CLUSTAL format seed alignment for MF_00335

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RNY_UREPA       -------------------------MGYLIAFIILLILFVLLITIVPVVMVVYLK-----
RNY_UREP2       -------------------------MGYLIAFIILLILFVLLITIVPVVMVVYLK-----
RNY_MYCPE       ------------------------MQQNTVTLILVGVIIFLFISLFFYVIYSFVQ-----
RNY_MYCCT       ----------------------------MNDDIIILLSVFCGIFFICFIICSSIAL----
RNY_MYCMS       ----------------------------MNDDIIILLSVFCGIFFICFIICSSIAL----
RNY_MESFL       ------------------------------MGIIIGLIIVS----VALIISLCSLL----
RNY_CAMJR       -----------------------------MIESLIALIAAIVGLGIGYLVAKKIND----
RNY_CAMJJ       -----------------------------MIESLIALIAAIVGLGIGYLVAKKIND----
RNY_CAMJE       -----------------------------MIESLIALIAAIVGLGIGYLVAKKIND----
RNY_CAMJ8       -----------------------------MIESLIALIAAIVGLGIGYLVAKKIND----
RNY_CAMJD       -----------------------------MIESLIALIAAIVGLGIGYLVAKKIND----
RNY_CAMC1       -----------------------------MIEVLIGLGAGVVGVGAGYLYAKKIND----
RNY_CAMC5       -----------------------------MIEVLIGLGAGVAGVGAGYLYAKKIND----
RNY_CAMFF       -----------------------------MIEVVVGIGAGLIGIGAGYLVAKKIND----
RNY_CAMHC       -----------------------------MIEFLIGLIAAVVGILVGYLIARKINN----
RNY_NITSB       ----------------------------MWVEILVGSSAAIISGAAGYLLSKKIEK----
RNY_SULDN       ----------------------------MLNEILSGSSAAVISGLVGFYISKKITN----
RNY_HELHP       ---------------------------MGVWYAIGSIIFGLLVGVSVYLISRKIFH----
RNY_WOLSU       ---------------------------MIEWTILSSLASALLAGGGTYLVYKKVSN----
RNY_SULNB       --------------------------MIGTIAGVSGIAGAAVGAGACYLWLKNSTQ----
RNY_ARCB4       -----------------------------MEDLIVAIVVGAFSSAISIFVVRKLDR----
RNY_HELPY       ------------------------MSSGLIYISLEVLVACLITALVMYYVMKKIYY----
RNY_HELPH       ------------------------MSSGLIYISLEVLVACLITALIMYYVMKKIYY----
RNY_HELPJ       ------------------------MSSGLIYISLEVLVACLITALIMYYVMKKIYY----
RNY_HELAH       ------------------------MGNGLIYISLEVIVACLISALAMYYVMKKIYY----
RNY_BORBU       -------------------------------MIYIIFSSIFAGFILGFLVRVFLGR----
RNY_BORAP       --------------------------------MYIIFSSIFAGFILGFLIRVFLGR----
RNY_BORBP       -------------------------------MIYIIFSSIFAGFILGFLVRVFLGR----
RNY_TREPA       ----------------------------MTTSIVIGVVLVTVGLTFGWTIRWLYAR----
RNY_TREDE       ------------------------------MNWILYVILPAVCIILGWTIRWLYAR----
RNY_UNCTG       -----------------------------MGNITVIVITAFVASIVGYILRLIYAK----
RNY_GEOMG       -------------------------MKIEI-AIVLILAAAGLGYFVGNMLRKRISD----
RNY_GEOSL       -------------------------MKIEL-AIIFIVLAAGAGFLIGNLLRKKLSD----
RNY_GEOUR       -------------------------MKIDMMTMILAVIAAAIGFLIGNLLRKKSSD----
RNY_PELPD       -------------------------MQVSIWMLVITVLAAVAAYFAGSRVNKKDSG----
RNY_PELCD       -------------------------MSIEI-QWIGIGAAFLVGAIGGALVRRKVAA----
RNY_SYNFM       --------------------------MGYVSGILLVLIGLLAGVGLGVLLRQYWLE----
RNY_SYNAS       -------------------------MLNYTVIAFIMLGLIAIGLAIGYFLKFRLSQ----
RNY_DESPS       -------------------------MFFIEHPFVYLGLDLIVGCLIGFFLRKQLVE----
RNY_DESVH       ---------------------------MGLMIFAYIAIGAVLGAGTGYLLHRYVSA----
RNY_DESVV       ---------------------------MGLMIFAYIAIGAVLGAGTGYLLHRYVSA----
RNY_DESAG       ---------------------------MGLIEIVLLLVGMAVGAATGFILHKIVSA----
RNY_LAWIP       ---------------------------MSFILVLCTVSSLFVGGGTGIFLYKKVSK----
RNY_CLOB1       --------------------------MGPTKYIIIAVVIIIICVILGLYIVDKKAK----
RNY_CLOBH       --------------------------MGPTKYIIIAVVIIIICVILGLYIVDKKAK----
RNY_CLOBM       --------------------------MGPTKYIIIAVVIIIICVILGLYVVDKKAK----
RNY_CLOBL       --------------------------MGPTKYIIIAVVIIIICVILGLYVVDKKAK----
RNY_CLOBK       --------------------------MGPTKYIIIAVVIIIICVILGLYVVDKKAK----
RNY_CLOK5       -------------------------MNYMIIYEIIAGILIVVAILIHFNIMKNKVA----
RNY_CLONN       -----------------------------------MIITILIAIFVIIYVRKNISQ----
RNY_CLOTE       --MTLSKLLYLSAIDYLNTKSKGGAHLNLTYYIVATIIIAVIAVYVDYYIRKNVSA----
RNY_CLOAB       -------------------------MNNTNKLIITIVCLVIIITIVEMYIRRKYAW----
RNY_CLOPE       ----------------------------MVVGILIGIIILGVVGFIQYTLIQKASK----
RNY_CLOP1       ----------------------------MVVGILIGIIILGVVGFIQYTLIQKASK----
RNY_CLOPS       ----------------------------MVVGILIGIIILGVVGFIQYTLIEKASK----
RNY_CLOB8       --------------------------MVTAVMILIDVIVLLILGIVVYKTIQNISK----
RNY_THEP3       -------------------------------MIITALIAIAVGFLIGYLARKIIAE----
RNY_THEPX       -------------------------------MIITALIAIAVGFLIGYLARKIIAE----
RNY_CALS4       ----------------MNHLLRRCRSISYVGLIITALIAILIGFLAGFLARKVIAE----
RNY_NATTJ       ----------------------------------------------------MIAE----
RNY_ALKMQ       ------------------------------------------------------------
RNY_ALKOO       ------------------------MPNTLVLNGLLILVGILIGCLVGYFFRKNIAE----
RNY_CLOD6       --------------------------MDVIDSVVMIVIGAAVGIIAGYFVRKNISE----
RNY_DESRM       ---------------------------MEFQIILVVIISALVGLVIGFFIRKNIAE----
RNY_PELTS       -----------------------------------------MAFCAGYFLRKYLAE----
RNY_DESAP       --------------------------MLENTAIIIAITTGFVAFIGGYFLRKLLGE----
RNY_CARHZ       --------------------------MNLITDIIIAVAGVGVGVAAGYVIRKNIAE----
RNY_DESHY       ---------------MCLGGENYLELTELIFIVVAVVVSLFVGGFIGWLIRKSAAE----
RNY_HELMI       ---------------------------MEWIIAGLLAVIAFVGGI---FYRKSIAE----
RNY_MOOTA       -----------------------------------MLIAFLVGGAGGYAIRKYLAE----
RNY_LACP7       -----------------------MLIKIVIACVITAIIVALIAWKSAISYYKKVVE----
RNY_HUNT2       ---------------MCAIAYLGGLLTGIVIAIIASIIASVISYRKGIEFRKKKAE----
RNY_CALS8       -------------------MQKISDTLKLIITAGVSIALAIVAFFLGYLYRKKIAE----
RNY_SYMTH       ----------------------MKAILYVIVAVIALILGGAAGVAGGYYWFERESR----
RNY_SYNWW       ------------------------MIEIDLTSFVIITLSLAVGLTGGYYGRRFLAE----
RNY_FINM2       --------------------------MSTTTSLIIAILAGILGIVIGFFFRKSLAE----
RNY_FUSNN       -------------------------------MALIFAVFFKKIVIDRQIEKLNDLE----
RNY_ROSCS       MFEPVATARQRAVACCTFTTEQEDVVQWLVWALPALVIGLAIGAGIGILIYKNSVQ----
RNY_ROSS1       MFEPVATARHWAVACCTFTIEQEDVVQWLIWALPALVIGLAIGAGIGILIYKKSVQ----
RNY_CHLAA       -------------------------MTELLWAVVALLAGLAGGAGIGVYWANNGVS----
RNY_DEHMB       --------MFEFFMETAPATTTGLPLSAILAIFFSFIIGIVFGGMALFVFRGFIMN----
RNY_DEHMC       --------MFEFFMETAPATTTGLPLSAILAIFFSFIIGIVFGGMALFVFRGFIMN----
RNY_DEHM1       --------MLEFFMETAPTTTTGLPLSAILAIFFSFIIGIVFGGMALFVFRGFIMN----
RNY_DEIRA       ----------------------MPTLYVILSLLLGLIGGVLVQRAIGSRQQAVTDD----
RNY_DEIGD       ----------------------MNMLYFVLALLVGLAGGFFVGQARGRQQRATLDD----
RNY_THET2       ----------------------MSLLDLVLLLLVLGLGGVLLLRRKGEDRSAQEAR----
RNY_THET8       ----------------------MSLLDLVLLLLVLGLGGVLLLRRKGEDRSAQEAR----
RNY_SALAI       ----------------------MSGFDAVLLVAVLLLALIVLGAVLVGVRAVRGIA----
RNY_SALTO       ----------------------MNGFDAVLLVAVLLLTVVVVGAVLVGVRAVRGLA----
RNY_ACIC1       -----------------------------MPVLIATVGVVAVAALVIAIFVVIKFG----
RNY_FRASN       ------------------------------MVADLRREARDVEEEVERIRRRAEQD----
RNY_THEFY       ----------------------MDGVADLVVIALLGALTLLTAGHVLALRSRSRAV----
RNY_CUTAK       -----------------------------MLIALIAVSVLAVAAIIGSLADRRAIG----
RNY_RHOBA       --------------------------MNPQLASTILYCLFFFFLGIAAVLAFIQRQ----
RNY_OPITP       --------------------MSAADFAFLIAESDLFDWSLTVALVIGGALGFLVVW----
RNY_RUBXD       --------------------------MSVLWMVLGLAIGIAVGAAAGYIVCRSRTD----
RNY_PARUW       -----------------------MIENQVPFYLLIFLVGIGLGVLTFWAYHRFALG----
RNY_STAA2       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAA1       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAAE       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAAT       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAA8       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAAB       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAAC       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAAR       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAAS       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAAM       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAAW       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAAN       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAA3       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAA9       ---------------------------MNLLSLLLILLGIILGVVGGYVVARNLLL----
RNY_STAES       ---------------------------MNLLSLLLILLGIILGVVVGYIVARNLLH----
RNY_STAEQ       ---------------------------MNLLSLLLILLGIILGVVVGYIVARNLLH----
RNY_STAHJ       ---------------------------MNLLNLLLILLGIILGVVVGYFVARNLLH----
RNY_STAS1       ---------------------------MNLLGLLLILLGIILGVVVGYIVARNLLH----
RNY_BACHD       ------------------------MEFNVLFIS-ILLVVSAVSAVVGYLVRKSIAE----
RNY_BACSK       ---------------------MPSYTLSLLVLCLIVLAFSVVFAVVGYLVRKSVAE----
RNY_EXIS2       --------------------------MGTTTWIVILLLAILIAFIVGYFLRKSIAE----
RNY_BACSU       --------------------------MTPIMMVLISILLILLGLVVGYFVRKTIAE----
RNY_BACVZ       --------------------------MTP-MTVLISILLTLLGLVVGYYVRKTIAE----
RNY_BACLD       --------------------------MSP-LAILISILLSLFCLVVGYYVRKIIAE----
RNY_BACP2       --------------------------MSPTMFTIISILLSLICLVVGYFVRKTIAE----
RNY_BACAN       --------------------------MSSTVWILISILLATVGAVVGFFVRKSIAE----
