEKVIEEAKKTIETA------
DNAK_THEMA       EEIELKNRADDLAYSVEKTLKEHG-----DKIPADLKSRLEDMIRELRDAINR-------
DNAK_THEAC       EQIELLNNAESLAYSVEKTLNDAG-----DKVDKETKERLTNEVKDLRKAIEE-------
DNAK_THEVO       EQIETLNNAESLAYSVEKTLNEAG-----DKVDKETKDRILSEVKDLRKAIEE-------
DNAK_PICTO       EEIETINNAETLAYTAEKTINDAG-----DKIDESSKESVRSIVKDLRDAISS-------
DNAK_METTH       EEIEIRNNADSMIYTAEKTLDELG-----DKVPAEKKEEVEKQVRELRELIAG-------
DNAK3_NOSS1      ELVELKNQADNLLIIYESTLKDNG-----DLIGEQIKVLANEKVAQIQSVM---TNPA--
DNAK1_THEEB      EIAELRNQADALLYSYESTIKNHG-----ITLSPELRARIEPVVQSMQAAM---VDDN--
DNAK3_SYNP6      QMIELRTQFENLRYSFESTLQNNR-----ELLTAEQQEPLEASLNALASGLE-SVSNE--
DNAK1_NOSS1      ERVEKRTRSEALILQGERQLREVALEFGMQ-FARNRRQRIDNISRELKESLKENDDRG--
DNAK3_SYNY3      ERIEKRNSAKALTDQAQRRLKEVTLDFGSA-FTVSYRRQVDALCSEILDSLEKDDERR--
DNAK3_THEEB      ARIEKRNRSQDLINRAERQLREAAQEFGYQ-FAAEQRRGIEALVRQLQEAIRNEDDRQ--
DNAK1_SYNP6      ARIEKRNRAQTLIAQSERRLREISLDFGLY-FAESKRRRIESTIRELKDYLERQDDRG--
DNAK1_PROMM      ASIDRRNSALTLVGQAERRLRDAALELGPY-GAERQQRAVETAMRDVQDLLEQNDLQE--
DNAK1_SYNPX      NQIERRNRAQTLVAQAERRLRDAALELGPY-GAERQQRAVEMAMRDVQDCLAQDDLQE--
DNAK1_PROMA      ASIDQRNNALTLVAQAERRLRDVSLEFGPY-GAERQQRAVEVSLRDVQDFLDSDDLAE--
DNAK1_PROMP      SVIDRKNNALTLIAQAERRLRDASLEFGPY-GAERQQRAVELAIQDVEEFIDDDDPQE--
DNAK_THET8       EHAELKNALDSARVQAERVLQERQG-------APEARARLEAAIGKAKELVERDAP----
DNAK_THET2       EHAELKNALDSARVQAERVLQERQG-------APEARARLEAAIGKAKELVERDAP----
DNAK_DEIRA       EKVEKRNNLDSLRVQAVQQLEEQEGA------AQDAKDRLKAAADEAEEAVRSEDDSK--
DNAK2_NOSS1      EKIERKNQADSLAYQAEKQLQELGDKVP-----EADKTKVEGLVKDLREAVAKEDDEQ--
DNAK2_SYNY3      EKIDRKNQADSLVYQAEKQITELGDKVP-----AADKIKAEGLIKDLKEAVAQEDDAK--
DNAK2_THEEB      EKIETKNQAEQLCYQAEKQLNELGDKVS-----TSDKDRLTSLIANLRSEIGTEAEKKPI
DNAK2_PROMA      DRIDIKNQAETLVYQTEKQLGELGDKVD-----EEAKAKVEAKRIQLKEATEKDDYET--
DNAK_PROMT       EKIDIKNQAETLVYQAEKQIGELGDKVD-----EAAKAKVEEKRIKLKEATEKDDYES--
DNAK2_PROMP      EKIDLKNQAETLVYQTEKQLGELGDKVD-----ASAKAKVEEKSKALKEATSKEDYEA--
DNAK2_PROMM      ERIDIKNQAETLVYQAEKQLGELADKVD-----ADSKAKVEDKRVKLKAAIEKDDFDA--
DNAK2_SYNPX      EKIDLKNQAETLVYQAEKQMGELGDKVE-----ADAKAKVDEKRTKLQEAINAEDYDA--
DNAK2_SYNP6      ERIDLKNQADTLVYQSEKQLSELGDKIS-----ADEKSKVEGFIQELKDALAAEDYDK--
DNAK_GLOVI       EAVDLKNEADSLAYQAERQLTEFGDKVD-----SSDKSKIEGLIKDLREALSREDMDK--
DNAK2_STRAW      EAVDARNELDAVAYQVEKRLAELGDAAP-----AHEKARAEMLVSDARAAVKEEAGVE--
                                                                             

DNAK_MYCH7       ---KTDELKLKLDQIEAAAQSFAQATAQ-------------QANTSE---------SDPK
DNAK_MYCHJ       ---KTDELKLKLDQIEAAAQSFAQATAQ-------------QANTSE---------SDPK
DNAK_MYCPU       ---KIEELKVKLEQIEQAAQAFAQYSAQ-------------QAATEN---------SK--
DNAK_MYCMO       ---KIDELKIKLDQIEEVAKAFAQKAAS-------------KETSKN---------EQ--
DNAK_MYCS5       ---DIPTLKAKLEEVENMMKNFANFAQQ-------------ANATKD---------QS--
DNAK_MYCHO       ---DIEQLEKKITEFEQKMAQAAEFLKK-------------QQGNNN---------PN--
DNAK_UREPA       ---DYVKLEAEVKKVEDLLTNAAKFAQQ-------------AQQQNP---------DNQN
DNAK_MYCGE       ---DYAKLKVEIENFKKWREEMAKKYNP-------------TGEQGP---------QA--
DNAK_MYCPN       ---DYTKLKAEIENFKKWREEMAKKYNP-------------NGDQGQ---------PA--
DNAK_MYCGA       ---KWDELKEQIDGFKKWRDDMSKKYG--------------GGEAPA---------EP--
DNAK_MYCPE       ---KWDELKTKINQFEAMASQFAQAAKQ-------------NEEKKE---------ED--
DNAK_MESFL       ---DYEALETKVNELEQMIQMASQFAQA-------------QTAQPE---------EG--
DNAK_MYCMS       ---NYEALEQKMAELEQAMAQAAEFANK-------------QNE-SD---------PN--
DNAK_BACAN       ---ELEEIRAKKDALQEIVQQLTVKLYE-------------QAQAAA---------GQAE
DNAK_BACCZ       ---ELEEIRAKKDALQEIVQQLTVKLYE-------------QAQAAA---------GQAE
DNAK_BACHK       ---ELEEIRAKKDALQEIVQQLTVKLYE-------------QAQAAA---------GQAE
DNAK_BACCR       ---ELEEIRAKKDALQEIVQQLTVKLYE-------------QAQAAA---------GQAE
DNAK_BACC1       ---ELEEIRAKKDALQEIVQQLTVKLYE-------------QAQAAA---------GQAE
DNAK_BACSU       ---EFEEIKAKKDELQTIVQELSMKLYE-------------EAAKAQ---------QAQ-
DNAK_BACLD       ---DLDEIKAKKDELQAIVQELSMKLYE-------------EAAKQA---------QAQQ
DNAK_GEOKA       ---DIDDIRKKKDALQEAVQQLSIKLYE-------------QAAKQA---------QSAG
DNAK_OCEIH       ---DMEQVKAKKDALEEHVQQLSAKLYE-------------QVQQEA---------QQAS
DNAK_BACHD       ---NIDEIRTAKEELQQVVQALTTKLYE-------------QAAQQA---------QQAQ
DNAK_BACSK       ---NTDDIKAAKDELQEIVTALTTKLYE-------------QAAQAA---------QAQQ
DNAK_STRA3       ---NLDDMKAKLEALNEKAQALAVKLYE-------------QAAAAQ---------QAAQ
DNAK_STRA5       ---NLDDMKAKLEALNEKAQALAVKLYE-------------QAAAAQ---------QAAQ
DNAK_STRA1       ---NLDDMKAKLEALNEKAQALAVKLYE-------------QAAAAQ---------QAAQ
DNAK_STRP1       ---NLDDMKAKLEALNEKAQALAVKMYE-------------QAAAAQ---------QAAQ
DNAK_STRP6       ---NLDDMKAKLEALNEKAQALAVKMYE-------------QAAAAQ---------QAAQ
DNAK_STRP8       ---NLDDMKAKLEALNEKAQALAVKMYE-------------QAAAAQ---------QAAQ
DNAK_STRPM       ---NLDDMKAKLEALNEKAQALAVKMYE-------------QAVAAQ---------QAAQ
DNAK_STRP3       ---NLDDMKAKLEALNEKAQALAVKMYE-------------QAAAAQ---------QAAQ
DNAK_STRMU       ---NLDDMKAKLEALNEKAQALAMKLYE-------------QAAAAQ---------QAQA
DNAK_STRPN       ---NLDDMKTKLEALNEKAQGLAVKLYE-------------QAAAAQ---------QAQE
DNAK_STRR6       ---NLDDMKAKLEALNEKAQGLAVKLYE-------------QAAAAQ---------QAQE
DNAK_STRT1       ---NLDDMKAKLEALNEKAQALAVKLYE-------------QAAAAQ---------QAQA
DNAK_STRT2       ---NLDDMKAKLEALNEKAQALAVKLYE-------------QAAAAQ---------QAQA
DNAK_LACLA       ---DIDDIKAKSEALSEIAQNLAVKLYE-------------QANAAQ---------GEAG
DNAK_ENTFA       ---DIEQMKAKRDSLNEIVQNLTVKLYE-------------QA-AQQ---------QAQE
DNAK_LISMF       ---DFEAIKEKTESLNEIVQNLSVKLYE-------------QAAAEQ---------QAAG
DNAK_LISMO       ---DFDAIKEKTESLNEIVQNLSVKLYE-------------QAAAEQ---------QAAG
DNAK_LISIN       ---NFDAIKEKTDSLNEIVQNLSVKLYE-------------QAAAEQ---------QAAG
DNAK_STAAC       ---DIEDIKSKKEELEKVIQELSAKVYE-------------QAAQQQ---------QQAQ
DNAK_STAAM       ---DIEDIKSKKEELEKVIQELSAKVYE-------------QAAQQQ---------QQAQ
DNAK_STAAN       ---DIEDIKSKKEELEKVIQELSAKVYE-------------QAAQQQ---------QQAQ
DNAK_STAAR       ---DIEDIKSKKEELEKVIQELSAKVYE-------------QAAQQQ---------QQAQ
DNAK_STAAS       ---DIEDIKSKKEELEKVIQELSAKVYE-------------QAAQQQ---------QQAQ
DNAK_STAAW       ---DIEDIKSKKEELEKVIQELSAKVYE-------------QAAQQQ---------QQAQ
DNAK_STAES       ---DIDDIKAKKEELEKVIQELSAKVYE-------------QAQQAQ---------QQAQ
DNAK_STAEQ       ---DIDDIKAKKEELEKVIQELSAKVYE-------------QAQQAQ---------QQGQ
DNAK_STAHJ       ---DIEDIKAKKEELEKVIQDLSAKVYQ-------------QAQQAQ---------QQAQ
DNAK_STAS1       ---DIDDIKAKKEDLEKVVQDLSTKVYE-------------QAAQAQ---------QQAQ
DNAK_LACAC       ---NLDEMKEKKDALSKAAQDLAVKLYQ-------------QNGGAQ---------GAAG
DNAK_LACJO       ---NLDEMKEKKEALSKAAQDLAVKLYQ-------------QNGGAQ---------GAAG
DNAK_LACSK       ---NLEDMKTKRDALSEIVQELTVKLYQ-------------QAQEAQ---------QAAG
DNAK_LACSS       ---NLEDMKTKRDALSEIVQELTVKLYQ-------------QAQEAQ---------QAAG
DNAK_LACPL       ---NIDEMKAKKDDLNKIVQDLSVKLYQ-------------QAQEAQ---------GAQG
DNAK_ONYPE       ---DTALIKEKTASLTKESQGIAMKAYQ-------------KAQEKQ---------AQEK
DNAK_TROWT       ---DHDLIKAGTDKLLASQQKFAQSVYE-------------TTK----------------
DNAK_TROW8       ---DHDLIKAGTDKLLASQQKFAQSVYE-------------TTK----------------
DNAK_LEIXX       ---DDEAVKTAYDKLNESQQKLGQAIYS-------------AAQAA----------EAPA
DNAK_BIFLO       ---DTEKVKTAQTELMTAAQKIGQVLYA-------------QQGAE----------GAAA
DNAK_COREF       ---DIDAIKTAVDKLNTESQEMGRAIYE-------------AEAAA----------GATQ
DNAK_CORGL       ---DLEAIKAAVEKLNTESQEMGKAIYE-------------ADAAA----------GATQ
DNAK_CORDI       ---DIEAIKTAVEKLSTESQEMGKAIYE-------------AEAA--------------N
DNAK_CORJK       ---DIEAIKDAVEKLNAESQEMGKAIYE-------------AEAAA----------GAEG
DNAK_MYCLE       ---DISAIKSAMEKLGQDSQALGQAIYE-------------ATQAA----------SKVG
DNAK_MYCPA       ---DITAIKSAMEKLGQESQALGQAIYE-------------ATQAE----------SAQA
DNAK_MYCTU       ---DISAIKSAMEKLGQESQALGQAIYE-------------AAQAA----------SQAT
DNAK_MYCBO       ---DISAIKSAMEKLGQESQALGQAIYE-------------AAQAA----------SQAT
DNAK_NOCFA       ---DIAAVKAAVEKLATESQALGQAIYE-------------AQGAD----------AAAS
DNAK1_STRAW      --DNTAEIRTATEKVAAVSQKLGQAMYA-------------DAQAA----------QAAG
DNAK_STRCO       ---DTAEIRTATEKVAAVSQKLGQAMYA-------------DAQAA----------QAAG
DNAK_THEFY       ---DIEAIRSASEKVALASQKIGSAIYS-------------QSQQ---------------
DNAK_CUTAK       ---NDDEVKAAMDDLNQKASAMGQAIYA-------------AAQQA----------QAEN
DNAK_HALMA       ---TKEDYEAVTETLSEELQEIGKQMYQ-------------DQAQQ--------AAGGAA
DNAK_NATPD       ---DTDELTEATEALAEALQEIGKQMYQ-------------QQAGEGGAGAGAGAAGGMG
DNAK_HALSA       ---EIDALETATEELSDTLQEIGKQAYQ-------------QQQDA--------QAGAAG
DNAK_AGRFC       --PDADDIQAKTQTLMEVSMKLGQAIYE-------------AQQA----------EAG--
DNAK_RHIME       --PDAEDIKAKTNTLMEVSMKLGQAIYE-------------AQQT----------DAAHA
DNAK_RHILO       ---DAADIEAKSQALAEASMKLGQAMYE-------------ASQK----------EAAEA
DNAK_BRUME       ---DAEDIKAKTQALAEVSMKLGQAMYE-------------AAQA----------AEGAG
DNAK_BRUAB       ---DAEDIKAKTQALAEVSMKLGQAMYE-------------AAQA----------AEGAG
DNAK_BRUSU       ---DAEDIKAKTQALAEVSMKLGQAMYE-------------AAQA----------AEGAG
DNAK_BARHE       ---DTEEVKAKMQKLAEVSMKLGQAMYE-------------ASQA----------ATPNT
DNAK_BARQU       ---DPEEVTAKMQKLAEVSMKLGQAMYE-------------ASQA----------ATANT
DNAK_BRADU       ---DAEAIKAKTQTLAQASMKLGEAMYK-------------QQAE----------ADAKK
DNAK_NITWN       ---DAEAIKAKTNTLAQASMKLGEAMYK-------------QQAE----------ADAAK
DNAK_RHOPA       ---DAEAIKAKSNTLAQASMKLGEAMYK-------------QAEA----------AGGAQ
DNAK_CAUVC       ---DVEAIQAKTQALIQASMKLGEAMYA-------------AQQG----------SAEGG
DNAK_ZYMMO       ---DVAQINEKTQALGQVAMKLGQALYE-------------QDQA----------NNERH
DNAK_RHOS4       ---DAGKIKGGIQNLTEAAMRLGEAIYK-------------ASQA----------EGGAT
DNAK_RUEPO       --VSAEKIKSGLQNVTEAAMKLGEAIYK-------------AQSE----------GGDDE
DNAK_RICFE       ---DASLIKEKTNNLTAANMKIGETMYK-------------AQTE----------NQHSE
DNAK_RICTY       ---DASLIKEKTNNLTAANMKIGETMYK-------------AQTE----------NQHSE
DNAK_RICPR       ---DASLIKEKTGNLTAANMKIGEAMYK-------------TQTE----------NQHSE
DNAK_RICCN       ---DTALIKEKTESLTAASMKIGEAMYK-------------AQSE----------SQPAA
DNAK_PELUB       ---DTEEIKKKTETLVQASMKLGEAIYK-------------SQEKK---------EGSPK
DNAK_EHRRG       --EDTDTMQNKLDHLMKVSMKLGEALYS-------------NTNNA---------TAGDN
DNAK_EHRRW       --EDTDTMQNKLDHLMKVSMKLGEALYS-------------NTNNA---------TAGDN
DNAK_EHRCJ       --ESVDILQQKVDHLMKVSMKLGEALYG-------------NANNT---------SSTES
DNAK_ANAMM       --SSSDVIQQKYDALMQLSMKLGEAAYS-------------AQKDS---------GTSTD
DNAK_WOLPM       --DDADSIQQKVTNLSQLSMKLGEAMYQ-------------TSQQN---------SAENG
DNAK_WOLTR       --DDVDSIQQKITNLSQLSMKLGETIYK-------------ESQQQ---------QGKES
DNAK_BORBR       --GDKAEIDAKVEALSTASQKLGEKMY-------------ADMQAQ---------QQAQQ
DNAK_BORPE       --GDKAEIDAKVEALSTASQKLGEKMY-------------ADMQAQ---------QQAQQ
DNAK_BORPA       --GDKAEIDAKVEALSTASQKLGEKMY-------------ADMQAQ---------QQAQQ
DNAK_BURPS       --SDKAAIDAKVEAVATASQKLGEKMY-------------ADMQAQ---------QAGAA
DNAK_BURMA       --SDKAAIDAKVEAVATASQKLGEKMY-------------ADMQAQ---------QAGAA
DNAK_BURP1       --SDKAAIDAKVEAVATASQKLGEKMY-------------ADMQAQ---------QAGAA