RNY_BACAH       --------------------------MSSTVWILISILLATVGAVVGFFVRKSIAE----
RNY_BACHK       --------------------------MSSTVWILISILLATVGAVVGFFVRKSIAE----
RNY_BACCZ       --------------------------MSSTVWILISILLATVGAVVGFFVRKSIAE----
RNY_BACC1       --------------------------MSSTVWILISILLATVGAVVGFFVRKSIAE----
RNY_BACCR       --------------------------MTSTVWILISILLATVGAVVGFFVRKSIAE----
RNY_BACMK       -------------------------MSSSTVWILISILLATVGAVVGFFVRKSIAE----
RNY_BACCN       --------------------------MSNTVWILISILLATVGAVVGFFVRKSIAE----
RNY_GEOKA       ----------------------------MGSIIISALLALVIGAVVGFFVRKSIAE----
RNY_GEOTN       ----------------------------MGSIIISALLALVIGAVVGFFVRKSIAE----
RNY_LYSSC       ---------------------------MDGITIISALLGLIVGAAVSYIYMKKVND----
RNY_OCEIH       --------------------------MDIVIVVISILLALIVGIVVGYLVRRSIAE----
RNY_LISIN       --------------------------MTIAITIISSLLFLIVGLVVGSLIFKSSTE----
RNY_LISMO       --------------------------MTIAITIISSLLFLIVGLVVGSLIFKSSTE----
RNY_LISMF       --------------------------MTIAITIISSLLFLIVGLVVGSLIFKSSTE----
RNY_LISW6       --------------------------MTIAITIISSLLFLIVGLVVGSLIFKSSTE----
RNY_LACPL       ---------------------------MNVFGIILAVIAIVVGYGIGYYVRKNVHE----
RNY1_LACBA      ---------------------------MSVPIVILAIIAIVVGVVGGYYLRKSVHE----
RNY1_PEDPA      ---------------------------MIILYIILAIIAIVVGYCAGFFMHKRLIE----
RNY_LACP3       -----------------------MSSVTLVSITLAAVIALAVGLLIGFALQKKLHQ----
RNY_LACSS       ------------------------MNLDLLLI-LTAVIMLIVGFAVGAILQKKAHE----
RNY_ENTFA       ----------------------------MVLNILLAIVGLIVGLGLGFVIAKSRHD----
RNY_LACS1       -------------------------MIIAITILAIAIATLVIGFALGVAYRKRSYE----
RNY_LEUCK       ----------------------------MAVTIISALFAIVIGIGVGYYLHLSSDK----
RNY_LEUMM       ----------------------------MVVTIISVFFAIVIGLGIGYYVRKSQDA----
RNY_LACLM       -------------------------MDIISIVLLVLLVVLVVAFIFYAQNIKKNKQD---
RNY_LACLS       -------------------------MDIISIVLLVLLVVLVVAFIFCAQNIKKNKQD---
RNY_LACLA       -------------------------MDIISIVLLVLLVVLVVAFIFYAQNIKKNKQD---
RNY_STRA3       -------------------------MFNIILAMVCALIGLIIGYVAISMKMKSSKEA---
RNY_STRA1       -------------------------MFNIILAMVCALIGLIIGYVAISMKMKSSKEA---
RNY_STRA5       -------------------------MFNIILAMVCALIGLIIGYVAISMKMKSSKEA---
RNY_STRPM       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRPF       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRPG       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRPB       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRPC       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRP3       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRP6       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRP1       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRP8       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRPD       -------------------------MVNIILLIVSALIGLILGYALISIRLKSAKEA---
RNY_STRMU       -------------------------MLNILLTLVFSLIGLVIGYAVISARLKKAKET---
RNY_STRT2       -------------------------MINMIILVVFALIGLVVGYSAISIKLSKAKEQ---
RNY_STRT1       -------------------------MINMIILVVFALIGLVVGYSAISIKLSKAKEQ---
RNY_STRTD       ----------------------------MIILVVFALIGLVVGYLAISIKLSKAKEQ---
RNY_STRPN       --------------------------MSLAIAVFAVIIGLVIGYVSISAKMKSSQEA---
RNY_STRR6       --------------------------MSLAIAVFAVIIGLVIGYVSISAKMKSSQEA---
RNY_STRPI       -----------------------MEIMSLAIAVFAVIIGLVIGYVSISAKMKSSQEA---
RNY_STRP2       -----------------------MEIMSLAIAVFAVIIGLVIGYVSISAKMKSSQEA---
RNY_STRGC       -------------------------MEMIFALVFAVIIGLVIGYVSISARMKSSKEA---
RNY_STRSV       -----------------------MDLFPIIMSVFAAIIGLVIGYVSVSAKMKSSKEA---
RNY_STRSY       -----------------------MNIITVVVTLVSALIGLVLGYFAISLKMKSAKET---
RNY_STRS2       -----------------------MNIITVVVTLVSALIGLVLGYFAISLKMKSAKET---
RNY_LACAC       --------------------MNTIIMIPVATA----IVSLLVGTVTGYAIRKHSWE----
RNY_LACH4       --------------------MDTIIMIPVATA----IVSLLVGTVIGYAIRKHSWE----
RNY_LACDA       --------------------MMNNTVFPLATVAVIFLISLVVGCLIGYAIRKNVWE----
RNY_LACDB       --------------------MMNNTVFPLATVAVIFLISLVVGCLIGYAIRKNVWE----
RNY_LACGA       --------------------MINTILVPVAVA----IVSVLVGGCAGYSLRKNKWE----
RNY_LACJO       --------------------MVNTILVPVAVA----IVSVLVGGCAGYSIRKNKWE----
RNY_AYWBP       -------------------MKDASWRDHCTMGCSLFFLALICGSIIGYFLYSFFNQ----
RNY_ONYPE       -------------------MKGDYWRTHCIMDCSLLVFALICGSIIGYFLYSFFNQ----
RNY_ACHLI       --------------------MFNVDTPALITFILLIVVGALGGALVGYFIRVAQHE----
RNY_MAGMM       ------------------------------MDILLLMVGLLLGAGGVFVMLRNQSN----
RNY_THEMA       -------------------------------MMLWYIVAGAGGLLIGYLI----------
RNY_THESQ       --------------------------------MLWYIVAGAGGLLIGYLI----------
RNY_THEP1       --------------------------------MLWYIVAGAGGLLIGYLI----------
RNY_PSELT       ------------------------------MIILVAVVTAVISFGLGYVV----------
RNY_FERNB       --------------------------MEWLIYIVILFVGIAAGAFFGISVGRK-------
RNY_THEM4       -----------------------------MLIYILSGLGVLVGALLGYVV----------
RNY_PETMO       --------------------------MEILVYIIIGIAIFILSLLVGINIGNRR------
RNY_AQUAE       ---------------------------MDVLSILLILVAVGVGIFVGRQFLGQKQAPAPT
RNY_BACFR       ----------------------------MLVTIVASIACFIVGGILSYVLFKYGL-----
RNY_BACFN       ----------------------------MLVTIVASIACFIVGGILSYVLFKYGL-----
RNY_BACTN       ----------------------------MIAIIATAIACFVVGGILSYVLFRYVL-----
RNY_BACV8       ----------------------------MITTVIIAIVCFAVGGGLSYMLFRYGL-----
RNY_PARD8       ---------------------------MVGMYIIIPIVTFIIGGLLAWLGMRFLL-----
RNY_PORGI       --------------------------MGIGTLLLFTFLGLVAGATAVWLITRTLL-----
RNY_CYTH3       ------------------------MSELIMYILATAVVSIGVGIVAGKAIFQKDFS----
RNY_FLAJ1       --------------------------MDIITIIIGIV-GIAAGFAIAKIIEKSNIS----
RNY_FLAPJ       --------------------------MDIITIIIAVIAGIGGGFGISKFLEKSGVS----
RNY_GRAFK       --------------------------MEILIIVIAAVVGLALGFAIAKMLEKKQAS----
RNY_PELLD       ---------------------MGIV-INLFLIIFASVVFFAAGFFLGRFFLERLGT----
RNY_CHLPM       ---------------------MGIV-INLFLLVPASIVFFAAGFFLGRFFLERLGT----
RNY_CHLPD       ---------------------MGIFFISLVLIVLASVVFFVGGFFLGRYFLERIGT----
RNY_CHLCH       ---------------------MGIV-INLLLLVLAALVAFVAGFFIGRYFLERIGT----
RNY_CHLTE       ---------------------MGIV-INLFLIIAASIVFFVVGFYIGRFFLERIGT----
RNY1_BDEBA      -----------------------------MEIVISAIIGLLIGGTVVFVIKRLQDN----
RNY2_BDEBA      ----------------------------MIAMIATAIIGIVAGGGLGWALHKFFRA----
RNY2_LACBA      -----------------------------MLITGLIIGCLLIGLVIGYVVRQHQHR----
RNY2_PEDPA      ------------------------------MATILIVVLLLASIGVGYGLRAKKHS----
RNY_MYCGE       --------------------------MNNNIT-NSIAQLFFNTSFFAFLFL---------
RNY_MYCPN       --------------------------MSAKLTLESIAKTFAETSIFAILFL---------
                                                                            

RNY_UREPA       ------------------------------------------------------------
RNY_UREP2       ------------------------------------------------------------
RNY_MYCPE       ------------------------------------------------------------
RNY_MYCCT       -------------------YLWKSKS----------------------------------
RNY_MYCMS       -------------------YLWKSKS----------------------------------
RNY_MESFL       -------------------YILTSKS----------------------------------
RNY_CAMJR       ------------------AKYEIFVE----------------------------------
RNY_CAMJJ       ------------------AKYEIFVE----------------------------------
RNY_CAMJE       ------------------AKYEIFVE----------------------------------
RNY_CAMJ8       ------------------AKYEIFVE----------------------------------
RNY_CAMJD       ------------------AKYEIFVE----------------------------------
RNY_CAMC1       ------------------ANYNIFLE----------------------------------
RNY_CAMC5       ------------------ANYNIFLE----------------------------------
RNY_CAMFF       ------------------ANYSIFLE----------------------------------
RNY_CAMHC       ------------------ANYEIFLE----------------------------------
RNY_NITSB       ------------------DKLKIYEE----------------------------------
RNY_SULDN       ------------------ANFDIYVE----------------------------------
RNY_HELHP       ------------------SNSQIIIE----------------------------------
RNY_WOLSU       ------------------ANYKIHLE----------------------------------
RNY_SULNB       ------------------KKFAHLEM----------------------------------
RNY_ARCB4       ------------------AKFEVFIE----------------------------------
RNY_HELPY       ------------------ARGQATLK----------------------------------
RNY_HELPH       ------------------ARGQAALK----------------------------------
RNY_HELPJ       ------------------ARGQAILK----------------------------------
RNY_HELAH       ------------------ARGQAVLK----------------------------------
RNY_BORBU       ------------------LSLLDLEK----------------------------------
RNY_BORAP       ------------------LSLLDLEK----------------------------------
RNY_BORBP       ------------------LSLLDLEK----------------------------------
RNY_TREPA       ------------------FHLSACEQ----------------------------------
RNY_TREDE       ------------------FQLSASEQ----------------------------------
RNY_UNCTG       ------------------LNIRSVEQ----------------------------------
RNY_GEOMG       ------------------TLVSKAEE----------------------------------
RNY_GEOSL       ------------------SLVSKAEE----------------------------------
RNY_GEOUR       ------------------AIVASAEE----------------------------------
RNY_PELPD       ------------------LIVKQSEE----------------------------------
RNY_PELCD       ------------------TQLAEAKR----------------------------------
RNY_SYNFM       ------------------KRNRQLQE----------------------------------
RNY_SYNAS       ------------------KRLESSEN----------------------------------
RNY_DESPS       ------------------RQQQNIQA----------------------------------
RNY_DESVH       ------------------KRIGDANE----------------------------------
RNY_DESVV       ------------------KRIGDANE----------------------------------
RNY_DESAG       ------------------KRLQDARE----------------------------------
RNY_LAWIP       ------------------KYIGDAKE----------------------------------
RNY_CLOB1       ------------------EKLSEASK----------------------------------
RNY_CLOBH       ------------------EKLSEASK----------------------------------
RNY_CLOBM       ------------------EKLSEASK----------------------------------
RNY_CLOBL       ------------------EKLSEASK----------------------------------
RNY_CLOBK       ------------------EKLSEASK----------------------------------
RNY_CLOK5       ------------------AIKSQTIY----------------------------------
RNY_CLONN       ------------------AKIAEAEA----------------------------------
RNY_CLOTE       ------------------AKISNAEE----------------------------------
RNY_CLOAB       ------------------AKISKAEE----------------------------------
RNY_CLOPE       ------------------NRVESLEK----------------------------------
RNY_CLOP1       ------------------NRVESLEK----------------------------------
RNY_CLOPS       ------------------NRVESLEK----------------------------------
RNY_CLOB8       ------------------AKIESLEK----------------------------------
RNY_THEP3       ------------------SKIKSAEN----------------------------------
RNY_THEPX       ------------------SKIKSAEN----------------------------------
RNY_CALS4       ------------------SKIKSAEN----------------------------------
RNY_NATTJ       ------------------AKITSAEE----------------------------------
RNY_ALKMQ       ------------------------------------------------------------
RNY_ALKOO       ------------------GKISNAED----------------------------------
RNY_CLOD6       ------------------AKIGQAEN----------------------------------
RNY_DESRM       ------------------GKITSAEA----------------------------------
RNY_PELTS       ------------------AKIASAEA----------------------------------
RNY_DESAP       ------------------MKITSAEE----------------------------------
RNY_CARHZ       ------------------AAIGSAEA----------------------------------
RNY_DESHY       ------------------KLIGSAEE----------------------------------
RNY_HELMI       ------------------GKIGSAED----------------------------------
RNY_MOOTA       ------------------AKIASAEK----------------------------------
RNY_LACP7       ------------------GKIGSADE----------------------------------
RNY_HUNT2       ------------------AKIGSAEQ----------------------------------
RNY_CALS8       ------------------KTIKSAEQ----------------------------------
RNY_SYMTH       ------------------KKLNSAEA----------------------------------
RNY_SYNWW       ------------------SRIRTAEE----------------------------------
RNY_FINM2       ------------------KKIRSAED----------------------------------
RNY_FUSNN       ------------------DEVEKAKL----------------------------------
RNY_ROSCS       ------------------SQIRQIEA----------------------------------
RNY_ROSS1       ------------------SQIRQIEA----------------------------------
RNY_CHLAA       ------------------SLVQRKAA----------------------------------
RNY_DEHMB       ------------------RQLRIAQR----------------------------------
RNY_DEHMC       ------------------RQLRIAQR----------------------------------
RNY_DEHM1       ------------------RQLRIAQR----------------------------------
RNY_DEIRA       ------------------RLQREAQAEAQQIRAEAQRHARELHEAAEQDRQDAISKTQDA
RNY_DEIGD       ------------------QLQREARAEAERIRTQADAEARQLREQAEQ-------RLQDA
RNY_THET2       ------------------ELLEAARREAREVLEAARKEARDILEAARHEAKALRQEAEAR
RNY_THET8       ------------------ELLEAARREAREVLEAARKEARDILEAARQEAKALRQEAEAR
RNY_SALAI       ------------------GAPRPEDPAFIAEKDRQEQSLAALRSAADEANSTVDAAKSAA
RNY_SALTO       ------------------GTSRPDDPAFIAEKDRQEQSLAALRSAAEEANSTIDAAKSAA
RNY_ACIC1       ------------------RAPR--------------------------------------
RNY_FRASN       ------------------AAEQTERVRREAEQIR--------------------------
RNY_THEFY       ------------------AAQA--------------------------------------
RNY_CUTAK       ------------------RRAERAESERDVKALELSRS----------------------
RNY_RHOBA       ------------------AVKRRER-----------------------------------
RNY_OPITP       ------------------AFTRHTRR----------------------------------
RNY_RUBXD       ------------------RRLAETRA----------------------------------
RNY_PARUW       ------------------GFKRISKD----------------------------------
RNY_STAA2       ------------------QKQSQARQ----------------------------------
RNY_STAA1       ------------------QKQSQARQ----------------------------------
RNY_STAAE       ------------------QKQSQARQ----------------------------------
RNY_STAAT       ------------------QKQSQARQ----------------------------------
RNY_STAA8       ------------------QKQSQARQ----------------------------------
RNY_STAAB       ------------------QKQSQARQ----------------------------------
RNY_STAAC       ------------------QKQSQARQ----------------------------------
RNY_STAAR       ------------------QKQSQARQ----------------------------------
RNY_STAAS       ------------------QKQSQARQ----------------------------------
RNY_STAAM       ------------------QKQSQARQ----------------------------------
RNY_STAAW       ------------------QKQSQARQ----------------------------------
RNY_STAAN       ------------------QKQSQARQ----------------------------------
RNY_STAA3       ------------------QKQSQARQ----------------------------------
RNY_STAA9       ------------------QKQSQARQ----------------------------------
RNY_STAES       ------------------QKQVQARQ----------------------------------
RNY_STAEQ       ------------------QKQVQARQ----------------------------------
RNY_STAHJ       ------------------QKQLQARQ----------------------------------
RNY_STAS1       ------------------QKQLQAGQ----------------------------------
RNY_BACHD       ------------------AKISSAEH----------------------------------
RNY_BACSK       ------------------AKISSAEH----------------------------------
RNY_EXIS2       ------------------AKIQGAET----------------------------------
RNY_BACSU       ------------------AKIAGARG----------------------------------
RNY_BACVZ       ------------------AKIAGARG----------------------------------
RNY_BACLD       ------------------AKISGARN----------------------------------
RNY_BACP2       ------------------AKISGARN----------------------------------
RNY_BACAN       ------------------AKINGAAN----------------------------------
RNY_BACAH       ------------------AKINGAAN----------------------------------
RNY_BACHK       ------------------AKINGAAN----------------------------------
RNY_BACCZ       ------------------AKINGAAN----------------------------------
RNY_BACC1       ------------------AKINGAAN----------------------------------
RNY_BACCR       ------------------AKINGAAN----------------------------------
RNY_BACMK       ------------------AKINGAAN----------------------------------
RNY_BACCN       ------------------AKINGAAN----------------------------------
RNY_GEOKA       ------------------AKIGGAKA----------------------------------
RNY_GEOTN       ------------------AKIGGAKA----------------------------------
RNY_LYSSC       ------------------SKITGAKH----------------------------------
RNY_OCEIH       ------------------AKISSAER----------------------------------
RNY_LISIN       ------------------KKLAAARG----------------------------------
RNY_LISMO       ------------------KKLAAARG----------------------------------
RNY_LISMF       ------------------KKLAAARG----------------------------------
RNY_LISW6       ------------------KKLAAARG----------------------------------
RNY_LACPL       ------------------KELDVARN----------------------------------
RNY1_LACBA      ------------------RKLDAAKY----------------------------------
RNY1_PEDPA      ------------------KQTANASN----------------------------------
RNY_LACP3       ------------------NNLDRATQ----------------------------------
RNY_LACSS       ------------------REIDGANK----------------------------------
RNY_ENTFA       ------------------KAINGAKI----------------------------------
RNY_LACS1       ------------------QALDVATQ----------------------------------
RNY_LEUCK       ------------------KKITSTKQ----------------------------------
RNY_LEUMM       ------------------HKVISAEQ----------------------------------
RNY_LACLM       -----AESLFNEAENKANEVMASAKR----------------------------------
RNY_LACLS       -----AESLFNEAENKANEVMASAKR----------------------------------
RNY_LACLA       -----AESLFNEAENKANEVMANAKR----------------------------------
RNY_STRA3       -----AELTLLNAEQDAVDLRGKAEI----------------------------------
RNY_STRA1       -----AELTLLNAEQDAVDLRGKAEI----------------------------------
RNY_STRA5       -----AELTLLNAEQDAVDLRGKAEI----------------------------------