DNAK_BURL3       --ADKAAIDAKVEELGKVSQKLGEKMY-------------ADMQAQ---------QAGAA
DNAK_RALSO       --SDKAAIDAKVEALATASQKLGEKVY-------------ADMQAK----------GGAE
DNAK_CUPPJ       --GDKAEIDAKVTALSEVSQKLGEKVY-------------ADMQAK----------AGEQ
DNAK_AROAE       --NDKDTIEARMQALATASQKLGEQMY-------------AQSQGA---------EGGAT
DNAK_THIDA       --GDKETIETKTNALATASHKLAEQMY-------------QAEQ--------------AK
DNAK_DECAR       --GDKETITAKTEALSAAAQKLGEKMY-------------AQQQAE-----------GAA
DNAK_NITEU       --GDKQTIDAKTQALTEASHKLAEKMY-------------AQEQAQ----------AGQQ
DNAK_NEIMA       --DDKTAIDAKAEALGTASQKLGEMVY-------------AQAQAE---------AQAGE
DNAK_NEIG1       --DDKTAIDAKAEALGTASQKLGEMVY-------------AQAQAE---------AQAGE
DNAK_NEIMB       --DDKAAIDAKTEALGAASQKLGEMVY-------------AQAQAE---------AQAGE
DNAK_CHRVO       --DDKEAIEAKAEELAKASQKLGEIMY-------------AQAQAE---------AGAQG
DNAK_BUCAI       --EDKSDIEKNIQNLLKISSKLTEINQ-------------KKSEKD---------QK-DN
DNAK_BUCAP       --ENKSEIEKNIQNLLNISSKLTEINQ-------------KKSEEN---------LKKED
DNAK_BUCBP       --ENKTKIEEKIQEVLKISTKLIEKNK-------------PKQTSE---------SSNSN
DNAK_BLOFL       --ENKGDIESKVQELIKVSGKLLEASS-------------QKYKEK---------VNDSK
DNAK_BLOPB       --EDKNEIESKIQSLIKVSGKLLEAS--------------QKHQEQ---------SKSQS
DNAK_WIGBR       --EDKKDIEIKIQSLIQISSCLVDFS--------------KNKENL---------NKEDI
DNAK_ECOLI       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QTAGA
DNAK_ECOL6       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QTAGA
DNAK_ECO57       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QTAGA
DNAK_SHIBS       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QTAGA
DNAK_SHIDS       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QTAGA
DNAK_SHISS       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QTAGA
DNAK_SHIFL       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QTAGA
DNAK_SALTI       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QAGSA
DNAK_SALPA       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QAGSA
DNAK_SALTY       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QAGSA
DNAK_SALCH       --EDKAAIEAKMQELAQVSQKLMEIAQ-------------QQHAQQ---------QAGSA
DNAK_YERPE       --EDKAEIEAKTQALVQVSGKLLEMAQ-------------QQQAAA---------GGDAG
DNAK_YERPS       --EDKAEIEAKTQALVQVSGKLLEMAQ-------------QQQAAA---------GGDAG
DNAK_PHOLL       --EDKADIEAKIQALVQASAKLLEIAQ-------------QQAQAG---------ATADA
DNAK_PECAS       --EDKAEIEAKIQALVQVSGKLLEASQ-------------PQ-PGA---------EGAAD
DNAK_PASMU       --EDKAEIETKVQALIQVSEKLMQAAQ---------------PQPE---------AQAQQ
DNAK_MANSM       --EDKAEIEAKIQALIQVSEKLMQAAQ-------------QQAQAD---------AGAQQ
DNAK_HAEIN       --EDKAEIEAKIEAVIKASEPLMQAVQ-------------AKAQQA---------GGEQP
DNAK_HAEI8       --EDKAEIEAKIEAVIKASEPLMQAVQ-------------AKAQQA---------GGEQP
DNAK_HAEDU       --EDKAEIEAKIEAVIKASEPLMQAAQ-------------AKAQTN---------QAGE-
DNAK2_COLP3      --DDKEVIEAKTQALMEASAKLMEIAQ-------------AKEQ-A---------QSAPE
DNAK_PSEHT       --DKKDEIEAKTQALAEKSQKLMEIAQ-------------AKAQ-Q---------GSADA
DNAK_SHEON       --NDKEAIEKATQALIEASAKLMEIAQ-------------AKAQTQ---------GGAQE
DNAK_VIBVU       --EDKEAIEAKIQALMAAAQKLMEIAQ-------------QQAQAQ---------QGS--
DNAK_VIBVY       --EDKEAIEAKIQALMAAAQKLMEIAQ-------------QQAQAQ---------QGS--
DNAK_VIBPA       --EDKEAIDAKVQALMTAAQKLMEIAQ-------------QQAQAQ---------QAQG-
DNAK_VIBCH       --EDKAEIDAKVQALMAAAQKLMEIAQ-------------QQAQAQ---------GANA-
DNAK1_ALIF1      --DDKEAIDAKTQELMQAAQKLMEIAQ-------------QKAQAQ---------QGAQ-
DNAK2_ALIF1      --NDKEAIDAKTQELMQAAQKLMEIAQ-------------QKAQAQ---------QGAD-
DNAK1_PHOPR      --EDKEAIDAKVQALVAASQKLMEIAQ-------------QQAQAQ---------QAPGG
DNAK2_PHOPR      --EDKAAIDNATQALMTASQALVQMAQ-------------QQAQAQ---------HAQSS
DNAK_IDILO       --GDKEAIDAKSQALMEASQKLMEAAQ-------------QQQAQQ---------GAEGA
DNAK_XANAC       --DDKAQIEARTKTLEEAGQSLYAAAA-------------AAEQGG---------NADAA
DNAK_XANC5       --DDKAQIEARTKTLEEAGQSLYAAAA-------------AAEQGG---------NADAA
DNAK_XANCP       --DDKAQIEARSKTLEEAGQSLYAAAA-------------AAEQGG---------NADAA
DNAK_XANC8       --DDKAQIEARSKTLEEAGQSLYAAAA-------------AAEQGG---------NADAA
DNAK_XANOR       --DDKAQIEARTKTLEEAGQSLYAAAA-------------AAEQGG---------SADAA
DNAK_XYLFA       --DDKNQIEAKSKTLEEVAQSLHMAAT-------------AEQQSG------------ST
DNAK_XYLFT       --DDKNQIEAKSKTLEEVAQSLHMAAT-------------AEQQSG------------ST
DNAK_PSEPK       --DDKAAIDAKVEELSKVSAPVAQKMY--------------AEQS-----------AEQP
DNAK_PSEPF       --DDKAAIDAKVEELSKVSAPVAQKMY--------------AEQ------------AQPA
DNAK_PSE14       --DDKAAIEAKVEELSKVSAPIAQKMY--------------AEQ------------AENP
DNAK_PSEU2       --DDKAAIEAKVEELSKVSAPIAQKMY--------------AEQ------------AENP
DNAK_PSESM       --DDKAVIEAKVEELSKVSAPIAQKMY--------------AEQ------------AENP
DNAK_PSEF5       --DDKAAIDAKVEELSKVSAPVAQKMY--------------AEQ------------AQPA
DNAK_PSEAE       --DDKAEIEAKMNALSQASTPLAQKMY--------------AEQ------------AQQG
DNAK_ACIAD       --NDVEDIKAKTEALQNILMPITQRAYEQAQGAG------GAQGFD---------PNAFQ
DNAK_PSYA2       --DDHDDIKAKLEALDNAFLPVSQKIY--ADAGA------GSEGMD---------PNQFQ
DNAK_FRATT       --DDKQAIESKTKALEEAFAPIAQKAY--------------AEQAQ---------AAVAQ
DNAK_LEGPH       --TDKARIEDKLKVLTDASAKMAERIYAKK-------------SSE---------GQAAQ
DNAK_LEGPL       --TDKARIEDKLKVLTDASAKMAERIYAKK-------------SSE---------GQTAQ
DNAK_LEGPA       --TDKTRIEDKLKVLTDASAKMAERIYAKK-------------SSE---------GQAAQ
DNAK_COXBU       --NDKDAIEAKTKALTEHSSKLAERVYAKKGG--------AAGAPP---------GGEAE
DNAK_METCA       --DNKDLIEQRTSALTELSGKLAERLYTQQG------------------------GTAGS
DNAK_NITOC       --DNKEVIEARIKDLTDASAKMAERLYTQQ----------------------------AE
DNAK1_COLP3      --SDKAAIEMRQSALQEAYSKTMQTEQ-----------------AQ---------SQQAA
DNAK_DESAG       --SDVDAIKKATDELSQASHKLAEKLYA------------QQQAGA---------QGAAG
DNAK_DESVH       --EDVDAIKKASDELAQASHKLAEQLYK------------QQAQAG---------GPEAG
DNAK_GEOSL       --SDVEVLKKATDELTQASHKLAEAVYA------------KAQA-------------EGA
DNAK_PELCD       --DDPEDIRQKSEALATASHKLAEAVYK------------QTQ--------------EGA
DNAK_DESPS       --DDVEAIKAAIEALTAASHKLAELMYQ------------QASQ-------------ETP
DNAK_CAMJE       --ASKEEIESKMKALSEVSHKLAENMYK-------------KDEP-----------NTAN
DNAK_CAMJR       --ASKEEIESKMKALSEVSHKLAENMYK-------------KDEP-----------NTAN
DNAK_HELHP       --ASKEELEEKIKNLTEVSHKLAEAAYA-------------KEQ------------GGTQ
DNAK_WOLSU       --LTKEEIDEKVKALTEVSHKLAEAMYK-------------KENPQ---------AADAQ
DNAK_HELPY       --ATKAELEDKTKLLAQAAQKLGEAMAN-------------KNN--------------AE
DNAK_HELPJ       --ATKAELEDKTKALTQAAQKLGEAMAN-------------KNN--------------AE
DNAK_FUSNN       --DDKSAIDSAMEKLSQASHKFAEELYK-------------EVQAQ---------AQAQQ
DNAK_RHOBA       --DDLAEIKAASDELEAASQAFSKVLYE-------------KTDAA---------GEAGA
DNAK_BACFN       --MT--TIDSAMAELNTAFQAASAEMYAQSGA-----QGGAQAGPDMN-------AGQSN
DNAK_BACFR       --MT--TIDSAMAELNTAFQAASAEMYAQSGA-----QGGAQAGPDMN-------AGQSN
DNAK_BACTN       --LA--AIDTAMAEINTVFQTASAEMYAQGGA-----QGGAQAGPDMD-------AGQ-N
DNAK_PORGI       --VA--AIDTAMAELQTALSAAGEELYKNAGAA----QGGAQPGPDFG-------GAQGP
DNAK_CHLTE       --VD--AIKPAMDELSKVWSDAASNLY--GQP-------GAEPQP----------ETNGH
DNAK_CHLCH       --TE--SIKSAMDDLNSQWNSIASDLYQSGAG-------AAQAQP----------EAPQN
DNAK_BORBU       --I--SLIKSRTEELQKASYKIAEMMYKDS-----------SQQNA----------NSQQ
DNAK_BORBP       --I--SLIKSRTEELQKASYKIAEMMYKDS-----------SQQNA----------SNQQ
DNAK_TREPA       --V--ASIKAKTEILQQASYKIAEEMYKRQ-----------AAAGA----------AAGK
DNAK_TREDE       --T--ADIKAKTENLQQAAYKIAEEMYKQQGAQAGADPNAGSSQGA----------QAGT
DNAK_LEPIC       --K--ARIESAKASISKIATDIASKVYSQSAPGAEQAAAG-GPNGG----------AGSN
DNAK_LEPIN       --K--ARIESAKASISKIATDIASKVYSQSAPGAEQAAAG-GPNGS----------AGSN
DNAK_BDEBA       --ASGDELKGAFERLQNLTHKLTSELYKKQ-----------GAQPG----------AEGQ
DNAK_CHLAB       --PT-EKIKEASDELSRHMQKIGEAMQSQ----SASAAANAQDGPNINTEDL---KKHSF
DNAK_CHLCV       --PV-EKIKDASEELSRHMQKIGEAMQSQSASAAASSAANAQGGPNINTEDL---KKHSF
DNAK_CHLPN       --PI-EKIKEVTEDLSKHMQKIGESMQSQSASAAASSAANAKGGPNINTEDL---KKHSF
DNAK_CHLTR       --ST-TAIKAASDELSTHMQKIGEAMQAQSASAAASSAANAQGGPNINSEDL---KKHSF
DNAK_CHLTA       --ST-TAIKAASDELSTRMQKIGEAMQAQSASAAASSAANAQGGPNINSEDL---KKHSF
DNAK_CHLMU       --ST-TAIKAASDELSARMQKIGEAMQAQSAS-----AANAQGGPNINSEDL---KKHSF
DNAK_PARUW       --DI-ARIRSAKDELERQMQQIGEVMSKAAGQ-----SETQSTGPGSYQE------SSNQ
DNAK_DEHM1       --VD--AIKTTTQELSTALQSVGSAVYGQQQEQ------GAPAQ-------------EEP
DNAK_DEHMC       --VE--AIKKTTQELSTALQSVGSAVYGKQQE-------GAPAQ-------------EEP
DNAK_CLOPE       --DDIEAIKKAMEDLTQAFYKVSEKLYQ-------------QNGGAQGQGFD---PNNMG
DNAK_CLOTE       --EDIEAIKKATEDLTQAFYQISSKIYQ-------------DAGAPGAEGFD---SNMAG
DNAK_CLOAB       --DDIEAIKKATEDLTQALYAITTKMYE-------------QSGAQGAPGAD---PN---
DNAK_METAC       --KDTEEVKAKTEALQEAVYPISTAMYQ-------------KAQQEAQQAS----GE---
DNAK_METMA       --KDAEDIKAKTEALQESVYPISTAMYQ-------------KAQQAQQAAG----GE---
DNAK_METBF       --KDSEDIKSKTEALQEAVYPISTAMYQ-------------KAQQQAQQAQQ---AE---
DNAK_CALS4       --TDVEAIKAASEKLSEAFYKVSTRLYQ-------------QAAGSANPGG---------
DNAK_CARHZ       --KDVQLMRAKMEELTKPLYELTSSIYQ-------------QSANQ-NQTQ---------
DNAK_SYMTH       --TDVNAVKQATEKLTEAVYKLSSAIYE-------------KTGSAGTGAG---------
DNAK_AQUAE       --TEIEQVKQVTEKVLQVSSKMGTTLYGE-----------AGKQAG----------GGEK
DNAK_THEMA       --NDIPKVKMLFDDLQKESMKIGEYLY---------------KSAT----------GGET
DNAK_THEAC       --KNTENVKTLMDKLSKDIQEVGAKMYQQ-----------ASANTQ----------QSAQ
DNAK_THEVO       --KNMDNVKTLMEKISKDIQEVGTKMYQS-----------ASSTTQ----------TGS-
DNAK_PICTO       --KDINKIKELSEKLTKEIQEIGTKMYQS-----------QATQGT----------SQNS
DNAK_METTH       --DDIQAIKSKTEELTKTVQEIGVSYIPA-----------GSTATS----------STAA
DNAK3_NOSS1      --ISLKEFQQCLDDFQQTLFSIGANVYQRANTQ-----TDDELEVMSDGSSPSDIEHPIS
DNAK1_THEEB      --ITPDEIRKRMEALQQALVTLGSVVYQQT--------AGGSMMTSTPTMGRATMSSQAT
DNAK3_SYNP6      --AELNQLRQQLEALKQQLYAIGAAAYRQD---------GSVTTIPVQPTFADLIGDNDN
DNAK1_NOSS1      -------IDQAYADLQDALYELNREVRQYYAE---------DEDDDL--------FATIK
DNAK3_SYNY3      -------LDRAQADLQDVLYELNREVRLQYD----------DKEEGF--------FEAIK
DNAK3_THEEB      -------IDLTYAALEERLYDFIRQ--LRLRE---------EEAEDD--------EEVFK
DNAK1_SYNP6      -------LDLALAELQDALFDLNQETAARLRD---------EEGEGF--------FEPLK
DNAK1_PROMM      -------LELAVASLQEALFGLNRRISSERRT---------DANP----------LQGIR
DNAK1_SYNPX      -------LDLCLSGLEEALFGLNRRLSAERQS---------DGRP----------LQGLR
DNAK1_PROMA      -------LDLAVSSLQEALFGLNRRISAEKRT---------DNNP----------IQGIK
DNAK1_PROMP      -------LEISVSSLQEALFGLNRRFAAEKKV---------DSNP----------LQGIK
DNAK_THET8       ---------------DPELKAATEELLKAVEE---------YEKGAQ--------AASGK
DNAK_THET2       ---------------DPELKAATEELLKAVEE---------YEKGAQ--------AASGK
DNAK_DEIRA       -------IADAQKKLEEELRSFMTANQASTQG---------QPEGTQ--------AQANK
DNAK2_NOSS1      -------IKKLTPELQQALFAVGSNIYQQAGG---------GA-------------APGA
DNAK2_SYNY3      -------IQTVMPELQQVLYSIGSNMYQQAGA---------EAG-V---------GAPGA
DNAK2_THEEB      DAIDFGRVKSLMQDLQQALYSVGSSVYQSAQS---------SD-------------GTGS
DNAK2_PROMA      -------MKTLVEDLQKELYSLGASVYQQSNA---------AS-------------QAAD
DNAK_PROMT       -------MKTLVEELQQELYSLGASVYQQAND---------AS-------------QAAA