RNY_STRPM       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRPF       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRPG       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRPB       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRPC       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRP3       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRP6       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRP1       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRP8       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRPD       -----AELTLLNAEQEAVDIRGKAEV----------------------------------
RNY_STRMU       -----AELTLLNAEQDAVNARSKAEM----------------------------------
RNY_STRT2       -----AETILLKAEQDAVNLRSQAEH----------------------------------
RNY_STRT1       -----AETILLKAEQDAVNLRSQAEH----------------------------------
RNY_STRTD       -----AETILLKAEQDAVNLRSQAEH----------------------------------
RNY_STRPN       -----AELMLLNAEQEATNLRGQAER----------------------------------
RNY_STRR6       -----AELMLLNAEQEATNLRGQAER----------------------------------
RNY_STRPI       -----AELMLLNAEQEATNLRGQAER----------------------------------
RNY_STRP2       -----AELMLLNAEQEATNLRGQAER----------------------------------
RNY_STRGC       -----AELTLLNAEQEATNLRGQAER----------------------------------
RNY_STRSV       -----AELTLLNAEQEATNLRGQAER----------------------------------
RNY_STRSY       -----AELTLLNAEQEASNVRGRAEE----------------------------------
RNY_STRS2       -----AELTLLNAEQEASNVRGRAEE----------------------------------
RNY_LACAC       ------------------QKAQNAQN----------------------------------
RNY_LACH4       ------------------QKVQNAQN----------------------------------
RNY_LACDA       ------------------TRAENARQ----------------------------------
RNY_LACDB       ------------------TRAENARQ----------------------------------
RNY_LACGA       ------------------TQAQNAAH----------------------------------
RNY_LACJO       ------------------TQAQNAAH----------------------------------
RNY_AYWBP       ------------------KKLEEKKQ----------------------------------
RNY_ONYPE       ------------------KKLEEKKQ----------------------------------
RNY_ACHLI       ------------------KSLRLARE----------------------------------
RNY_MAGMM       ------------------QALVERDA----------------------------------
RNY_THEMA       ------------ANYQINQKLRKAKE----------------------------------
RNY_THESQ       ------------ANYQINQKLRKAKE----------------------------------
RNY_THEP1       ------------ASYQINQKLRKAKE----------------------------------
RNY_PSELT       ------------AKSRIEQKNRKAQQ----------------------------------
RNY_FERNB       -----------RAEEALEKKLKAAKE----------------------------------
RNY_THEM4       ------------AKRNIEKQLLLAKK----------------------------------
RNY_PETMO       -----MISTLATKKEELEVEIKNKQK----------------------------------
RNY_AQUAE       YQPVPSPQILEEAKSKAEEIIKEAKE----------------------------------
RNY_BACFR       ------------------------------------------------------------
RNY_BACFN       ------------------------------------------------------------
RNY_BACTN       ------------------------------------------------------------
RNY_BACV8       ------------------------------------------------------------
RNY_PARD8       ------------------------------------------------------------
RNY_PORGI       ------------------------------------------------------------
RNY_CYTH3       --------------------KQETEA----------------------------------
RNY_FLAJ1       --------------------NLIKNA----------------------------------
RNY_FLAPJ       --------------------NLIKNA----------------------------------
RNY_GRAFK       --------------------GTIASA----------------------------------
RNY_PELLD       --------------------TKVLEA----------------------------------
RNY_CHLPM       --------------------TKVLEA----------------------------------
RNY_CHLPD       --------------------TKILEA----------------------------------
RNY_CHLCH       --------------------TKVLEA----------------------------------
RNY_CHLTE       --------------------TKVLEA----------------------------------
RNY1_BDEBA      ------------------NKKKSARF----------------------------------
RNY2_BDEBA      ------------------RTLRLARE----------------------------------
RNY2_LACBA      ------------------QELLAVQK----------------------------------
RNY2_PEDPA      ------------------ETLAQARK----------------------------------
RNY_MYCGE       ------------------------------------------------------------
RNY_MYCPN       ------------------------------------------------------------
                                                                            

RNY_UREPA       ------------------------------------------------------------
RNY_UREP2       ------------------------------------------------------------
RNY_MYCPE       ------------------------------------------------------------
RNY_MYCCT       -------------------------------RKRLVE---------------------QY
RNY_MYCMS       -------------------------------RKRLVE---------------------QY
RNY_MESFL       -------------------------------QKVLNE---------------------KK
RNY_CAMJR       ------------------------------QAKAKAK---------------------AI
RNY_CAMJJ       ------------------------------QAKAKAK---------------------AI
RNY_CAMJE       ------------------------------QAKAKAK---------------------AI
RNY_CAMJ8       ------------------------------QAKAKAK---------------------AI
RNY_CAMJD       ------------------------------QAKAKAK---------------------AI
RNY_CAMC1       ------------------------------QAKAKAK---------------------AI
RNY_CAMC5       ------------------------------QAKAKAK---------------------AI
RNY_CAMFF       ------------------------------QAKAKAK---------------------AI
RNY_CAMHC       ------------------------------QAKAKAK---------------------AI
RNY_NITSB       ------------------------------QARAKAK---------------------AI
RNY_SULDN       ------------------------------KAKAQAG---------------------AI
RNY_HELHP       ------------------------------QAKAKAK---------------------AI
RNY_WOLSU       ------------------------------KAKARAR---------------------AI
RNY_SULNB       ------------------------------EAKAKAK---------------------AI
RNY_ARCB4       ------------------------------QAKAKAK---------------------VI
RNY_HELPY       ------------------------------SASAKAK---------------------LM
RNY_HELPH       ------------------------------SASAKAK---------------------LM
RNY_HELPJ       ------------------------------GASAKAK---------------------LM
RNY_HELAH       ------------------------------SASAKAK---------------------LM
RNY_BORBU       ------------------------------NLKKVRV---------------------ES
RNY_BORAP       ------------------------------NLTKVRV---------------------ES
RNY_BORBP       ------------------------------NLTKVRV---------------------ES
RNY_TREPA       ------------------------------RAERILQ---------------------EA
RNY_TREDE       ------------------------------RAERILQ---------------------EA
RNY_UNCTG       ------------------------------TSKRVIE---------------------EM
RNY_GEOMG       ------------------------------LASKIVD---------------------DA
RNY_GEOSL       ------------------------------LASRIVE---------------------DA
RNY_GEOUR       ------------------------------LAAKMVE---------------------ES
RNY_PELPD       ------------------------------LAAKMID---------------------DA
RNY_PELCD       ------------------------------MADQILS---------------------EA
RNY_SYNFM       ------------------------------QARNILT---------------------DA
RNY_SYNAS       ------------------------------LALRIID---------------------EA
RNY_DESPS       ------------------------------QSKQIIE---------------------NA
RNY_DESVH       ------------------------------LAKRIVE---------------------EA
RNY_DESVV       ------------------------------LAKRIVE---------------------EA
RNY_DESAG       ------------------------------LADRIIE---------------------EA
RNY_LAWIP       ------------------------------LAIRIVE---------------------EA
RNY_CLOB1       ------------------------------EARRLKE---------------------EA
RNY_CLOBH       ------------------------------EARRLKE---------------------EA
RNY_CLOBM       ------------------------------EARRLKE---------------------EA
RNY_CLOBL       ------------------------------EARRLKE---------------------EA
RNY_CLOBK       ------------------------------EARRLKE---------------------EA
RNY_CLOK5       ------------------------------ESNRLKE---------------------EA
RNY_CLONN       ------------------------------KSKKIII---------------------DS
RNY_CLOTE       ------------------------------KGRNIIE---------------------DA
RNY_CLOAB       ------------------------------DAKKIKE---------------------DA
RNY_CLOPE       ------------------------------EASLTLE---------------------EA
RNY_CLOP1       ------------------------------EASLTLE---------------------EA
RNY_CLOPS       ------------------------------EASLALE---------------------EA
RNY_CLOB8       ------------------------------EAEEILV---------------------RA
RNY_THEP3       ------------------------------LARTILE---------------------SA
RNY_THEPX       ------------------------------LARTILE---------------------SA
RNY_CALS4       ------------------------------LARTILE---------------------SA
RNY_NATTJ       ------------------------------AADKIIE---------------------DA
RNY_ALKMQ       ------------------------------MAKKIKD---------------------DA
RNY_ALKOO       ------------------------------LAKKIVE---------------------DA
RNY_CLOD6       ------------------------------LAKEIID---------------------KA
RNY_DESRM       ------------------------------QAKRILE---------------------EA
RNY_PELTS       ------------------------------QAKKILE---------------------EA
RNY_DESAP       ------------------------------RARLVLE---------------------EA
RNY_CARHZ       ------------------------------QAKKIID---------------------EA
RNY_DESHY       ------------------------------EAKRVID---------------------NA
RNY_HELMI       ------------------------------RARQIVD---------------------DA
RNY_MOOTA       ------------------------------AAATIIE---------------------EA
RNY_LACP7       ------------------------------KAREIID---------------------EA
RNY_HUNT2       ------------------------------EAERIIS---------------------EA
RNY_CALS8       ------------------------------EAQRIVE---------------------EA
RNY_SYMTH       ------------------------------RARHIVD---------------------EA
RNY_SYNWW       ------------------------------EVAKMLD---------------------EA
RNY_FINM2       ------------------------------YAVKIIE---------------------DA
RNY_FUSNN       ------------------------------KAKEIVE---------------------EA
RNY_ROSCS       ------------------------------EARLQLE---------------------AT
RNY_ROSS1       ------------------------------EARLQLE---------------------AT
RNY_CHLAA       ------------------------------EARLLIE---------------------EA
RNY_DEHMB       ------------------------------KATKMLA---------------------DS
RNY_DEHMC       ------------------------------KATKMLA---------------------DS
RNY_DEHM1       ------------------------------KATKMLA---------------------DS
RNY_DEIRA       ARRV-----------------QDAAERDTLAAAHEAR---------------------LD
RNY_DEIGD       ARRL-----------------QEADDRER---QVTLQ---------------------LE
RNY_THET2       AKAQ-----------------REEVEAEL-RRRLEAA---------------------EA
RNY_THET8       AKAQ-----------------REEVEAEL-RRRLEAA---------------------EA
RNY_SALAI       AAARTEAAAARAEAKAARAEARRVLDGARAEADTILE---------------------RV
RNY_SALTO       AAARTEAAAARAEAKAARAEARRVLDGARAEAEAILE---------------------RV
RNY_ACIC1       ------------------------------------------------------------
RNY_FRASN       ---------------------RHAEEAAEAIRERAVA---------------------DA
RNY_THEFY       ------------------------------------------------------------
RNY_CUTAK       --------------------QERLSRASQDLADSRKD---------------------VA
RNY_RHOBA       ---------------------------LDAEAEAVLE---------------------SA
RNY_OPITP       --------------------------MAHEQAAELEE---------------------VA
RNY_RUBXD       ------------------------------DARSIIE---------------------DA
RNY_PARUW       -----------------------------------------------------------I
RNY_STAA2       ------------------------------TAEDIVN---------------------QA
RNY_STAA1       ------------------------------TAEDIVN---------------------QA
RNY_STAAE       ------------------------------TAEDIVN---------------------QA
RNY_STAAT       ------------------------------TAEDIVN---------------------QA
RNY_STAA8       ------------------------------TAEDIVN---------------------QA
RNY_STAAB       ------------------------------TAEDIVN---------------------QA
RNY_STAAC       ------------------------------TAEDIVN---------------------QA
RNY_STAAR       ------------------------------TAEDIVN---------------------QA
RNY_STAAS       ------------------------------TAEDIVN---------------------QA
RNY_STAAM       ------------------------------TAEDIVN---------------------QA
RNY_STAAW       ------------------------------TAEDIVN---------------------QA
RNY_STAAN       ------------------------------TAEDIVN---------------------QA
RNY_STAA3       ------------------------------TAEDIVN---------------------QA
RNY_STAA9       ------------------------------TAEDIVN---------------------QA
RNY_STAES       ------------------------------TADDIVS---------------------YA
RNY_STAEQ       ------------------------------TADDIVS---------------------YA
RNY_STAHJ       ------------------------------TADDIIK---------------------QG
RNY_STAS1       ------------------------------TAEDIIE---------------------QG
RNY_BACHD       ------------------------------AAKQIVE---------------------DA
RNY_BACSK       ------------------------------AAKQMID---------------------DA
RNY_EXIS2       ------------------------------EATKIVE---------------------RA
RNY_BACSU       ------------------------------AAEQILE---------------------DA
RNY_BACVZ       ------------------------------AAEQILE---------------------DA
RNY_BACLD       ------------------------------AAEQILG---------------------DA
RNY_BACP2       ------------------------------MAEQIVE---------------------DA
RNY_BACAN       ------------------------------EAKRILD---------------------EA
RNY_BACAH       ------------------------------EAKRILD---------------------EA
RNY_BACHK       ------------------------------EAKRILD---------------------EA
RNY_BACCZ       ------------------------------EAKRILD---------------------EA
RNY_BACC1       ------------------------------EAKRILD---------------------EA
RNY_BACCR       ------------------------------EARRILD---------------------GA
RNY_BACMK       ------------------------------EAKRILD---------------------EA
RNY_BACCN       ------------------------------EAKRILD---------------------DA
RNY_GEOKA       ------------------------------AAEQLIE---------------------EA
RNY_GEOTN       ------------------------------AAEQLIE---------------------EA
RNY_LYSSC       ------------------------------VAETIVE---------------------EG
RNY_OCEIH       ------------------------------LAKQIVE---------------------EA
RNY_LISIN       ------------------------------TAELIVE---------------------DA
RNY_LISMO       ------------------------------TAELIVE---------------------DA
RNY_LISMF       ------------------------------TAELIVE---------------------DA
RNY_LISW6       ------------------------------TAELIVE---------------------DA
RNY_LACPL       ------------------------------TAEGIIS---------------------EA
RNY1_LACBA      ------------------------------TAAGVLA---------------------EA
RNY1_PEDPA      ------------------------------SADVIVE---------------------NA
RNY_LACP3       ------------------------------TAEGIIE---------------------AA
RNY_LACSS       ------------------------------TAKGIIE---------------------LA
RNY_ENTFA       ------------------------------SASSILE---------------------NA
RNY_LACS1       ------------------------------TATGIIE---------------------TA
RNY_LEUCK       ------------------------------IADNILE---------------------QA
RNY_LEUMM       ------------------------------MATNILE---------------------QA
RNY_LACLM       ------------------------------EAESLKR---------------------EA
RNY_LACLS       ------------------------------EAESLKR---------------------EA
RNY_LACLA       ------------------------------EAESLKM---------------------EA
RNY_STRA3       ------------------------------EAEHIRK---------------------AA
RNY_STRA1       ------------------------------EAEHIRK---------------------AA
RNY_STRA5       ------------------------------EAEHIRK---------------------AA
RNY_STRPM       ------------------------------DAEHIKK---------------------TA
RNY_STRPF       ------------------------------DAEHIKK---------------------TA
RNY_STRPG       ------------------------------DAEHIKK---------------------TA
RNY_STRPB       ------------------------------DAEHIKK---------------------TA
RNY_STRPC       ------------------------------DAEHIKK---------------------TA
RNY_STRP3       ------------------------------DAEHIKK---------------------TA
RNY_STRP6       ------------------------------DAEHIKK---------------------TA
RNY_STRP1       ------------------------------DAEHIKK---------------------TA
RNY_STRP8       ------------------------------DAEHIKK---------------------TA
RNY_STRPD       ------------------------------DAEHIKK---------------------TA
RNY_STRMU       ------------------------------DAEHIKK---------------------TA
RNY_STRT2       ------------------------------DADHLRV---------------------TA
RNY_STRT1       ------------------------------DADHLRV---------------------TA
RNY_STRTD       ------------------------------DADHLRV---------------------TA
RNY_STRPN       ------------------------------EADLLVN---------------------EA
RNY_STRR6       ------------------------------EADLLVN---------------------EA
RNY_STRPI       ------------------------------EADLLVN---------------------EA
RNY_STRP2       ------------------------------EADLLVN---------------------EA
RNY_STRGC       ------------------------------EADIILK---------------------DA
RNY_STRSV       ------------------------------EADLIVK---------------------EA
RNY_STRSY       ------------------------------QAEVILK---------------------TA
RNY_STRS2       ------------------------------QAEVILK---------------------TA
RNY_LACAC       ------------------------------DADHILADAKAQVAAAEAEVNAQKQAAIAV
RNY_LACH4       ------------------------------DADHILADARAQVAAVKAEVNAQKQAAEAV
RNY_LACDA       ------------------------------SVEAILAKAKAEVEVAKAEIQAQKQAAEAV
RNY_LACDB       ------------------------------SVEAILAKAKAEVEVAKAEIQAQKQAAEAV
RNY_LACGA       ------------------------------DAKHILADAESKAKAVEADLASQQ---EAM
RNY_LACJO       ------------------------------DAKHILADAESKAKAVEADLASQK---EAM
RNY_AYWBP       ------------------------------AFDNKLK---------------------EK
RNY_ONYPE       ------------------------------AFDDKLK---------------------EK
RNY_ACHLI       ------------------------------EAERIIE---------------------DG
RNY_MAGMM       ------------------------------RIDLLQK---------------------QA