DNAK2_PROMP      -------MKKLLEELQQELYAIGSSVYQQPGN---------QP-------------PAPG
DNAK2_PROMM      -------MKSLLEELQQELYTVGASVYQQAGA---------AA--A---------ESGAD
DNAK2_SYNPX      -------MKTLLEELQQELYTVGASVYQQEGA---------AAGGA---------APGGD
DNAK2_SYNP6      -------IRSIIEQLQQALYAAGSSVYQQASA---------EA------------SANAQ
DNAK_GLOVI       -------VASLKADLQQAVYDLSSKLYQQSAP---------SGAAAG--------PDEGA
DNAK2_STRAW      ------RVRPLTSELQQVLAGLAAHQGAATAD---------GG-------------PAQH
                                                                             

DNAK_MYCH7       A--------------------------------------DDSNTIDAEIKQD--------
DNAK_MYCHJ       A--------------------------------------DDSNTIDAEIKQD--------
DNAK_MYCPU       ----------------------------------------DSDTVEAEIVDDKAN-----
DNAK_MYCMO       ---------------------------------------NEDGSIDAEIKEEDPKA----
DNAK_MYCS5       ---------------------------------------SKDQEEVATVVEE--------
DNAK_MYCHO       ---------------------------------------TNNDNPQTN------------
DNAK_UREPA       N--------------------------------------NKDDVTEATVTDDSTKK----
DNAK_MYCGE       ----------------------------------------K-------------------
DNAK_MYCPN       ----------------------------------------Q-------------------
DNAK_MYCGA       ----------------------------------------K-------------------
DNAK_MYCPE       ----------------------------------------KKDSEESKN-----------
DNAK_MESFL       ----------------------------------------NSDSEENK------------
DNAK_MYCMS       ----------------------------------------NNSSEQNN------------
DNAK_BACAN       GAE---------------------GAQDAGAK-----KDNVVDAEFEEVKEDK-------
DNAK_BACCZ       GAE---------------------GAQDAGAK-----KDNVVDAEFEEVKEDK-------
DNAK_BACHK       GAE---------------------GAQDAGAK-----KDNVVDAEFEEVKEDK-------
DNAK_BACCR       GAQ---------------------GAQDAGAK-----KDNVVDAEFEEVKEDK-------
DNAK_BACC1       GAQ---------------------GAQDAGAK-----KDNVVDAEFEEVKEDK-------
DNAK_BACSU       --G---------------------GANAEGKA-----DDNVVDAEYEEVNDDQNKK----
DNAK_BACLD       --D---------------------GGAGAKKA-----DDNVVDAEYEEVNDDKDQK----
DNAK_GEOKA       ------------------------SQGGAANH-----KDNVVDAEFEEVNDDK-------
DNAK_OCEIH       G-E---------------------QGEESGNQ-----DDDVVDADYSEVDDDDKK-----
DNAK_BACHD       SAE---------------------GDQGTAEKGQ---DDNVVDADYEEVNEEDKK-----
DNAK_BACSK       --D---------------------GGNESADK-Q---DDNVVDADYEEVNDDDKK-----
DNAK_STRA3       GAE---------------------GAQSADSSSKG---DDVVDGEFTEK-----------
DNAK_STRA5       GAE---------------------GAQSADSSSKG---DDVVDGEFTEK-----------
DNAK_STRA1       GAE---------------------GAQSADSSSKG---DDVVDGEFTEK-----------
DNAK_STRP1       GAE---------------------GAQANDSANN----DDVVDGEFTEK-----------
DNAK_STRP6       GAE---------------------GAQANDSANN----DDVVDGEFTEK-----------
DNAK_STRP8       GAE---------------------GAQANDSANN----DDVVDGEFTEK-----------
DNAK_STRPM       GAE---------------------GAQANDSANN----DDVVDGEFTEK-----------
DNAK_STRP3       GTE---------------------GAQANDSANN----DDVVDGEFTEK-----------
DNAK_STRMU       GQE---------------------GAQSSDSDSSDKGGDDVVDGEFTEK-----------
DNAK_STRPN       GAE---------------------GAQATGNAGD-----DVVDGEFTEK-----------
DNAK_STRR6       GAE---------------------GAQATGNAGD-----DVVDGEFTEK-----------
DNAK_STRT1       GAE---------------------GAQATDNSGD-----DVVDGEFTEK-----------
DNAK_STRT2       GAE---------------------GAQATDNSGD-----DVVDGEFTEK-----------
DNAK_LACLA       QAT---------------------DAQEAPKDDN------TFDGDFEESK----------
DNAK_ENTFA       NPE---------------------AAQGGA--------DDVVDADFEEVNGDDK------
DNAK_LISMF       GAE---------------------GQEAPQND-------DVVDAEFEEVNDDDKENK---
DNAK_LISMO       GAE---------------------GQEAPQND-------DVVDAEFEEVNDDDKENK---
DNAK_LISIN       GAE---------------------GQEAPQND-------DVVDAEFEEVNDDDKENK---
DNAK_STAAC       GAN---------------------AGQNNDST--------VEDAEFKEVKDDDKK-----
DNAK_STAAM       GAN---------------------AGQNNDST--------VEDAEFKEVKDDDKK-----
DNAK_STAAN       GAN---------------------AGQNNDST--------VEDAEFKEVKDDDKK-----
DNAK_STAAR       GAN---------------------AGQNNDST--------VEDAEFKEVKDDDKK-----
DNAK_STAAS       GAN---------------------AGQNNDST--------VEDAEFKEVKDDDKK-----
DNAK_STAAW       GAN---------------------AGQNNDST--------VEDAEFKEVKDDDKK-----
DNAK_STAES       E-----------------------EQGSQDST--------VEDADFKEVKDDEDKK----
DNAK_STAEQ       E-----------------------EQGSQDST--------VEDADFKEVKDDEDKK----
DNAK_STAHJ       DGA---------------------QQTQNDSN--------VEDAEFKEVNDDEDKK----
DNAK_STAS1       GED---------------------ANASQDSN--------VEDADFKEVKDDDNQDNQK-
DNAK_LACAC       QAGPQG------------------GNPND------GNNGGAQDGEFHKVDPNK-------
DNAK_LACJO       QAGPQG--------------PQNGGQPNNDNGSDNGQGGSTVDGDFHKVDPDK-------
DNAK_LACSK       GAE---------------------GNATDAK-----TDDGTVDGDFEEVKDDKE------
DNAK_LACSS       GAE---------------------GNATDAK-----TDDGTVDGDFEEVKDDKE------
DNAK_LACPL       GADSNA-----------------AGNANSAKG----SDDNTVDGDFEDLDKDKDKK----
DNAK_ONYPE       GTQ---------------------ENTTAKNEKP---QDEVVDADFEEKK----------
DNAK_TROWT       ----------------------------------DDPKEQVVDAEVVDEDSGSSK-----
DNAK_TROW8       ----------------------------------DDPKEQVVDAEVVDEDSGSSK-----
DNAK_LEIXX       AAAG----------------------EEASAPSSSTGEEDVIDAEVVEDEEKKQQ-----
DNAK_BIFLO       GADG----------------------AGASAGSASGSDDDTVEAEVVDDDDDKDNK----
DNAK_COREF       ADAG-------------------------AEGAA---DDNVVDAEVVDEDVSEEKKDGDK
DNAK_CORGL       ADAG-------------------------AEGAA---DDNVVDAEVVEDDAADNGEDKK-
DNAK_CORDI       AGAA-------------------------DATNV---DPNVVDAEVVEDDDKDGNK----
DNAK_CORJK       AGAD-------------------------AAGSAANDDPNVVDAEVVDEDTSAEDDKK--
DNAK_MYCLE       GE------------------------ASAPGGS--NSTDDVVDAEVVDDERESK------
DNAK_MYCPA       GGPDG---------------------AAAGGGS--GSADDVVDAEVVDDDRESK------
DNAK_MYCTU       GAAHP---------------------GGEPGGAHPGSADDVVDAEVVDDGREAK------
DNAK_MYCBO       GAAHP---------------------GGEPGGAHPGSADDVVDAEVVDDGREAK------
DNAK_NOCFA       SN----------------------------GAASSANDDQVVDAEVVDEPVDTEKK----
DNAK1_STRAW      G-AEG---------------------AAGGEHAK-AADDDVVDAEIVDED-RKDGAA---
DNAK_STRCO       GEAPG---------------------ADAGAEGK-GADDDVVDAEIVDDE-RKDGAA---
DNAK_THEFY       --ASG---------------------AAAGGQQN-AEDAEVVDAEIVDEEPKREGNS---
DNAK_CUTAK       PQGQ-----------------------DAESASSESGDDTVVDAEIVDDEDEKK------
DNAK_HALMA       GAGPG--GAAGPG--GAAGPG-----GAAGGAAEQG--EEYVDADFEDVE-ESDEDE---
DNAK_NATPD       GAGPGGMGGAGPGGMGGAGPGGMGGAGPGAGAGQQGDGEEFVDADFEDVDDEDDEDE---
DNAK_HALSA       GAGGM-------GGMGGMADG------PGGAADADGDDEEYVDADFEDVDEE--------
DNAK_AGRFC       DASAEG--K-----------------------------DDVVDADYEEIKDD---KKSA-
DNAK_RHIME       DAAADA--KRS--------------------------GDDVVDADYEEVKDEDDRKRSA-
DNAK_RHILO       DAKADA--AKD---------------------------SDVVDADFEEIDEDDDKKKSA-
DNAK_BRUME       AEGGEQ--ASSS-------------------------KDDVVDADYEEIDDN---KKSS-
DNAK_BRUAB       AEGGEQ--ASSS-------------------------KDDVVDADYEEIDDN---KKSS-
DNAK_BRUSU       AEGGEQ--ASSS-------------------------KDDVVDADYEEIDDN---KKSS-
DNAK_BARHE       ETDTK--------------------------------SDDVVDADFEEINDK---KK---
DNAK_BARQU       ETDTK--------------------------------SDDVVDADFEEISDK---KK---
DNAK_BRADU       DAAKD----------------------------------DVVDAEFTEVDDDKNNKKSA-
DNAK_NITWN       DAAKD----------------------------------DVVDAEFTEVDDDK---KSA-
DNAK_RHOPA       QAGKD----------------------------------DVVDAEFTEVDDDK--KKSA-
DNAK_CAUVC       DAKAD---------------------------------DGVVDAEFEEVDDN---KPAA-
DNAK_ZYMMO       DTPETE--KAE--------------------------GDNVVDAEFQEIDDQD--KK---
DNAK_RHOS4       PDEEGP--RSV--------------------------DDDIVDADFEDLGEN---KRK--
DNAK_RUEPO       PAAADA--RPS--------------------------DDDIVDAEFEDLGED---KRK--
DNAK_RICFE       ANTVN--------------------------------DEKVVDADFQDVDKK--------
DNAK_RICTY       ANTVN--------------------------------DEKVVDADFQDVDKK--------
DNAK_RICPR       ANTVN--------------------------------NEKVVDADFQDVDKK--------
DNAK_RICCN       ESATN--------------------------------DEKIVDADFQDVEKK--------
DNAK_PELUB       EGDKND--EGKK-------------------------DDNVVDADFEEVKEESKEGKEED
DNAK_EHRRG       NTTDTGSSSNSD-------------------------GSKVVDSDYQEIDKKDGK-----
DNAK_EHRRW       NTTDTGSSSNSD-------------------------GSKVVDSDYQEIDKKDGK-----
DNAK_EHRCJ       TTTNN---NNEE-------------------------DSKVVDSDYQEIDKKDGK-----
DNAK_ANAMM       STASDTSGNPEE---------------------------RVVDSEYQEIKKDDEDKK---
DNAK_WOLPM       FSSEGN--PNDK-------------------------EEKVVDSDYQDIDNKEENK----
DNAK_WOLTR       SAGSST--TNE--------------------------EEKVVDSDYQDIDNKEENK----
DNAK_BORBR       QQAADNAKPV---------------------------DDNVVDADFKEVKRDQ-------
DNAK_BORPE       QQAADNAKPV---------------------------DDNVVDADFKEVKRDQ-------
DNAK_BORPA       QQAADNAKPV---------------------------DDNVVDADFKEVKRDQ-------
DNAK_BURPS       GAAGAAAEGASAQGGAQ-------------------PADDVVDADFKEVKKD--------
DNAK_BURMA       GAAGAAAEGASAQGGAQ-------------------PADDVVDADFKEVKKD--------
DNAK_BURP1       GAAGAAAEGASAQGGAQ-------------------PPDDVVDADFKEVKKD--------
DNAK_BURL3       GAAGAAEGAAHAGGAQQ-------------------AADDVVDAEFKEVKKD--------
DNAK_RALSO       AGAEQAAAGAHAGAQAGHG---------------APQDDNVVDAEFKEVNDKK-------
DNAK_CUPPJ       GAAGAAGAGAQQQAQ--------------------PQDDNVVDAEFKEVNDKK-------
DNAK_AROAE       DEAAGGGSTGGSKAA----------------------DADVVDAEFTEVK-DKK------
DNAK_THIDA       AQPAGETGNQSTGPG----------------------NDDVVDAEFEEVK-DK-------
DNAK_DECAR       AGATGQQAEAGEKTV----------------------EGDVVDAEFTEVNKDKK------
DNAK_NITEU       AGAGTASDQSQDKPV----------------------EGEVVDAEFEEVK-DKK------
DNAK_NEIMA       GAQAESSAKKDD---------------------------DIVDADFEEVKDDKK------
DNAK_NEIG1       GAQANASAKKDD---------------------------DVVDADFEEVKDDKK------
DNAK_NEIMB       SEQANASAKKDD---------------------------DVVDADFEEVKDDKK------
DNAK_CHRVO       GAEQAEAGKKDEG--------------------------NVVDAEFEEVKKDKA------
DNAK_BUCAI       NM-----SANKK-------------------------DENVVDAEFEEIKDPKK------
DNAK_BUCAP       TS-----SESKK-------------------------DENVVDAEFEEIKDPKK------
DNAK_BUCBP       SP-----SSSKP-------------------------EENVVDAEFEEVKDQKK------
DNAK_BLOFL       SDLNKDKSETDA-------------------------SGDVVDAEFEEIKNKK-------
DNAK_BLOPB       S-----NSTSDP-------------------------NGEVVDAEFEEIKNKK-------
DNAK_WIGBR       IKTNKKENNNKT-------------------------NDDVVDAEFEEIKDKKN------
DNAK_ECOLI       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_ECOL6       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_ECO57       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_SHIBS       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_SHIDS       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_SHISS       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_SHIFL       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_SALTI       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_SALPA       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_SALTY       DAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_SALCH       EAS----ANNAK-------------------------DDDVVDAEFEEVKDKK-------