RNY_THEMA       ------------------------------DAQTIIE---------------------KA
RNY_THESQ       ------------------------------DAQTIIE---------------------KA
RNY_THEP1       ------------------------------DAQTIIE---------------------KA
RNY_PSELT       ------------------------------DAVSLLK---------------------KA
RNY_FERNB       ------------------------------DAESIIK---------------------SA
RNY_THEM4       ------------------------------DAEHIIK---------------------DA
RNY_PETMO       ------------------------------EIEKMLK---------------------NA
RNY_AQUAE       ------------------------------KAEVILK---------------------EA
RNY_BACFR       ----------------------------KAKYDNVLK---------------------EA
RNY_BACFN       ----------------------------KAKYDNVLK---------------------EA
RNY_BACTN       ----------------------------KSKYDSVLK---------------------DA
RNY_BACV8       ----------------------------KSKYDIIIK---------------------EA
RNY_PARD8       ----------------------------KSKYDSVLQ---------------------EA
RNY_PORGI       ----------------------------KQRTEGILA---------------------EA
RNY_CYTH3       ----------------------------KEKANLIIK---------------------EA
RNY_FLAJ1       ----------------------------KKEAASILK---------------------DA
RNY_FLAPJ       ----------------------------KKEASSILK---------------------DA
RNY_GRAFK       ----------------------------KKEAGSILK---------------------EA
RNY_PELLD       ----------------------------EERAVQIVQ---------------------EA
RNY_CHLPM       ----------------------------EERAVQIVQ---------------------EA
RNY_CHLPD       ----------------------------EERAVQIVQ---------------------EA
RNY_CHLCH       ----------------------------EERAVQIVQ---------------------EA
RNY_CHLTE       ----------------------------EERAVQVIQ---------------------EA
RNY1_BDEBA      ------------------------------EAERIVN---------------------KA
RNY2_BDEBA      ------------------------------EAQDILD---------------------EA
RNY2_LACBA      ------------------------------QARDIIASA-------------------TA
RNY2_PEDPA      ------------------------------AAEKIIEHE-------------------RQ
RNY_MYCGE       ------------------------------------------------------------
RNY_MYCPN       ------------------------------------------------------------
                                                                            

RNY_UREPA       ----------------------------------------------KKQLKLTFVPKSQT
RNY_UREP2       ----------------------------------------------KKQLKLTFVPKSQT
RNY_MYCPE       ----------------------------------------------KKKNRNFKQIKIQP
RNY_MYCCT       TKEAKQAKKQI-------LANGYKEISEAKMLFLK----RSELEKNELDRVKEQLELRSN
RNY_MYCMS       TKEAKQAKKQI-------LANGYKEISEAKMLFLK----RSELEKNELDRVKEQLELRSN
RNY_MESFL       IKEAKNERKKI-------LSDTYREINEQKKSFEE----NLQFEKNKLEIAKQNIENENN
RNY_CAMJR       EYEAELILKDA-------KNSILNAELEVKKKYEEKTHKIQKDFNQKFDDLSKKE----Q
RNY_CAMJJ       EYEAELILKDA-------KNSILNAELEVKKKYEEKTHKIQKDFNQKFDDLSKKE----Q
RNY_CAMJE       EYEAELILKDA-------KNSILNAELEVKKKYEEKTHKFQKDFNQKFDDLSKKE----Q
RNY_CAMJ8       EYEAELILKDA-------KNSILNAELEVKKKYEEKTHKIQKDFNQKFDDLSKKE----Q
RNY_CAMJD       EYEAELILKDA-------KNSILNAELEVKKKYEEKTHKIQKDFNQKLDDLFKKE----Q
RNY_CAMC1       EYEAELTLKNS-------KISVQEAEFEAKKRYDDKTTKLQKEYASKFDELTKKE----K
RNY_CAMC5       EYEAELTLKNS-------KISVQEAEFEAKKRYDDKTTKLQKEYSQKFDELNKKE----Q
RNY_CAMFF       EFEAESILKDA-------KVKVNEAEFEAKKRYEEKGSRLQKEYNQKLDDISKKE----H
RNY_CAMHC       EFEAEGILRNS-------KISVQEAEFEAKKAYEDKALKLQKDYNAKFDEISKKE----Q
RNY_NITSB       EHEAEKILQNA-------QVQVKEAELELKRDFEKKLEELKRDYEERFNELMEKEMSLKQ
RNY_SULDN       ENEAQLLLYKA-------NIKSQEIEQEATKLYENAKDRAKADLSLREEDVNRKEQTFKR
RNY_HELHP       EYEAQNILQKH-------HMQIKEEQMRLKQEYEQECATLHKNYESRLAKLDKEESNRYQ
RNY_WOLSU       EHEAEMILQEA-------KIRAKELEIGAKSKYENETSKVIKEYESYLIKLEKQEAKNQQ
RNY_SULNB       SNEAELLLQES-------QMKIKTRELEHEAEFQKRLVQVEERN---------------R
RNY_ARCB4       EHEAEMALKDA-------QLK-------AKIECDREFKSAKREYEAMLLKIERKERELNE
RNY_HELPY       EFQAKSFVEAE-------EIRMKSQECKLQQQYENKNLQLQTHFDKKEAHLKHLEAQHKE
RNY_HELPH       EFQAKSFVEAE-------EVRMKSQECKLQQQYENKNLQLKTHFEKKEVHLKHLEAQHKE
RNY_HELPJ       EFQAKSFVEAE-------EMRMKSQECKLQQQYENKNLQLQTHFDKKEAHLKHLEAQHKE
RNY_HELAH       EFQAKSFVEAE-------EMRMKSQECKLQQQYENKNLQLKAHFDKKEAYLKHLEAQHKE
RNY_BORBU       QLEIENERRQI-------IANAKSQMLKEKNQQDR----DIRDRKNEIVNLEKRLLQREE
RNY_BORAP       QLEIENERRQI-------IANAKSQMLKEKNQQDR----DIRDRKNEIVNLEKRLLQREE
RNY_BORBP       QLEIENERKQI-------IANAKSQMLKEKNQQDR----DIRDRKNEIVNLEKRLLQREE
RNY_TREPA       QKEAESKKKSI-------LLEAKEYVLRERNQQER----DDRDRRAELQRAERRLLQKEE
RNY_TREDE       IKDAEAQKKEF-------LLEAKEQLIREQKQQER----ENRERRSDLQRFERRLAQKEE
RNY_UNCTG       KLIAETKAKEI-------ILDARLIVDRERKEFEH----KIKERRQFIQNMENKLNQREE
RNY_GEOMG       KREAETITKEA-------ELKAKDEVFQAKAEAER----DAKEKRKDLQALEKRLQQKEE
RNY_GEOSL       KREAETISKEA-------ALQAKDVVYQAKADFER----EAKEKHKDLQTLEKRLQQKEE
RNY_GEOUR       KRQAETITKEA-------SLQAKDVVYQAKADFER----ETKDKRRDLQALEKRLQQKEE
RNY_PELPD       RREAETITKEA-------DLKARAEIIEAKAGHDR----EITEKKKDLQILEKRLQQKEE
RNY_PELCD       TKEADILRKEA-------EIQKKDALLEAKTAWEQ----EAREMRRELQAQEKRLVQREE
RNY_SYNFM       RKEAETIKKEA-------ILQAKDSLFQMKAEFER----ETKESRKEFQNLEKRILQKEE
RNY_SYNAS       KKEAETIKKEA-------VLQTKENLLKLKAEFEK----ETRERKLDLDNLERRIRSKEE
RNY_DESPS       IIDAEQLKKEA-------LLQSKEEVYQIKQSLEA----EVKLERDDLKDEHRQLKKQRD
RNY_DESVH       RKEAQAQKKEI-------LLQGQDEIFNQKRELEN----EFKERERELKARDRKLEEQGE
RNY_DESVV       RKEAQAQKKEI-------LLQGQDEIFNQKRELEN----EFKERERELKARDRKLEEQGE
RNY_DESAG       RKEAQAHKKEV-------LIQGQDELFNQKRELER----EFKEREHELKIRERRLQEQTE
RNY_LAWIP       RKEGQAQKKEI-------LLQGQNEIFNQKKEFEF----DFKQREKELSIKDKKLQVQSE
RNY_CLOB1       ERDAEAKKKEA-------ILEAKEEAHKLRAEVER----ENRERRNEVQRLERRIIQKEE
RNY_CLOBH       ERDAEAKKKEA-------ILEAKEEAHKLRAEVER----ENRERRNEVQRLERRIIQKEE
RNY_CLOBM       ERDAEAKKKEA-------ILEAKEEAHKLRAEVER----ENRERRNEVQRLERRIIQKEE
RNY_CLOBL       ERDAEAKKKEA-------ILEAKEEAHKLRAEVER----ENRERRNEVQRLERRIIQKEE
RNY_CLOBK       ERDAEAKKKEA-------ILEAKEESHKLRAEVER----ENRERRNEVQRLERRIIQKEE
RNY_CLOK5       KKEAQSQKKEA-------ILEAKEEVHKLRNDLER----ESRDRRMEIQRLEKRVLQREE
RNY_CLONN       EKNAEAIKKEA-------ILEAKEEVHRIRNDFEK----ESRERRNEIQRLERRIIQREE
RNY_CLOTE       KREAESKKKEA-------ILEAKEEMHRLRNDFEK----ESKDRRNEIQRLERRIIQREE
RNY_CLOAB       KREAETLKKEA-------TLEAKEEAHRLRSDLDK----ETRERRNEIQRLERRNLQREE
RNY_CLOPE       KREAESTKKEA-------ILEAKEEVHKLRADLDK----ETRDRRNEIQRFERRLIQREE
RNY_CLOP1       KREAESTKKEA-------ILEAKEEVHKLRADLDK----ETRDRRNEIQRFERRLIQREE
RNY_CLOPS       KREAESTKKEA-------ILEAKEEVHKLRSDLDK----EIRDRRNEIQRFERRLIQREE
RNY_CLOB8       KKDAEATKKEA-------ILEAKEELHKLRNDFDK----ESRERRNEIQRLERRVIQREE
RNY_THEP3       KRDAENKKREL-------LLEAKEEIHRMRTDLEK----EIRDRRGELQRLEKRLLQKEE
RNY_THEPX       KRDAENKKREL-------LLEAKEEIHRMRTDLEK----EIRDRRGELQRLEKRLLQKEE
RNY_CALS4       KKDAENKKREA-------LLEAKEEIHRLRSDFEK----EVRDRRGELQRLEKRLLQKEE
RNY_NATTJ       KKQGESMKREA-------LLEAKEEIHTQRNELEK----ETRERRNEIQRFERKLEQKEE
RNY_ALKMQ       DKNAETTKKEV-------LLEAKEEIHKLRNEFER----ESRERRNELQRVERRLMQKEE
RNY_ALKOO       EKDAETTKKEL-------LLEAKEEVHKLRNELER----ENRERRNELQRTERRLIQKEE
RNY_CLOD6       HHDSETVQKEK-------LLEAKEEIHKWRTEAER----ENRERRTEVQKYEKRVVQKEE
RNY_DESRM       EKNAEGKKREA-------IVMAKEEVLKLRNEMER----EIRDRRNELQRLERRLLQKEE
RNY_PELTS       EKEAEAKKREA-------ILEAKEEVLKLRNDMER----ENRERRLELQRLERRLVQKEE
RNY_DESAP       AKEAESKKREA-------VVEAKEEILKLRNEVER----ESRERRSELQRQERRLVQKEE
RNY_CARHZ       TKAAEAKKREA-------VLEAKEEILKMKNEVER----EHRERRQELQRLERRLLSKEE
RNY_DESHY       QGAAEAKRREA-------VIAAKEEVMHIRNEVEK----ESRERRNEIQRMERRVIQKEE
RNY_HELMI       VKEAEAKRREA-------VLAAKDEVHQMRIEAER----ENRERRNELQRLERRLLQKEE
RNY_MOOTA       KKEAEARKREA-------VLEAKDEVHRMRNEVER----ESRERRNELQRLERRLLQKEE
RNY_LACP7       LKTAETKKREA-------LLEAKEESLKTKNELER----ETKERRAELQRYEKRVLTKEE
RNY_HUNT2       QKIAEAKKREV-------LLEAKEEIHKSRLELDR----EIKERRNEIQRLERRLVQKEE
RNY_CALS8       KKQAEAYKKEA-------TLLAKEEIHRARSEFDR----EVRERRAELQRFERRLIQKEE
RNY_SYMTH       LREAEAKKKEA-------ILEAKEEVHRLRTEAER----ELKERRAELQRLERRVLQKEE
RNY_SYNWW       AKEVEAKKKEI-------LLEAKDEIHRNRQDAEK----DIRERRRELDRVERRIIQKEE
RNY_FINM2       NKDAETKKKEL-------LVEAKDEIFKMKSDLDR----ENKSRLKEISRQEDRLNSKEE
RNY_FUSNN       ERDAVSKAKEI-------ELKAKEKAYQIKEEIEK----EARNSKNEIAQKEARIIKKEE
RNY_ROSCS       RSEQ----KDL-------ILRATDEALRLRTEAEA----QIREARAALAKQEERLQRKEE
RNY_ROSS1       RSEQ----KDL-------ILRATDEALRLRAEAEA----QIREARAALAKQEERLQRKEE
RNY_CHLAA       RSQQ----KEI-------LLQAKDEALRIRNEAEA----ELRESRQSLQKQEERLQRKEE
RNY_DEHMB       KLEA----KDV-------LVEAKREADKTRNSAET----ELKERRSELAKQENRVIQKTE
RNY_DEHMC       KLEA----KDV-------LVEAKREADKTRNSAET----ELKERRSELAKQENRVIQKTE
RNY_DEHM1       KVEA----KDV-------LVEAKREADKARNSAEA----ELKERRSELAKQENRVMQKTE
RNY_DEIRA       EQREQVRALRA-------QLEAEREQAKADAAQQR---EALSTDRQETRREREDLGREIE
RNY_DEIGD       AQREQLQAVRA-------QIEAERARAAQDAARER---ETLSADRQETRREREELKREIE
RNY_THET2       EAKKRLEEAGE-------RLKAEREELRAERERLRSLQEELKEERERLKAEREELRREGE
RNY_THET8       EAKKRLEEAGE-------RLKAEREELRAERERLRSLQEELKEERERLKAEREELRREGE
RNY_SALAI       HKQAEADAEQL-------RTAARRSGEREAAVLAT----TTREQAAEVERRAARMDDRER
RNY_SALTO       HKQAETEAEQL-------RTAARRSGEREAAVLAV----TTRDQAAEVERRAVRMDDRER
RNY_ACIC1       -----VDAGNV-------RQPSGMSGP-DAAAAEA----EIREARSELERREQRLAEREA
RNY_FRASN       ELRASRAEAAA-------RDAIHAEREQIRAELDE----DLRTQRTELRGWDSRLTQREQ
RNY_THEFY       ----QQWADRI-------RADAENAARSHQDRLLA----EAAAYRAELDRREQRIAAQEQ
RNY_CUTAK       KARAELESSRT-------RASDEARRADNADQARR----SAEALLEINRRSVEELTERDH
RNY_RHOBA       RREAETRGNQI-------IVDAREKALAIKAEADR----EVAAMRETEQIRDRKLDARED
RNY_OPITP       RREAAVAAEEI-------RQKAEAEIQEKRAELNR----DFDRREIESEVRLREIRAHE-
RNY_RUBXD       NRQAETLRREA-------ELAAKEAAMRIKDEAEA----EVRARRAEISRIEERLDNRDT
RNY_PARUW       ISRAEQETSEL-------RKTNELSLKQKQVEYQRELEQMWQQERKKLQQEEERLKQRED
RNY_STAA2       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAA1       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAAE       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAAT       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAA8       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAAB       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAAC       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAAR       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAAS       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAAM       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAAW       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAAN       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAA3       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAA9       HKEADNIKKEK-------LLEAKEENQILREQTEA----ELRERRSELQRQETRLLQKEE
RNY_STAES       NKEADNIKKEK-------LLEAKEENQILKEQAEN----ELRERRGELQRQETRLLQKEE
RNY_STAEQ       NKEADNIKKEK-------LLEAKEENQILKEQAEN----ELRERRGELQRQETRLLQKEE
RNY_STAHJ       QKEADNIKKEK-------LLEAKEENQIIREQTES----ELRERRGELQRQEARLLQKEE
RNY_STAS1       NKEAENIKKEK-------LLEAKEENQIIKEQSEI----ELRERRGDLQKQEARLLQKEE
RNY_BACHD       KREAEAGKKEA-------ILEVKDEVHKLRTEAER----EIRERRNEIQKQENRLVQKEE
RNY_BACSK       KREAETNKKEA-------ILEVKDEVHKLRSDAER----EVRERRNEIQKQEHRLVQKEE
RNY_EXIS2       QVSAEATKKEA-------LLEAKDEAFKLRNEVEK----ELRERRQELTKQEGRLLQKEE
RNY_BACSU       KRDAEALKKEA-------LLEAKDEIHKLRIDAEQ----EVRERRNELQKQENRLLQKEE
RNY_BACVZ       KRDAEALKKEA-------LLEAKDEIHTLRIDAEQ----EVRERRNELQKQENRLLQKEE
RNY_BACLD       KRDAEALKKEA-------LLEAKDEIHTLRIEAEQ----EVRERRNELQKQENRLLQKEE
RNY_BACP2       KRDAEALKKEA-------LLEAKDEIHSFRVEAEQ----EVRERRNELQRQENRLLQKEE
RNY_BACAN       NREAEALKKEA-------LLEAKDEIHTLRTEAEL----EIRDRRSELQKQENRLMQKEE
RNY_BACAH       NREAEALKKEA-------LLEAKDEIHTLRTEAEL----EIRDRRSELQKQENRLMQKEE
RNY_BACHK       NREAEALKKEA-------LLEAKDEIHTLRTEAEL----EIRDRRSELQKQENRLMQKEE
RNY_BACCZ       NREAEALKKEA-------LLEAKDEIHTLRTEAEL----EIRDRRSELQKQENRLMQKEE
RNY_BACC1       NREAEALKKEA-------LLEAKDEIHTLRTEAEL----EIRDRRSELQKQENRLMQKEE
RNY_BACCR       NRDAEALKKEA-------LLEAKDEIHTLRTEAEL----EIRDRRSELQKQENRLMQKEE
RNY_BACMK       NRDAEALKKEA-------LLEAKDEIHTLRTEAEL----EIRDRRSELQKQENRLMQKEE
RNY_BACCN       NREAEALKKEA-------LLEAKDEIHTLRTEAEL----EIRDRRSELQKQENRLMQKEE
RNY_GEOKA       KREADALKKEA-------LLEAKDEIHKLRTEAER----DIRDRRSELQKQENRLMQKEE
RNY_GEOTN       KRAADALKKEA-------LLEAKDEIHKLRTEAEH----DIRDRRSELQKQENRLMQKEE
RNY_LYSSC       KREAEALKKEA-------LLEAKDETHKFRTEAEN----DIRERRLELQKQENRLLQREE
RNY_OCEIH       HRNADAAKKEA-------LLEAKDETHKFRQQAED----EIRERRMEAQKQENRLMQKEE
RNY_LISIN       KKEAETTKKEA-------LLEAKEENHRLRTEIEN----ELRGRRTETQKAENRLLQREE
RNY_LISMO       KKEAETTKKEA-------LLEAKEENHRLRTEIEN----ELRGRRTETQKAENRLLQREE
RNY_LISMF       KKEAETTKKEA-------LLEAKEENHRLRTEIEN----ELRGRRTETQKAENRLLQREE
RNY_LISW6       KKEAETTKKEA-------LLEAKEENHRLRTEIEN----ELRGRRTETQKAENRLLQREE
RNY_LACPL       KRAAETHKKEK-------VLEAKEESHRYRAEVET----ELKQRRNEVQKQEDRLLQREE
RNY1_LACBA      KKQAETATKEA-------LLEAKEDSHKYRAEVET----ELKERRAEVQKQEDRLIQREE
RNY1_PEDPA      RKQAETERREK-------LLEAKDESHRYRAKVEK----ELKERRAELQKQEDRLLQRED
RNY_LACP3       KKEAATLKKEK-------LLEAKDENHRYRTQLED----ELKDRRTEVQKSEHRLNQRED
RNY_LACSS       EKEAATRKKEI-------LLEAKDENHQYRSEIEN----ELKDRRGEVQKQENRLIQREE
RNY_ENTFA       RKESETLKKEA-------LLEAKEENQKYRSEIES----ELKESRLELKSQENRLIQREQ
RNY_LACS1       KKEAAASKKEA-------IIEAKEENHRYRSEIES----ELKERRSEIQRQENRLLQREE
RNY_LEUCK       NNEAKSLTRAA-------KTDAKEMAQDYRHQVDN----DFKDRQKQLQQQEQRLEDRIS
RNY_LEUMM       NNEAKSLKRAA-------EVDAKDLAQTYRNQVND----SYNDRQKHLQQQEQRLEDRIN
RNY_LACLM       E----AFKKEA-------RYTLREEEQKQRREIED----EFKQERQELKETEKRLKQREE
RNY_LACLS       E----AFKKEA-------RYTLREEEQKQRREIED----EFKQERQELKETEKRLKQREE
RNY_LACLA       E----AFKKEA-------RYTLREEEQKQRREIED----EFKQERQELKETEKRLKQREE
RNY_STRA3       ERESKAHQKEL-------LLEAKEEARKYREEIEK----EFKSDRQELKQMEARLTDRAS
RNY_STRA1       ERESKAHQKEL-------LLEAKEEARKYREEIEK----EFKSDRQELKQMEARLTDRAS
RNY_STRA5       ERESKAHQKEL-------LLEAKEEARKYREEIEK----EFKSDRQELKQMEARLTDRAS
RNY_STRPM       KRESKANRKEL-------LLEAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRPF       KRESKANRKEL-------LLEAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRPG       KRESKANRKEL-------LLEAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRPB       KRESKANRKEL-------LLEAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRPC       KRESKANRKEL-------LLEAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRP3       KRESKANRKEL-------LLEAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRP6       KRESKANRKEL-------LLEAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRP1       KRESKANRKEL-------LLEAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRP8       KRESKANRKEL-------LLEAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRPD       KRESKANRKEL-------LLKAKEEARKYREEIEQ----EFKSERQELKQLETRLAERSL
RNY_STRMU       ERESKAYKKEL-------LIEAKEEARKYREEIEK----EFKSERQELKQMDARLTERAA
RNY_STRT2       ERESKAQRKEL-------LLEAKEKARKYREDIEE----EFKSERQELKQMENRLTERAT
RNY_STRT1       ERESKAQRKEL-------LLEAKEKARKYREDIEE----EFKSERQELKQMENRLTERAT
RNY_STRTD       ERESKAQRKEL-------LLEAKEKARKYREDIEE----EFKSERQELKQMENRLTERAT
RNY_STRPN       KRESKSLKKEA-------LLEAKEEARKYREEVDA----EFKSERQELKQIESRLTERAT
RNY_STRR6       KRESKSLKKEA-------LLEAKEEARKYREEVDA----EFKSERQELKQIESRLTERAT
RNY_STRPI       KRESKSLKKEA-------LLEAKEEARKYREEVDA----EFKSERQELKQIESRLTERAT
RNY_STRP2       KRESKSLKKEA-------LLEAKEEARKYREEVDA----EFKSERQELKQIESRLTERAT
RNY_STRGC       KRETNSLKKEA-------LLEAKEEARKYREEVEA----EFKSERQELKQTESRLTERAA
RNY_STRSV       KRETSSLKKEA-------LLEAKEEARKYREQVDA----EFKSERQELKQIESRLTERAS
RNY_STRSY       ERDRQTLKKEL-------LLEAKEEARKYREEIAE----EFKSERQELKQIESRLTERAT
RNY_STRS2       ERDRQTLKKEL-------LLEAKEEARKYREEIAE----EFKSERQELKQIESRLTERAT
RNY_LACAC       KQSAENTKKEK-------ILEAQEQIRDYRQKTED----ELNSKKDNLARQENRLQQRED
RNY_LACH4       KQSAENTKKEK-------ILEAQEQIRDYKQKTED----KLNLKKDDLARQENRLKQRED
RNY_LACDA       KRDAETEKKAK-------ILEAQEEIRDYRQKVED----ELNRRRDEAARKENRLQQKED
RNY_LACDB       KRDAETEKKAK-------ILEAQEEIRDYRQKVED----ELNRRRDEAARKENRLQQKED
RNY_LACGA       KKAAADAKKEK-------ILEAQEEIHHYRERVDN----ELNERRQEVSRQENRLLQRED
RNY_LACJO       KKAAADAKKEK-------ILEAQEEIHHYRERVDN----ELNERRQEVSRQENRLLQRED
RNY_AYWBP       EKDLQKREQEM-------MRNAKIEIASLRQKLEL----DLEQRTNTIVDLESKNNRREE
RNY_ONYPE       EKDLQQREQEM-------MRNAKIEITSLRQKLEL----DLEQRTNTIVDLESKNNRREE
RNY_ACHLI       KKEADRTKREM-------VFEAKQEILTLRKEFDE----DIKDRRQIVMNLEEKATQREN
RNY_MAGMM       QEQVRNAAKEV-------ELAMKGERIQIREELES----ELRSRREEVDSHQVRLDKRES
RNY_THEMA       EKEANEIKKKA-------IIEGREEVHRLREEFE----KERSRREEELRALEERLLKREE
RNY_THESQ       EKEANEIKKKA-------IIEGREEVHRLREEFE----KERSRREEELRALEERLLKREE
RNY_THEP1       EKEANEIKKKA-------IIEGREEVHRLREEFE----KERSRREEELRAFEERILKREE
RNY_PSELT       EQEAQEIKRKA-------IIEAREEVHKIKEEIE----EEKKRRDLEHRSLEERLLKREE
RNY_FERNB       EKEASEIKKKA-------IIEAREEAHQIREEIE----KERKKREEEIKQLEERLLKREE
RNY_THEM4       EKEASEIKKKA-------VIESREELHKLREEWE----KERKEREEEIRYLEERLIKREE
RNY_PETMO       EEEAKALKQKE-------LLEAKEEIHRLRQEFD----SEAKQQREELKANEERLIRKEE
RNY_AQUAE       KESAEKIVREAEEKAEKLIREAKEEVERIKEEVERRK-KELKEREENVLAKERHLDRRWE
RNY_BACFR       ETEAEVIKKNK-------LLEVKEKFLNKKADLEK----EVALRNQKIQQAENKLKQREM
RNY_BACFN       ETEAEVIKKNK-------LLEVKEKFLNKKADLEK----EVALRNQKIQQAENKLKQREM
RNY_BACTN       ETEAEVIKKNK-------LLEVKEKFLNKKADLEK----EVALRNQKIQQAENKLKQREM
RNY_BACV8       QTEAEVIKKNK-------LLEVKEKFLNKKADLEK----EVALRNQKIQQAENKLKQREL
RNY_PARD8       EKEAEVIKKNK-------MLEVKEKFLHLKADLEK----QVSQRNAKIQSVETKLKQREL
RNY_PORGI       RREAEVIKQKK-------LLEVKEKFLQLKGDLEK----QVAQRNSKLQSVESKLKSREQ
RNY_CYTH3       ELKAEATKKDK-------QLEAKEHFLKLKTEFEE----DSNKKKNLIIQNEQKIKQREQ
RNY_FLAJ1       NLEAENIKKDK-------ILQAKERFIELKSEHEQ----VILARDKKVAEVEKRVRDKES
RNY_FLAPJ       NLEGENIKKDK-------ILQAKEKFIELKSEHEQ----VILTRDRKVAEVEKRVRDKES
RNY_GRAFK       KAEGESIKKDK-------ILQAKEKFIELKSEHEK----VILSRDKKINDAEKRIKDKES
RNY_PELLD       QKEANEYKELK-------VTEVNQEWKKKRREFDQ----EVVIKNNKFNQLQKQVQQREA
RNY_CHLPM       QKEANEYKDLK-------VTEVNQEWKKKRREFDQ----EVVIKNNKFNQMQKQVQQREG
RNY_CHLPD       QKEANEYKELK-------VSEVNQEWKKKRREFDQ----EVVIKNNKFNQMQKQVLQKEG
RNY_CHLCH       QKEANEYKELK-------VSEVNQEWKKKRREFEQ----DVLIKNNKFAQLQKQLQQREA
RNY_CHLTE       QKEANDYKELK-------VNEVNQEWKKRKREFDS----EVTIKNNKFAQLQKQIRQKEV
RNY1_BDEBA      NSEAAKIKKES-------ENKAKDFESRARKNVEQDIHKQKSTLKNKESQLERRLKEVED
RNY2_BDEBA      NEVVELRNLEE-------RERIQEIEMELWTKVEPEMLKSEGRIEDLQEVANERKAKADA
RNY2_LACBA      ETQQKIAKLTA---------DSRRETLTYQQSVKD----ELAEQTSDIAVREQRRQQREQ
RNY2_PEDPA      KTKAEVAEYEK---------NSVQETQQYQETIDQ----ELADDLHDNQRKEAWIEQRMN
RNY_MYCGE       ------------------IIIAFNLCLFAYLYFQY----RIYKKN--PKKANNFKANEYE
RNY_MYCPN       ------------------IIVILNLGLLVFLAYQY----RVYKKKQRANLTKQTYNNDYG
                                                                            