DNAK_YERPE       DTS----AK--K-------------------------EDDVVDAEFEEVKDKK-------
DNAK_YERPS       DTS----AK--K-------------------------EDDVVDAEFEEVKDKK-------
DNAK_PHOLL       GDS----AK--K-------------------------DDDVVDAEFEEVKDKK-------
DNAK_PECAS       DAS----AR--R-------------------------DDDVVDAEFEEVKDKK-------
DNAK_PASMU       AQS----GK--S-------------------------NDDVVDAEFEEVKDNK-------
DNAK_MANSM       AQG----NN--G-------------------------GDDVVDAEFEEVKDNK-------
DNAK_HAEIN       QQS----SA--K-------------------------DDGVVDAEFEEVKDNK-------
DNAK_HAEI8       QQS----SA--K-------------------------DDGVVDAEFEEVKDNK-------
DNAK_HAEDU       QQS----SA--K-------------------------DDSVVDAEFEEVKENK-------
DNAK2_COLP3      G---AQEADAAP-------------------------ADDVVDAEFEEVKDDK-------
DNAK_PSEHT       G---EQQQSAKQ-------------------------DDDVVDAEFEEVKDDK-------
DNAK_SHEON       G---AAKQSNAT-------------------------ADDVVDAEFEEVKDDKK------
DNAK_VIBVU       ----AEAGAQSQ-------------------------EDDVVDAEFEEVKDDKK------
DNAK_VIBVY       ----AEAGAQSQ-------------------------EDDVVDAEFEEVKDDKK------
DNAK_VIBPA       ----ADAGAQSK-------------------------DDDVVDAEFEEVKDDKK------
DNAK_VIBCH       ----GQSSAK---------------------------EDDVVDAEFEEVNDDKK------
DNAK1_ALIF1      ----AGEQPK-Q-------------------------EDDVVDAEFEEVK----------
DNAK2_ALIF1      ----AGEQPK-Q-------------------------DDDVVDAEFEEVKDK--------
DNAK1_PHOPR      ----EGEQEAKQ-------------------------DDNVVDAEFEEVKDEKK------
DNAK2_PHOPR      QQTNDTTGQSST-------------------------DDDVFEAEFEEVKDK--------
DNAK_IDILO       AG--GEQQSSKA-------------------------DDDVVDAEFEEVKDDDKK-----
DNAK_XANAC       SGN---AQASKA-------------------------ADDVVDAEFTEVKDDKK------
DNAK_XANC5       SGN---AQASKA-------------------------ADDVVDAEFTEVKDDKK------
DNAK_XANCP       SGN---AQASKA-------------------------ADDVVDAEFTEVKDDKKA-----
DNAK_XANC8       SGN---AQASKA-------------------------ADDVVDAEFTEVKDDKKA-----
DNAK_XANOR       SGN---AQASKA-------------------------ADDVVDAEFTEVKDDKK------
DNAK_XYLFA       GAG---AGSSAK-------------------------VDDVVDAEFTEVKGDKK------
DNAK_XYLFT       GAG---AGASAK-------------------------VDDVVDAEFTEVKADKK------
DNAK_PSEPK       QGGAQQAEPEAK-------------------------HDDVVDAEFEEVKDNNKQ-----
DNAK_PSEPF       EGAAPHDEKAEK-------------------------ADDVVDAEFEEVKDHK-------
DNAK_PSE14       EAAAKPAEENGK-------------------------ADDVVDAEFEEVKDHK-------
DNAK_PSEU2       DAAAKPAEETAK-------------------------ADDVVDAEFEEVKDHK-------
DNAK_PSESM       EAAAKPAEETAK-------------------------ADDVVDAEFEEVKDHK-------
DNAK_PSEF5       EGAAPHAESAEK-------------------------ADDVVDAEFEEVKDHK-------
DNAK_PSEAE       ED-APQGEQAKA-------------------------ADDVVDAEFEEVKDNK-------
DNAK_ACIAD       GG--DAGQQQKA-------------------------DDGVVDAEFTEVKDDKK------
DNAK_PSYA2       QGADNAGENNQA-------------------------DDDVVDAEFTEVEDDKK------
DNAK_FRATT       GGA--KAEEPKK-------------------------EEDVVDADFEDVEDDKK------
DNAK_LEGPH       GQTQSQESTKPA-------------------------EEGVVDAEFEEVKEEDKK-----
DNAK_LEGPL       GQTQSQESTKPA-------------------------EEGVVDAEFEEVKEEDKK-----
DNAK_LEGPA       GQTQSQESTKPV-------------------------EEGVVDAEFEEVKEEDKK-----
DNAK_COXBU       GEPQAQAGGK---------------------------KEDVVDAEFEEVKDEKKKDEDK-
DNAK_METCA       ETHSHEKAGGSG-------------------------GDDVVDAEFEEVRDDKR------
DNAK_NITOC       EPQPQKEEGKAA-------------------------EEDVVDAEFEEVKEDKNKAS---
DNAK1_COLP3      QHQGNAANDGAK-------------------------DEDIIDADFEDVSNG--------
DNAK_DESAG       AEAGAGDAGAKAS-----------------------QDEDVVDADYTEVKN---------
DNAK_DESVH       AQP-EGDAGARK------------------------QDDDVVDADYTEVKK---------
DNAK_GEOSL       QPG-GEAAGEASA-----------------------KDEKVVDADFEEVKDDKK------
DNAK_PELCD       EAA-SEA-GEQSA-----------------------GDEGVVDAEFEEVDEQNK------
DNAK_DESPS       GDGDAGAAGAKKK-----------------------DDDDVVDADYEEVK----------
DNAK_CAMJE       DK------KKKD--------------------------DDVIDAEVE-------------
DNAK_CAMJR       DK------KKKD--------------------------DDVIDAEVE-------------
DNAK_HELHP       QG---TDTKKKD--------------------------DDVIDAEVE-------------
DNAK_WOLSU       QGNTANAGKKKD--------------------------DDVIDAEVE-------------
DNAK_HELPY       QP------KKKD--------------------------DDVIDAEVE-------------
DNAK_HELPJ       QP------KKKD--------------------------DDVIDAEVE-------------
DNAK_FUSNN       QAGANAGSDK--------------------------KDEDVAEAEVVD------------
DNAK_RHOBA       DAAGAAGATAGGG-----------------------DDDDAIDAEFEVKE----------
DNAK_BACFN       AGQNNGKQDDNV-----------------------------QDADFEEVK----------
DNAK_BACFR       AGQNNGKQDDNV-----------------------------QDADFEEVK----------
DNAK_BACTN       AGQDNSKHGDNV-----------------------------QDADFEEVK----------
DNAK_PORGI       SAGDQPSDDKNV-----------------------------TDVDFEEVK----------
DNAK_CHLTE       AGGSK--GGDGA-----------------------------VNAEYEVIDGDDK------
DNAK_CHLCH       SGSSQSSGGDGA-----------------------------VNAEYEVINDDKK------
DNAK_BORBU       ENGPQSNTSEEG-----------------------------KEADYEVVDEDKK------
DNAK_BORBP       ENGTQSNTSEEG-----------------------------KEADYEVVDEDKK------
DNAK_TREPA       KSDAPSGNEAEG-----------------------------GDVDYEVVKDEDSK-----
DNAK_TREDE       DYGTSGPKTGTA-----------------------------DDVDYEVVNDDNDK-----
DNAK_LEPIC       DQGNSTNNGEKV-----------------------------VDADYTVVDDEKK------
DNAK_LEPIN       DQGNSTNNGEKV-----------------------------VDADYTVVDDEKK------
DNAK_BDEBA       QADAAEGGEASA-----------------------------NKGGDDVIDADYKDVN---
DNAK_CHLAB       STKPPTGNSSSS-----------------------ANNENIEEADVEIVDKPND------
DNAK_CHLCV       STKPPAGNSASSN----------------------SNNENIEEADVEIVDKPND------
DNAK_CHLPN       STKPPSNNGSSE--------------------------DHIEEADVEIIDNDDK------
DNAK_CHLTR       STRPPAGGSASS-------------------------TDNIEDADVEIVDKPE-------
DNAK_CHLTA       STRPPAGGSASS-------------------------TDNIEDADVEIVDKPE-------
DNAK_CHLMU       STRPPAGDNSSS-------------------------TDNIEDADVEIVDKPE-------
DNAK_PARUW       SSQHQTNNNKPD---------------------------DIEEAEVEILDDKKP------
DNAK_DEHM1       SAEGKKNDDEGT-----------------------------VEGEFREV-----------
DNAK_DEHMC       SAEGKKADDEGT-----------------------------VEGEFREV-----------
DNAK_CLOPE       GANAGAGATNNN-------------------------DDNVVDADFEVQDDK--------
DNAK_CLOTE       EANAGQNANN---------------------------DDNVVDADYKVEDDEK-------
DNAK_CLOAB       -AGASQKTNGGA-------------------------DDNVVDADFKVDNDK--------
DNAK_METAC       -AGSA--DARGP-------------------------DETVVDADYEVVDDEKRK-----
DNAK_METMA       -GGAAGTDARGP-------------------------DETVVDADYEVVDDEKRK-----
DNAK_METBF       -GEAGSHDAQGP-------------------------DETVVDADYEVVDDEKRK-----
DNAK_CALS4       --SQGTS------------------------------QGNVYEADYKVEDDNK-------
DNAK_CARHZ       --TGTNT------------------------------QGNVYDADYKVNDDK--------
DNAK_SYMTH       --SQAGSAAGSG-------------------------DGQSMDAEFKVKDEDK-------
DNAK_AQUAE       KDEGGEGEV----------------------------EAKPVD-----------------
DNAK_THEMA       SNQ---------------------------------------------------------
DNAK_THEAC       SNSQNSGSS----------------------------DGKTVDAEYKEKS----------
DNAK_THEVO       GNQNSSKQE----------------------------NDKTVDAEYKEKS----------
DNAK_PICTO       SQNNNSQNN----------------------------NGDTVDADFKESK----------
DNAK_METTH       GR----------------------------------------------------------
DNAK3_NOSS1      GTLIPQFNFDFD-------------------------DESTAQADYEAID----------
DNAK1_THEEB      QVLDSEATIISD-------------------------NEETVVSDYEAVD----------
DNAK3_SYNP6      GSNETVAIERND-------------------------DDATVTADYEAIE----------
DNAK1_NOSS1      DIFVGDK-DKE----------------------RDLPRDSYRERDAYNNRD---------
DNAK3_SYNY3      KTFTGDF-DDDDDYY----------------NRRPAPRDDYRGGNDYGRYDDYN------
DNAK3_THEEB      LPNLREAVNKGLDVV----------------RGRERRRDD--DEDEWA------------
DNAK1_SYNP6      QTFASLRGDGNRDFE----------------RSWDDRGGDRWDADPWDRSRRSTPSYGYD
DNAK1_PROMM      NTLGSLK--------------------------DELFSDDDWDEDPWNSPA---------
DNAK1_SYNPX      NTLGSLK--------------------------DELFADD-WDDDPWAAPS---------
DNAK1_PROMA      NTFGSLK--------------------------DELFSDDYWDDDPWDYHP---------
DNAK1_PROMP      NTFGSLK--------------------------DELFSDDYWDDDPWDNQM---------
DNAK_THET8       G------------------------------------PDDVIDADYKPAD----------
DNAK_THET2       G------------------------------------PDDVIDADYKPAD----------
DNAK_DEIRA       A------------------------------------DDDVIDADFKPAE----------
DNAK2_NOSS1      APQDGGT-------------------------TSSDGGDDVIDADFTETK----------
DNAK2_SYNY3      GPEAG---------------------------TSSGGGDDVIDAEFSEPEK---------
DNAK2_THEEB      SSSGG---------------------------SGSGGDDEVIDAEFSETK----------
DNAK2_PROMA      GTSSESN-------------------------NSTEGNDDVIDAEFTESK----------
DNAK_PROMT       DSNTDSK-------------------------VDG---DDVIDADFTETK----------
DNAK2_PROMP      TPDSNES-------------------------NDKGGDDDVIDADFTETKD---------
DNAK2_PROMM      AGAAGA--------------------------GDSSSGDDVIDAEFTESK----------
DNAK2_SYNPX      AGASAAS-------------------------GGGDASDDVIDAEFTETK----------
DNAK2_SYNP6      AGPSSSS-------------------------SSSSGDDDVIDAEFSESK----------
DNAK_GLOVI       PSGSGGT-------------------------SGTRGGDDVIDAEFTETK----------
DNAK2_STRAW      AATGGPT-------------------------SGGGGGDDVIDAEFDKG-----------
                                                                             

DNAK_MYCH7       ------------------------------------------------------------
DNAK_MYCHJ       ------------------------------------------------------------
DNAK_MYCPU       ------------------------------------------------------------
DNAK_MYCMO       ------------------------------------------------------------
DNAK_MYCS5       ------------------------------------------------------------
DNAK_MYCHO       ------------------------------------------------------------
DNAK_UREPA       ------------------------------------------------------------
DNAK_MYCGE       ------------------------------------------------------------
DNAK_MYCPN       ------------------------------------------------------------
DNAK_MYCGA       ------------------------------------------------------------
DNAK_MYCPE       ------------------------------------------------------------
DNAK_MESFL       ------------------------------------------------------------
DNAK_MYCMS       ------------------------------------------------------------
DNAK_BACAN       ------------------------------------------------------------
DNAK_BACCZ       ------------------------------------------------------------
DNAK_BACHK       ------------------------------------------------------------
DNAK_BACCR       ------------------------------------------------------------
DNAK_BACC1       ------------------------------------------------------------
DNAK_BACSU       ------------------------------------------------------------
DNAK_BACLD       ------------------------------------------------------------
DNAK_GEOKA       ------------------------------------------------------------
DNAK_OCEIH       ------------------------------------------------------------
DNAK_BACHD       ------------------------------------------------------------
DNAK_BACSK       ------------------------------------------------------------
DNAK_STRA3       ------------------------------------------------------------
DNAK_STRA5       ------------------------------------------------------------
DNAK_STRA1       ------------------------------------------------------------
DNAK_STRP1       ------------------------------------------------------------
DNAK_STRP6       ------------------------------------------------------------
DNAK_STRP8       ------------------------------------------------------------
DNAK_STRPM       ------------------------------------------------------------
DNAK_STRP3       ------------------------------------------------------------
DNAK_STRMU       ------------------------------------------------------------
DNAK_STRPN       ------------------------------------------------------------
DNAK_STRR6       ------------------------------------------------------------
DNAK_STRT1       ------------------------------------------------------------
DNAK_STRT2       ------------------------------------------------------------
DNAK_LACLA       ------------------------------------------------------------
DNAK_ENTFA       ------------------------------------------------------------
DNAK_LISMF       ------------------------------------------------------------
DNAK_LISMO       ------------------------------------------------------------
DNAK_LISIN       ------------------------------------------------------------
DNAK_STAAC       ------------------------------------------------------------
DNAK_STAAM       ------------------------------------------------------------
DNAK_STAAN       ------------------------------------------------------------
DNAK_STAAR       ------------------------------------------------------------
DNAK_STAAS       ------------------------------------------------------------
DNAK_STAAW       ------------------------------------------------------------
DNAK_STAES       ------------------------------------------------------------
DNAK_STAEQ       ------------------------------------------------------------
DNAK_STAHJ       ------------------------------------------------------------
DNAK_STAS1       ------------------------------------------------------------
DNAK_LACAC       ------------------------------------------------------------
DNAK_LACJO       ------------------------------------------------------------
DNAK_LACSK       ------------------------------------------------------------
DNAK_LACSS       ------------------------------------------------------------
DNAK_LACPL       ------------------------------------------------------------
DNAK_ONYPE       ------------------------------------------------------------
DNAK_TROWT       ------------------------------------------------------------
DNAK_TROW8       ------------------------------------------------------------
DNAK_LEIXX       ------------------------------------------------------------
DNAK_BIFLO       ------------------------------------------------------------
DNAK_COREF       ------------------------------------------------------------
DNAK_CORGL       ------------------------------------------------------------
DNAK_CORDI       ------------------------------------------------------------
DNAK_CORJK       ------------------------------------------------------------
DNAK_MYCLE       ------------------------------------------------------------
DNAK_MYCPA       ------------------------------------------------------------
DNAK_MYCTU       ------------------------------------------------------------
DNAK_MYCBO       ------------------------------------------------------------
DNAK_NOCFA       ------------------------------------------------------------
DNAK1_STRAW      ------------------------------------------------------------
DNAK_STRCO       ------------------------------------------------------------
DNAK_THEFY       ------------------------------------------------------------
DNAK_CUTAK       ------------------------------------------------------------
DNAK_HALMA       ------------------------------------------------------------
DNAK_NATPD       ------------------------------------------------------------
DNAK_HALSA       ------------------------------------------------------------
DNAK_AGRFC       ------------------------------------------------------------
DNAK_RHIME       ------------------------------------------------------------
DNAK_RHILO       ------------------------------------------------------------
DNAK_BRUME       ------------------------------------------------------------
DNAK_BRUAB       ------------------------------------------------------------
DNAK_BRUSU       ------------------------------------------------------------
DNAK_BARHE       ------------------------------------------------------------
DNAK_BARQU       ------------------------------------------------------------
DNAK_BRADU       ------------------------------------------------------------
DNAK_NITWN       ------------------------------------------------------------
DNAK_RHOPA       ------------------------------------------------------------
DNAK_CAUVC       ------------------------------------------------------------
DNAK_ZYMMO       ------------------------------------------------------------
DNAK_RHOS4       ------------------------------------------------------------
DNAK_RUEPO       ------------------------------------------------------------
DNAK_RICFE       ------------------------------------------------------------
DNAK_RICTY       ------------------------------------------------------------
DNAK_RICPR       ------------------------------------------------------------
DNAK_RICCN       ------------------------------------------------------------
DNAK_PELUB       KEKSA-------------------------------------------------------
DNAK_EHRRG       ------------------------------------------------------------
DNAK_EHRRW       ------------------------------------------------------------
DNAK_EHRCJ       ------------------------------------------------------------
DNAK_ANAMM       ------------------------------------------------------------
DNAK_WOLPM       ------------------------------------------------------------
DNAK_WOLTR       ------------------------------------------------------------
DNAK_BORBR       ------------------------------------------------------------
DNAK_BORPE       ------------------------------------------------------------
DNAK_BORPA       ------------------------------------------------------------
DNAK_BURPS       ------------------------------------------------------------
DNAK_BURMA       ------------------------------------------------------------
DNAK_BURP1       ------------------------------------------------------------
DNAK_BURL3       ------------------------------------------------------------
DNAK_RALSO       ------------------------------------------------------------
DNAK_CUPPJ       ------------------------------------------------------------
DNAK_AROAE       ------------------------------------------------------------
DNAK_THIDA       ------------------------------------------------------------
DNAK_DECAR       ------------------------------------------------------------
DNAK_NITEU       ------------------------------------------------------------
DNAK_NEIMA       ------------------------------------------------------------
DNAK_NEIG1       ------------------------------------------------------------
DNAK_NEIMB       ------------------------------------------------------------
DNAK_CHRVO       ------------------------------------------------------------
DNAK_BUCAI       ------------------------------------------------------------
DNAK_BUCAP       ------------------------------------------------------------
DNAK_BUCBP       ------------------------------------------------------------
DNAK_BLOFL       ------------------------------------------------------------
DNAK_BLOPB       ------------------------------------------------------------
DNAK_WIGBR       ------------------------------------------------------------
DNAK_ECOLI       ------------------------------------------------------------
DNAK_ECOL6       ------------------------------------------------------------
DNAK_ECO57       ------------------------------------------------------------
DNAK_SHIBS       ------------------------------------------------------------
DNAK_SHIDS       ------------------------------------------------------------
DNAK_SHISS       ------------------------------------------------------------
DNAK_SHIFL       ------------------------------------------------------------
DNAK_SALTI       ------------------------------------------------------------
DNAK_SALPA       ------------------------------------------------------------
DNAK_SALTY       ------------------------------------------------------------
DNAK_SALCH       ------------------------------------------------------------
DNAK_YERPE       ------------------------------------------------------------
DNAK_YERPS       ------------------------------------------------------------
DNAK_PHOLL       ------------------------------------------------------------
DNAK_PECAS       ------------------------------------------------------------
DNAK_PASMU       ------------------------------------------------------------
DNAK_MANSM       ------------------------------------------------------------
DNAK_HAEIN       ------------------------------------------------------------
DNAK_HAEI8       ------------------------------------------------------------
DNAK_HAEDU       ------------------------------------------------------------
DNAK2_COLP3      ------------------------------------------------------------
DNAK_PSEHT       ------------------------------------------------------------
DNAK_SHEON       ------------------------------------------------------------
DNAK_VIBVU       ------------------------------------------------------------
DNAK_VIBVY       ------------------------------------------------------------
DNAK_VIBPA       ------------------------------------------------------------
DNAK_VIBCH       ------------------------------------------------------------
DNAK1_ALIF1      ------------------------------------------------------------
DNAK2_ALIF1      ------------------------------------------------------------
DNAK1_PHOPR      ------------------------------------------------------------
DNAK2_PHOPR      ------------------------------------------------------------
DNAK_IDILO       ------------------------------------------------------------
DNAK_XANAC       ------------------------------------------------------------
DNAK_XANC5       ------------------------------------------------------------
DNAK_XANCP       ------------------------------------------------------------
DNAK_XANC8       ------------------------------------------------------------
DNAK_XANOR       ------------------------------------------------------------
DNAK_XYLFA       ------------------------------------------------------------
DNAK_XYLFT       ------------------------------------------------------------
DNAK_PSEPK       ------------------------------------------------------------
DNAK_PSEPF       ------------------------------------------------------------
DNAK_PSE14       ------------------------------------------------------------
DNAK_PSEU2       ------------------------------------------------------------
DNAK_PSESM       ------------------------------------------------------------
DNAK_PSEF5       ------------------------------------------------------------
DNAK_PSEAE       ------------------------------------------------------------
DNAK_ACIAD       ------------------------------------------------------------
DNAK_PSYA2       ------------------------------------------------------------
DNAK_FRATT       ------------------------------------------------------------
DNAK_LEGPH       ------------------------------------------------------------
DNAK_LEGPL       ------------------------------------------------------------
DNAK_LEGPA       ------------------------------------------------------------
DNAK_COXBU       ------------------------------------------------------------
DNAK_METCA       ------------------------------------------------------------
DNAK_NITOC       ------------------------------------------------------------
DNAK1_COLP3      ------------------------------------------------------------
DNAK_DESAG       ------------------------------------------------------------
DNAK_DESVH       ------------------------------------------------------------
DNAK_GEOSL       ------------------------------------------------------------
DNAK_PELCD       ------------------------------------------------------------
DNAK_DESPS       ------------------------------------------------------------
DNAK_CAMJE       ------------------------------------------------------------
DNAK_CAMJR       ------------------------------------------------------------
DNAK_HELHP       ------------------------------------------------------------
DNAK_WOLSU       ------------------------------------------------------------
DNAK_HELPY       ------------------------------------------------------------
DNAK_HELPJ       ------------------------------------------------------------
DNAK_FUSNN       ------------------------------------------------------------
DNAK_RHOBA       ------------------------------------------------------------
DNAK_BACFN       ------------------------------------------------------------
DNAK_BACFR       ------------------------------------------------------------
DNAK_BACTN       ------------------------------------------------------------
DNAK_PORGI       ------------------------------------------------------------
DNAK_CHLTE       ------------------------------------------------------------
DNAK_CHLCH       ------------------------------------------------------------
DNAK_BORBU       ------------------------------------------------------------
DNAK_BORBP       ------------------------------------------------------------
DNAK_TREPA       ------------------------------------------------------------
DNAK_TREDE       ------------------------------------------------------------
DNAK_LEPIC       ------------------------------------------------------------
DNAK_LEPIN       ------------------------------------------------------------
DNAK_BDEBA       ------------------------------------------------------------
DNAK_CHLAB       ------------------------------------------------------------
DNAK_CHLCV       ------------------------------------------------------------
DNAK_CHLPN       ------------------------------------------------------------
DNAK_CHLTR       ------------------------------------------------------------
DNAK_CHLTA       ------------------------------------------------------------
DNAK_CHLMU       ------------------------------------------------------------
DNAK_PARUW       ------------------------------------------------------------
DNAK_DEHM1       ------------------------------------------------------------
DNAK_DEHMC       ------------------------------------------------------------
DNAK_CLOPE       ------------------------------------------------------------
DNAK_CLOTE       ------------------------------------------------------------
DNAK_CLOAB       ------------------------------------------------------------
DNAK_METAC       ------------------------------------------------------------
DNAK_METMA       ------------------------------------------------------------
DNAK_METBF       ------------------------------------------------------------
DNAK_CALS4       ------------------------------------------------------------
DNAK_CARHZ       ------------------------------------------------------------
DNAK_SYMTH       ------------------------------------------------------------
DNAK_AQUAE       ------------------------------------------------------------
DNAK_THEMA       ------------------------------------------------------------
DNAK_THEAC       ------------------------------------------------------------
DNAK_THEVO       ------------------------------------------------------------
DNAK_PICTO       ------------------------------------------------------------
DNAK_METTH       ------------------------------------------------------------
DNAK3_NOSS1      ------------------------------------------------------------
DNAK1_THEEB      ------------------------------------------------------------
DNAK3_SYNP6      ------------------------------------------------------------
DNAK1_NOSS1      ----------------------YGRDYGRDYGRDSRPSYDNSRPPRK-------------
DNAK3_SYNY3      -----YNAPSRREAPMPRAGAGRGPSLSKDYRSTAYADWDQSRVTRQRPYQGESLGGTYD
DNAK3_THEEB      -------------------------EPPRTRRSRSYSQRADSAP----------------
DNAK1_SYNP6      DRRSPVSDPYRGERWVEEQTSMSRREPVRDRNGGNGSVRPEPAPRRGRPTWEEDQPPRRD
DNAK1_PROMM      -------------------------RSS--DGRRIYRGRELNP-----------------
DNAK1_SYNPX      -------------------------GPP--RGRSLNR-RDRDP-----------------
DNAK1_PROMA      -------------------------NNNRVGGGRDYGGRNLDR-----------------
DNAK1_PROMP      -------------------------NSNS-RNSRYGNSRDDDP-----------------
DNAK_THET8       ------------------------------------------------------------
DNAK_THET2       ------------------------------------------------------------
DNAK_DEIRA       ------------------------------------------------------------
DNAK2_NOSS1      ------------------------------------------------------------
DNAK2_SYNY3      ------------------------------------------------------------
DNAK2_THEEB      ------------------------------------------------------------
DNAK2_PROMA      ------------------------------------------------------------
DNAK_PROMT       ------------------------------------------------------------
DNAK2_PROMP      ------------------------------------------------------------
DNAK2_PROMM      ------------------------------------------------------------
DNAK2_SYNPX      ------------------------------------------------------------
DNAK2_SYNP6      ------------------------------------------------------------
DNAK_GLOVI       ------------------------------------------------------------
DNAK2_STRAW      ------------------------------------------------------------
                                                                             

DNAK_MYCH7       ------------------------------------------------------------
DNAK_MYCHJ       ------------------------------------------------------------
DNAK_MYCPU       ------------------------------------------------------------
DNAK_MYCMO       ------------------------------------------------------------
DNAK_MYCS5       ------------------------------------------------------------
DNAK_MYCHO       ------------------------------------------------------------
DNAK_UREPA       ------------------------------------------------------------
DNAK_MYCGE       ------------------------------------------------------------
DNAK_MYCPN       ------------------------------------------------------------
DNAK_MYCGA       ------------------------------------------------------------
DNAK_MYCPE       ------------------------------------------------------------
DNAK_MESFL       ------------------------------------------------------------
DNAK_MYCMS       ------------------------------------------------------------
DNAK_BACAN       ------------------------------------------------------------
DNAK_BACCZ       ------------------------------------------------------------
DNAK_BACHK       ------------------------------------------------------------
DNAK_BACCR       ------------------------------------------------------------
DNAK_BACC1       ------------------------------------------------------------
DNAK_BACSU       ------------------------------------------------------------
DNAK_BACLD       ------------------------------------------------------------
DNAK_GEOKA       ------------------------------------------------------------
DNAK_OCEIH       ------------------------------------------------------------
DNAK_BACHD       ------------------------------------------------------------
DNAK_BACSK       ------------------------------------------------------------
DNAK_STRA3       ------------------------------------------------------------
DNAK_STRA5       ------------------------------------------------------------
DNAK_STRA1       ------------------------------------------------------------
DNAK_STRP1       ------------------------------------------------------------
DNAK_STRP6       ------------------------------------------------------------
DNAK_STRP8       ------------------------------------------------------------
DNAK_STRPM       ------------------------------------------------------------
DNAK_STRP3       ------------------------------------------------------------
DNAK_STRMU       ------------------------------------------------------------
DNAK_STRPN       ------------------------------------------------------------
DNAK_STRR6       ------------------------------------------------------------
DNAK_STRT1       ------------------------------------------------------------
DNAK_STRT2       ------------------------------------------------------------
DNAK_LACLA       ------------------------------------------------------------
DNAK_ENTFA       ------------------------------------------------------------
DNAK_LISMF       ------------------------------------------------------------
DNAK_LISMO       ------------------------------------------------------------
DNAK_LISIN       ------------------------------------------------------------
DNAK_STAAC       ------------------------------------------------------------
DNAK_STAAM       ------------------------------------------------------------
DNAK_STAAN       ------------------------------------------------------------
DNAK_STAAR       ------------------------------------------------------------
DNAK_STAAS       ------------------------------------------------------------
DNAK_STAAW       ------------------------------------------------------------
DNAK_STAES       ------------------------------------------------------------
DNAK_STAEQ       ------------------------------------------------------------
DNAK_STAHJ       ------------------------------------------------------------
DNAK_STAS1       ------------------------------------------------------------
DNAK_LACAC       ------------------------------------------------------------
DNAK_LACJO       ------------------------------------------------------------
DNAK_LACSK       ------------------------------------------------------------
DNAK_LACSS       ------------------------------------------------------------
DNAK_LACPL       ------------------------------------------------------------
DNAK_ONYPE       ------------------------------------------------------------
DNAK_TROWT       ------------------------------------------------------------
DNAK_TROW8       ------------------------------------------------------------
DNAK_LEIXX       ------------------------------------------------------------
DNAK_BIFLO       ------------------------------------------------------------
DNAK_COREF       ------------------------------------------------------------
DNAK_CORGL       ------------------------------------------------------------
DNAK_CORDI       ------------------------------------------------------------
DNAK_CORJK       ------------------------------------------------------------
DNAK_MYCLE       ------------------------------------------------------------
DNAK_MYCPA       ------------------------------------------------------------
DNAK_MYCTU       ------------------------------------------------------------
DNAK_MYCBO       ------------------------------------------------------------
DNAK_NOCFA       ------------------------------------------------------------
DNAK1_STRAW      ------------------------------------------------------------
DNAK_STRCO       ------------------------------------------------------------
DNAK_THEFY       ------------------------------------------------------------
DNAK_CUTAK       ------------------------------------------------------------
DNAK_HALMA       ------------------------------------------------------------
DNAK_NATPD       ------------------------------------------------------------
DNAK_HALSA       ------------------------------------------------------------
DNAK_AGRFC       ------------------------------------------------------------
DNAK_RHIME       ------------------------------------------------------------
DNAK_RHILO       ------------------------------------------------------------
DNAK_BRUME       ------------------------------------------------------------
DNAK_BRUAB       ------------------------------------------------------------
DNAK_BRUSU       ------------------------------------------------------------
DNAK_BARHE       ------------------------------------------------------------
DNAK_BARQU       ------------------------------------------------------------
DNAK_BRADU       ------------------------------------------------------------
DNAK_NITWN       ------------------------------------------------------------
DNAK_RHOPA       ------------------------------------------------------------
DNAK_CAUVC       ------------------------------------------------------------
DNAK_ZYMMO       ------------------------------------------------------------
DNAK_RHOS4       ------------------------------------------------------------
DNAK_RUEPO       ------------------------------------------------------------
DNAK_RICFE       ------------------------------------------------------------
DNAK_RICTY       ------------------------------------------------------------
DNAK_RICPR       ------------------------------------------------------------
DNAK_RICCN       ------------------------------------------------------------
DNAK_PELUB       ------------------------------------------------------------
DNAK_EHRRG       ------------------------------------------------------------
DNAK_EHRRW       ------------------------------------------------------------
DNAK_EHRCJ       ------------------------------------------------------------
DNAK_ANAMM       ------------------------------------------------------------
DNAK_WOLPM       ------------------------------------------------------------
DNAK_WOLTR       ------------------------------------------------------------
DNAK_BORBR       ------------------------------------------------------------
DNAK_BORPE       ------------------------------------------------------------
DNAK_BORPA       ------------------------------------------------------------
DNAK_BURPS       ------------------------------------------------------------
DNAK_BURMA       ------------------------------------------------------------
DNAK_BURP1       ------------------------------------------------------------
DNAK_BURL3       ------------------------------------------------------------
DNAK_RALSO       ------------------------------------------------------------
DNAK_CUPPJ       ------------------------------------------------------------
DNAK_AROAE       ------------------------------------------------------------
DNAK_THIDA       ------------------------------------------------------------
DNAK_DECAR       ------------------------------------------------------------
DNAK_NITEU       ------------------------------------------------------------
DNAK_NEIMA       ------------------------------------------------------------
DNAK_NEIG1       ------------------------------------------------------------
DNAK_NEIMB       ------------------------------------------------------------
DNAK_CHRVO       ------------------------------------------------------------
DNAK_BUCAI       ------------------------------------------------------------
DNAK_BUCAP       ------------------------------------------------------------
DNAK_BUCBP       ------------------------------------------------------------
DNAK_BLOFL       ------------------------------------------------------------
DNAK_BLOPB       ------------------------------------------------------------
DNAK_WIGBR       ------------------------------------------------------------
DNAK_ECOLI       ------------------------------------------------------------
DNAK_ECOL6       ------------------------------------------------------------
DNAK_ECO57       ------------------------------------------------------------
DNAK_SHIBS       ------------------------------------------------------------
DNAK_SHIDS       ------------------------------------------------------------
DNAK_SHISS       ------------------------------------------------------------
DNAK_SHIFL       ------------------------------------------------------------
DNAK_SALTI       ------------------------------------------------------------
DNAK_SALPA       ------------------------------------------------------------
DNAK_SALTY       ------------------------------------------------------------
DNAK_SALCH       ------------------------------------------------------------
DNAK_YERPE       ------------------------------------------------------------
DNAK_YERPS       ------------------------------------------------------------
DNAK_PHOLL       ------------------------------------------------------------
DNAK_PECAS       ------------------------------------------------------------
DNAK_PASMU       ------------------------------------------------------------
DNAK_MANSM       ------------------------------------------------------------
DNAK_HAEIN       ------------------------------------------------------------
DNAK_HAEI8       ------------------------------------------------------------
DNAK_HAEDU       ------------------------------------------------------------
DNAK2_COLP3      ------------------------------------------------------------
DNAK_PSEHT       ------------------------------------------------------------
DNAK_SHEON       ------------------------------------------------------------
DNAK_VIBVU       ------------------------------------------------------------
DNAK_VIBVY       ------------------------------------------------------------
DNAK_VIBPA       ------------------------------------------------------------
DNAK_VIBCH       ------------------------------------------------------------
DNAK1_ALIF1      ------------------------------------------------------------
DNAK2_ALIF1      ------------------------------------------------------------
DNAK1_PHOPR      ------------------------------------------------------------
DNAK2_PHOPR      ------------------------------------------------------------
DNAK_IDILO       ------------------------------------------------------------
DNAK_XANAC       ------------------------------------------------------------
DNAK_XANC5       ------------------------------------------------------------
DNAK_XANCP       ------------------------------------------------------------
DNAK_XANC8       ------------------------------------------------------------
DNAK_XANOR       ------------------------------------------------------------
DNAK_XYLFA       ------------------------------------------------------------
DNAK_XYLFT       ------------------------------------------------------------
DNAK_PSEPK       ------------------------------------------------------------
DNAK_PSEPF       ------------------------------------------------------------
DNAK_PSE14       ------------------------------------------------------------
DNAK_PSEU2       ------------------------------------------------------------
DNAK_PSESM       ------------------------------------------------------------
DNAK_PSEF5       ------------------------------------------------------------
DNAK_PSEAE       ------------------------------------------------------------
DNAK_ACIAD       ------------------------------------------------------------
DNAK_PSYA2       ------------------------------------------------------------
DNAK_FRATT       ------------------------------------------------------------
DNAK_LEGPH       ------------------------------------------------------------
DNAK_LEGPL       ------------------------------------------------------------
DNAK_LEGPA       ------------------------------------------------------------
DNAK_COXBU       ------------------------------------------------------------
DNAK_METCA       ------------------------------------------------------------
DNAK_NITOC       ------------------------------------------------------------
DNAK1_COLP3      ------------------------------------------------------------
DNAK_DESAG       ------------------------------------------------------------
DNAK_DESVH       ------------------------------------------------------------
DNAK_GEOSL       ------------------------------------------------------------
DNAK_PELCD       ------------------------------------------------------------
DNAK_DESPS       ------------------------------------------------------------
DNAK_CAMJE       ------------------------------------------------------------
DNAK_CAMJR       ------------------------------------------------------------
DNAK_HELHP       ------------------------------------------------------------
DNAK_WOLSU       ------------------------------------------------------------
DNAK_HELPY       ------------------------------------------------------------
DNAK_HELPJ       ------------------------------------------------------------
DNAK_FUSNN       ------------------------------------------------------------
DNAK_RHOBA       ------------------------------------------------------------
DNAK_BACFN       ------------------------------------------------------------
DNAK_BACFR       ------------------------------------------------------------
DNAK_BACTN       ------------------------------------------------------------
DNAK_PORGI       ------------------------------------------------------------
DNAK_CHLTE       ------------------------------------------------------------
DNAK_CHLCH       ------------------------------------------------------------
DNAK_BORBU       ------------------------------------------------------------
DNAK_BORBP       ------------------------------------------------------------
DNAK_TREPA       ------------------------------------------------------------
DNAK_TREDE       ------------------------------------------------------------
DNAK_LEPIC       ------------------------------------------------------------
DNAK_LEPIN       ------------------------------------------------------------
DNAK_BDEBA       ------------------------------------------------------------
DNAK_CHLAB       ------------------------------------------------------------
DNAK_CHLCV       ------------------------------------------------------------
DNAK_CHLPN       ------------------------------------------------------------
DNAK_CHLTR       ------------------------------------------------------------
DNAK_CHLTA       ------------------------------------------------------------
DNAK_CHLMU       ------------------------------------------------------------
DNAK_PARUW       ------------------------------------------------------------
DNAK_DEHM1       ------------------------------------------------------------
DNAK_DEHMC       ------------------------------------------------------------
DNAK_CLOPE       ------------------------------------------------------------
DNAK_CLOTE       ------------------------------------------------------------
DNAK_CLOAB       ------------------------------------------------------------
DNAK_METAC       ------------------------------------------------------------
DNAK_METMA       ------------------------------------------------------------
DNAK_METBF       ------------------------------------------------------------
DNAK_CALS4       ------------------------------------------------------------
DNAK_CARHZ       ------------------------------------------------------------
DNAK_SYMTH       ------------------------------------------------------------
DNAK_AQUAE       ------------------------------------------------------------
DNAK_THEMA       ------------------------------------------------------------
DNAK_THEAC       ------------------------------------------------------------
DNAK_THEVO       ------------------------------------------------------------
DNAK_PICTO       ------------------------------------------------------------
DNAK_METTH       ------------------------------------------------------------
DNAK3_NOSS1      ------------------------------------------------------------
DNAK1_THEEB      ------------------------------------------------------------
DNAK3_SYNP6      ------------------------------------------------------------
DNAK1_NOSS1      ----SP---------------------------------RPS-------YQDNWDDDDD-
DNAK3_SYNY3      DRRSSPQDDYSRGDRQKDYDYRENAPSRSGRGGNGRYGERPAQPGRNAPLQNGWDDDDDD
DNAK3_THEEB      -----------------------------------------------------WDDWDDD
DNAK1_SYNP6      -----------------------------------RSSQPPAKPASGRRWNDGWDDDDDE
DNAK1_PROMM      -----------------------------------------------------WDDDFYR
DNAK1_SYNPX      -----------------------------------------------------WDDDFYR
DNAK1_PROMA      -----------------------------------------------------WDNDFYN
DNAK1_PROMP      -----------------------------------------------------WDNDYFL
DNAK_THET8       ------------------------------------------------------------
DNAK_THET2       ------------------------------------------------------------
DNAK_DEIRA       ------------------------------------------------------------
DNAK2_NOSS1      ------------------------------------------------------------
DNAK2_SYNY3      ------------------------------------------------------------
DNAK2_THEEB      ------------------------------------------------------------
DNAK2_PROMA      ------------------------------------------------------------
DNAK_PROMT       ------------------------------------------------------------
DNAK2_PROMP      ------------------------------------------------------------
DNAK2_PROMM      ------------------------------------------------------------
DNAK2_SYNPX      ------------------------------------------------------------
DNAK2_SYNP6      ------------------------------------------------------------
DNAK_GLOVI       ------------------------------------------------------------
DNAK2_STRAW      ------------------------------------------------------------
                                                                             

DNAK_MYCH7       --
DNAK_MYCHJ       --
DNAK_MYCPU       --
DNAK_MYCMO       --
DNAK_MYCS5       --
DNAK_MYCHO       --
DNAK_UREPA       --
DNAK_MYCGE       --
DNAK_MYCPN       --
DNAK_MYCGA       --
DNAK_MYCPE       --
DNAK_MESFL       --
DNAK_MYCMS       --
DNAK_BACAN       --
DNAK_BACCZ       --
DNAK_BACHK       --
DNAK_BACCR       --
DNAK_BACC1       --
DNAK_BACSU       --
DNAK_BACLD       --
DNAK_GEOKA       --
DNAK_OCEIH       --
DNAK_BACHD       --
DNAK_BACSK       --
DNAK_STRA3       --
DNAK_STRA5       --
DNAK_STRA1       --
DNAK_STRP1       --
DNAK_STRP6       --
DNAK_STRP8       --
DNAK_STRPM       --
DNAK_STRP3       --
DNAK_STRMU       --
DNAK_STRPN       --
DNAK_STRR6       --
DNAK_STRT1       --
DNAK_STRT2       --
DNAK_LACLA       --
DNAK_ENTFA       --
DNAK_LISMF       --
DNAK_LISMO       --
DNAK_LISIN       --
DNAK_STAAC       --
DNAK_STAAM       --
DNAK_STAAN       --
DNAK_STAAR       --
DNAK_STAAS       --
DNAK_STAAW       --
DNAK_STAES       --
DNAK_STAEQ       --
DNAK_STAHJ       --
DNAK_STAS1       --
DNAK_LACAC       --
DNAK_LACJO       --
DNAK_LACSK       --
DNAK_LACSS       --
DNAK_LACPL       --
DNAK_ONYPE       --
DNAK_TROWT       --
DNAK_TROW8       --
DNAK_LEIXX       --
DNAK_BIFLO       --
DNAK_COREF       --
DNAK_CORGL       --
DNAK_CORDI       --
DNAK_CORJK       --
DNAK_MYCLE       --
DNAK_MYCPA       --
DNAK_MYCTU       --
DNAK_MYCBO       --
DNAK_NOCFA       --
DNAK1_STRAW      --
DNAK_STRCO       --
DNAK_THEFY       --
DNAK_CUTAK       --
DNAK_HALMA       --
DNAK_NATPD       --
DNAK_HALSA       --
DNAK_AGRFC       --
DNAK_RHIME       --
DNAK_RHILO       --
DNAK_BRUME       --
DNAK_BRUAB       --
DNAK_BRUSU       --
DNAK_BARHE       --
DNAK_BARQU       --
DNAK_BRADU       --
DNAK_NITWN       --
DNAK_RHOPA       --
DNAK_CAUVC       --
DNAK_ZYMMO       --
DNAK_RHOS4       --
DNAK_RUEPO       --
DNAK_RICFE       --
DNAK_RICTY       --
DNAK_RICPR       --
DNAK_RICCN       --
DNAK_PELUB       --
DNAK_EHRRG       --
DNAK_EHRRW       --
DNAK_EHRCJ       --
DNAK_ANAMM       --
DNAK_WOLPM       --
DNAK_WOLTR       --
DNAK_BORBR       --
DNAK_BORPE       --
DNAK_BORPA       --
DNAK_BURPS       --
DNAK_BURMA       --
DNAK_BURP1       --
DNAK_BURL3       --
DNAK_RALSO       --
DNAK_CUPPJ       --
DNAK_AROAE       --
DNAK_THIDA       --
DNAK_DECAR       --
DNAK_NITEU       --
DNAK_NEIMA       --
DNAK_NEIG1       --
DNAK_NEIMB       --
DNAK_CHRVO       --
DNAK_BUCAI       --
DNAK_BUCAP       --
DNAK_BUCBP       --
DNAK_BLOFL       --
DNAK_BLOPB       --
DNAK_WIGBR       --
DNAK_ECOLI       --
DNAK_ECOL6       --
DNAK_ECO57       --
DNAK_SHIBS       --
DNAK_SHIDS       --
DNAK_SHISS       --
DNAK_SHIFL       --
DNAK_SALTI       --
DNAK_SALPA       --
DNAK_SALTY       --
DNAK_SALCH       --
DNAK_YERPE       --
DNAK_YERPS       --
DNAK_PHOLL       --
DNAK_PECAS       --
DNAK_PASMU       --
DNAK_MANSM       --
DNAK_HAEIN       --
DNAK_HAEI8       --
DNAK_HAEDU       --
DNAK2_COLP3      --
DNAK_PSEHT       --
DNAK_SHEON       --
DNAK_VIBVU       --
DNAK_VIBVY       --
DNAK_VIBPA       --
DNAK_VIBCH       --
DNAK1_ALIF1      --
DNAK2_ALIF1      --
DNAK1_PHOPR      --
DNAK2_PHOPR      --
DNAK_IDILO       --
DNAK_XANAC       --
DNAK_XANC5       --
DNAK_XANCP       --
DNAK_XANC8       --
DNAK_XANOR       --
DNAK_XYLFA       --
DNAK_XYLFT       --
DNAK_PSEPK       --
DNAK_PSEPF       --
DNAK_PSE14       --
DNAK_PSEU2       --
DNAK_PSESM       --
DNAK_PSEF5       --
DNAK_PSEAE       --
DNAK_ACIAD       --
DNAK_PSYA2       --
DNAK_FRATT       --
DNAK_LEGPH       --
DNAK_LEGPL       --
DNAK_LEGPA       --
DNAK_COXBU       --
DNAK_METCA       --
DNAK_NITOC       --
DNAK1_COLP3      --
DNAK_DESAG       --
DNAK_DESVH       --
DNAK_GEOSL       --
DNAK_PELCD       --
DNAK_DESPS       --
DNAK_CAMJE       --
DNAK_CAMJR       --
DNAK_HELHP       --
DNAK_WOLSU       --
DNAK_HELPY       --
DNAK_HELPJ       --
DNAK_FUSNN       --
DNAK_RHOBA       --
DNAK_BACFN       --
DNAK_BACFR       --
DNAK_BACTN       --
DNAK_PORGI       --
DNAK_CHLTE       --
DNAK_CHLCH       --
DNAK_BORBU       --
DNAK_BORBP       --
DNAK_TREPA       --
DNAK_TREDE       --
DNAK_LEPIC       --
DNAK_LEPIN       --
DNAK_BDEBA       --
DNAK_CHLAB       --
DNAK_CHLCV       --
DNAK_CHLPN       --
DNAK_CHLTR       --
DNAK_CHLTA       --
DNAK_CHLMU       --
DNAK_PARUW       --
DNAK_DEHM1       --
DNAK_DEHMC       --
DNAK_CLOPE       --
DNAK_CLOTE       --
DNAK_CLOAB       --
DNAK_METAC       --
DNAK_METMA       --
DNAK_METBF       --
DNAK_CALS4       --
DNAK_CARHZ       --
DNAK_SYMTH       --
DNAK_AQUAE       --
DNAK_THEMA       --
DNAK_THEAC       --
DNAK_THEVO       --
DNAK_PICTO       --
DNAK_METTH       --
DNAK3_NOSS1      --
DNAK1_THEEB      --
DNAK3_SYNP6      --
DNAK1_NOSS1      WL
DNAK3_SYNY3      WF
DNAK3_THEEB      W-
DNAK1_SYNP6      WF
DNAK1_PROMM      --
DNAK1_SYNPX      --
DNAK1_PROMA      --
DNAK1_PROMP      --
DNAK_THET8       --
DNAK_THET2       --
DNAK_DEIRA       --
DNAK2_NOSS1      --
DNAK2_SYNY3      --
DNAK2_THEEB      --
DNAK2_PROMA      --
DNAK_PROMT       --
DNAK2_PROMP      --
DNAK2_PROMM      --
DNAK2_SYNPX      --
DNAK2_SYNP6      --
DNAK_GLOVI       --
DNAK2_STRAW      --