RNY_UREPA       SFKKIVQKTKDLEEECEDLNNKNNELKKAISDQNLQIDLLKKNNE-------NFLLNATS
RNY_UREP2       SFKKIVQKTKDLEEECEDLNNKNNELKKAISDQNLQIDLLKKNNE-------NFLLNATS
RNY_MYCPE       KKNNKITPTSDQKLKADEFISIINKKREILNHQRADYLKIKETQE-------SYQQLQEV
RNY_MYCCT       DLKRNQEIVESKSQRLDASLLDLEKRKFLLDKKEEYLI--------------KVLEDASS
RNY_MYCMS       DLKRNQEIVESKSQRLDASLLDLEKRKFLLDKKEEYLI--------------KILEDASG
RNY_MESFL       LLIKERAIIIKQQEAIDVKNTDLDKRIKNYSDKREELI--------------KRLEIISN
RNY_CAMJR       KLQQEEEKLKEDKEYLCKSQKHIQNLQSDVDKLKNKYQEKLDDVL-------KILEHSTG
RNY_CAMJJ       KLQQEEEKLKEDKEYLCKSQKHIQNLQSDVDKLKNKYQEKLDDVL-------KILEHSTG
RNY_CAMJE       KLQQEEEKLKEDKEYLCKSQKHIQNLQSDVDKLKNKYQEKLDDVL-------KILEHSTG
RNY_CAMJ8       KLQQEEEKLKEDKEYLCKSQKHIQDLQSDVDKLKNKYQEKLDDVL-------KILEHSTG
RNY_CAMJD       KLQQEEEKLKEDKEYLCKSQKHIQDLQSDVDKLKNKYQEKLDDVL-------KILEHSTR
RNY_CAMC1       ILLNEQELLNESKELFEKDKQDAKVTYEEGLNLKATYQNKVEEAI-------RVLEHAAG
RNY_CAMC5       ILLNEQELLNENKELFEKDRNEAKLTYEEGLNLKATYQSKVQEAL-------KVLEHAAG
RNY_CAMFF       AILNEQEILKNSKDELEKSQNQAKTLYEEGLNLKIAYQDKLSETL-------KVLEHVAG
RNY_CAMHC       TVLTEQEILKDSREELEKEKKSAQTIYDEGTSLKKTYETKVEESL-------KLLERVAG
RNY_NITSB       MFKDELKHITLEKQEIKAEREEINRLKNEYEELKKRYQEKYQEVL-------EALQQQAG
RNY_SULDN       YKQNEERRLQDEVSTLKARQVDLKRNEKSLSSLKKRYEDKIDEAL-------NAIEHCAG
RNY_HELHP       QLNNQKQEVEKEKQEIAELKVRLLRSQGEQDKLKQEYQHIKKEML-------DVLSKYAQ
RNY_WOLSU       RLERETQQLEEERRRINHKQASLSGMIEELEKLKGDYRSKLTESL-------EILSRVAG
RNY_SULNB       ALILEQKAVEKEEEALLLLEQRILEKESVLEALEEKKQKQISETV-------EKLQHAAS
RNY_ARCB4       HLESELKAIKLEKEQIVEKNRKITTLKDGLEEQKKTYEEKTLEAI-------KILENACG
RNY_HELPY       FVRDEKRYLEKEKKELEKERQILEQEKENFKKQRAVCKESQAKAL-------DAMLNYMA
RNY_HELPH       FVRDEKRYLEKEKKELEKERQILEQEKENFKKQRVVCKEAQAKAL-------DAMLNYMA
RNY_HELPJ       FVRDEKRYLEKEKKELEKERQILEQERENFKKQRAICKEAQAKAL-------DAMLNYMA
RNY_HELAH       FVRDEKRYLEKEKQELEKERQILEQEKENFKKQYATCKENQSKAL-------DVMLNYMA
RNY_BORBU       TLDKRISALDKQQSRVDFKIKEFEQKEKVIREK-------EADLV-------KRLENISG
RNY_BORAP       TLDKRISALDKQQSRVDFKIKEFEQKEKVIREK-------EADLV-------KRLENISG
RNY_BORBP       TLDKRISALDKQQSRVDFKIKEFEQKEKAIREK-------EADLV-------KRLENISG
RNY_TREPA       ALSTRAGELDS-------RERSLKQRDQSLCQE-------EARYR-------QELERVSG
RNY_TREDE       VLDKRVETVEKQEKELIKREAALDERTEILSGE-------EERYR-------EELERISG
RNY_UNCTG       SLDRKMDAVDKKEKNLSEREKDFSSKEHLLSVKFSEVDKVKEEQK-------KFLERISG
RNY_GEOMG       NLDKKMNLFDQRDADLTKKDQALLNREQGLVQKEERLDGLIAEQR-------EKLESISG
RNY_GEOSL       NLDKKMNLFDQRDADLTKKEQGILAREQSLNRKEESLDALVAEQR-------AKLEQISG
RNY_GEOUR       NLDKKMNLFDQRDAEFLKREQGLAAKEQVLGQKDEKLNQLISEER-------TRLENISG
RNY_PELPD       NLDKKFGLIEQKELDMLKKEQSFVAREQNLAAKSEELSRASDVQQ-------AKLEEISG
RNY_PELCD       NLDRKVAQVDARDEEFGQREKRLSQQESRIRSWEKEADALVRQQR-------ERLEELAG
RNY_SYNFM       NLDKKSEALDKREGVIGKREKVLQQQEKELEENTRELHMLIEEQR-------KKLESLSG
RNY_SYNAS       NLDKRIDSMSQKENAIEVREKNLLSKEMQLNEKHDKLSRMIGEQK-------EKLEQIAD
RNY_DESPS       NIKRENERFEKRQSRHVVAEKALERRLREVDVKHEEADNEILKQR-------DELARIAG
RNY_DESVH       RLEEKLEKATQKEHEVLAIEKELTRKERRLATLEEELEGKIAEQD-------HRLEEVSG
RNY_DESVV       RLEEKLEKATQKEHEVLAIEKELTRKERRLATLEEELEGKIAEQD-------HRLEEVSG
RNY_DESAG       RLEEKLEKLAQKEHDALSVEKELNRRERTLGLKEEELTQKIAEQD-------KKLQEISG
RNY_LAWIP       RLEERLERAAEKEHEILKVEKELSIKERNLLTLEEQLKSRIDEQE-------KQLQKISG
RNY_CLOB1       ALDKKSEALENKEEALNKKQQKIEDVET-------HMEELHEKQR-------TELERISG
RNY_CLOBH       ALDKKSEALENKEEALNKKQQKIEDVET-------HMEELHEKQR-------TELERISG
RNY_CLOBM       ALDKKSEALENKEEALNKKQQKIEDVET-------HMEELHEKQR-------TELERISG
RNY_CLOBL       ALDKKSEALENKEEALNKKQQKIEDVEA-------HMEELHEKQR-------TELERISG
RNY_CLOBK       ALDKKSEALENKEEALNKKQQKIEDVET-------HMEELHEKQR-------TELERISG
RNY_CLOK5       LLDKKNDVLEKRESSLDKKQQEIDKVQA-------KVEELYQKQR-------EELERLSG
RNY_CLONN       LLDKKSEAIENKEEVLNKKQQDINEKAA-------SIDELYDKQR-------EELEKLSN
RNY_CLOTE       ALDKKGDMLEKKEESLNKKHQELENKKS-------NIENLYEKQR-------EELERLAG
RNY_CLOAB       TLDKKNDLLEKRENGLNERENSIQERQN-------TIEQLYKEER-------EKLEQLSG
RNY_CLOPE       SLDKKGEMLEKREDSINKKSIEIQELEE-------RVQNLYGEQR-------AELERISN
RNY_CLOP1       SLDKKGEMLEKREDSINKKSIEIQELEE-------RVQNLYGEQR-------AELERISN
RNY_CLOPS       SLDKKGEMLEKREDSINKKSIEIQELEE-------RVQSLYGEQR-------AELERISN
RNY_CLOB8       ALDKKSELLEKKDETINQRMLEVDQVEA-------RVQKLYEERR-------AELERISA
RNY_THEP3       TLDKRAETLEQKESFLEEKQKEIQQLEE-------QISLLYQKEI-------EELERISG
RNY_THEPX       TLDKRAETLEQKENLLEEKQKEIQQLEE-------QISLLHQKEI-------EELERISG
RNY_CALS4       ILEKRAESLEQKEILLEQKQKEIQQLEE-------QITLLHKKQL-------EELERISG
RNY_NATTJ       SLSKQQKQLEQKEKEIAQKDEKITNKEQ-------ELEKIYQQQV-------EELENLSG
RNY_ALKMQ       SLDKKSETLEQKDDRLSRKLRDLETKEE-------EIKLLYNKEV-------QKLEELSG
RNY_ALKOO       ALDKKSETLELKDEKLNKKLKELDNKEL-------EINNLYQKEV-------EKLEELSG
RNY_CLOD6       VLDRKLQNLESKEVNLSEKLKVVEKKEE-------EVEVIKTQQL-------EKLESISG
RNY_DESRM       TLDRKMDSMEKKEESLSRKEADIENTKA-------ELTNVLNRQL-------AELERVSG
RNY_PELTS       TLDRKVDAIEKKEDALNRKEAEIDAIKA-------QLNEIYKKQL-------SELERISG
RNY_DESAP       SLDRKLEALEKKEENLAKRETELAKMHE-------ELKALHQKEL-------QELERISG
RNY_CARHZ       TLDRKIESFERKEEQLAKKEQEIENLRQ-------SLEETLQKEL-------AELERISG
RNY_DESHY       SLDRKMESLERKEDNLHRKEEEVDQLKE-------VLTQTVAKEK-------QELERVSG
RNY_HELMI       SLDRKMESMERKEDNLQRREDEIEKLRA-------GLAETLQKQV-------AELERLSG
RNY_MOOTA       TLERKSETLERKEASLHRQEEAIQRTRE-------EVEKIRQQQV-------SELERISG
RNY_LACP7       TLDRKTEALEKKEAKLVAKEQELDRLRV-------EVEESHQKQV-------AELEKISG
RNY_HUNT2       ALDRKVESLEQKEELLNKKTKEIQELYE-------QTLETQRQQV-------AELERISG
RNY_CALS8       MLDKKMAAVEEKEEQLNQKIKDVQKLQE-------EIELLKQKQQ-------EELQRISG
RNY_SYMTH       QLDRKVEQLERKEETLSRKERELDRKNQ-------QAQELVNKQM-------AELERISQ
RNY_SYNWW       MIDKKTENMEKKEQVLLEKEKETEKTQQ-------DLQMVLSQQL-------KELERLSG
RNY_FINM2       NLERKNASLEKKHKKLDSELKKADDMQL-------KIQSLIDEKE-------LELEKVAG
RNY_FUSNN       ILDGKIEKIEIKSLELEKINDELEEKRK-------EIDDLRVKQE-------EELSRVSE
RNY_ROSCS       NLDRKIEGLERRERQLQQRERQMEQLHQ-------EAEHLRQQQR-------AELERISA
RNY_ROSS1       NLDRKIEGLERRERQLQQRERQMEQLHQ-------EAEQLRQQQR-------AELERISA
RNY_CHLAA       NIDRKLEGIERRERLIQQRERQIEQLTQ-------EAERLKRQQA-------QELERISQ
RNY_DEHMB       ALDRKLENLEQREQSLTNREKSIDETQS-------QIEEIRENEL-------KRLEEVAN
RNY_DEHMC       ALDRKLENLEQREQSLTNREKSIDETQS-------QIEEIRENEL-------KRLEEVAN
RNY_DEHM1       ALDRKLENLEQREQSLTNREKSIDETQS-------QIEEIRTAEL-------KRLEEVAS
RNY_DEIRA       RLGRRTEQLDARSDKLDALEERLEGGWREVQRQEQEVAERLRQAD-------LKLYEVAG
RNY_DEIGD       RLNRRAEQLDARGDKLDALEERLEGQLHALAQQEAELAERSRQVD-------LKLYEVAG
RNY_THET2       RLAKRAEALDARAARLEEAEAELVRKEEALKAEARALEERFKEVE-------RRLYEVAG
RNY_THET8       RLAKRAEALDARAARLEEAEAELVRKEEALKAEARALEERLKEVE-------RRLYEVAG
RNY_SALAI       LHSEEVERLAERDRQLSAASAALAARESTLVDRDRELAQAEDRRR-------RELERVAG
RNY_SALTO       LHTEEVERLAERDRQLSAANAALEARESALAERDRELEQAEQRRR-------RELERVAG
RNY_ACIC1       RLDAEHERLAARERQ-------LAELEEKLGRLQAELAQVAEERR-------LLLERTAG
RNY_FRASN       RVTDQAASVEERLRRLETREAELAVREAGLDSRESDLGELEEARR-------RELERVAG
RNY_THEFY       RIERELRRLDAARRQ-------LDERTAQLDQRAAELARLAEERR-------AVLEQAAA
RNY_CUTAK       RLQEARRHLEEGLDKIEQDRLELAERSSQLDERDAELDRRHGQIV-------TELERVAG
RNY_RHOBA       QLASGQESLRKAQRGLESSQTRLAAQMRNLTEQRAELDRLVQESQ-------RALEKVSG
RNY_OPITP       ------ESLALLDYQLEQRQERLNRETAAMRQARDAIRALSKSVR-------QRLEGVSQ
RNY_RUBXD       ALDRREVELDERRRR-------LSETEDELRRREESLAEREQEQL-------RALEEISG
RNY_PARUW       KLESRMNLVEKKLSDTEKREAILIGRKAQLDEEKKQTIESHSKLL-------SILEKASG
RNY_STAA2       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAA1       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAAE       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAAT       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAA8       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAAB       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAAC       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAAR       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAAS       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAAM       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAAW       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAAN       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAA3       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAA9       NLERKSDLLDKKDEILEQKESKIEEKQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAES       NLDRKSDLLDKKDEILEQKESKLEERQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAEQ       NLDRKSDLLDKKDEILEQKESKLEERQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAHJ       NLDRKSDLLDKKDEILEQKESKLEERQQQVDAKESSVQTLIMKHE-------QELERISG
RNY_STAS1       NLERKSDLLDKKDEILEQKESKLEERQQQVDAKESSVQTLINKHE-------QELERISG
RNY_BACHD       ILDRKSETLDKKEESLDKREESLTKKQRQIEEMDSKVEEILNKQQ-------VELERISG
RNY_BACSK       ILDRKSETLDKKEESLEKREESLAKKQRQVEEMESKMSQLLVEQK-------QELERVSG
RNY_EXIS2       TLDRRVDSIDRKEEQINTRDAEIAKRKHQAEELERKVEDLYEQGR-------QELVRVAN
RNY_BACSU       NLDRKHEGIDKREAMLEKKDHSLNERQQHIEEMESKVDEMIRMQQ-------SELERISS
RNY_BACVZ       NLDRKHEGIDKREAMLEKKDHSLNERQQHIEEMESKVDEMIRMQQ-------SELERISS
RNY_BACLD       NLDRKDESLDKREAMLEKKDHSLNERQQHIEEMESKVDEMIRMQQ-------SELERISS
RNY_BACP2       NLDRKDESLDKRESLLEKRDHSLNERQQHIEEMESKVDDMIRLQK-------AELERISS
RNY_BACAN       NLDRKDETLDKRELQLEKKEDSLVARQQQIEELESKVGELVQKQQ-------TELERISN
RNY_BACAH       NLDRKDETLDKRELQLEKKEDSLVARQQQIEELESKVGELVQKQQ-------TELERISN
RNY_BACHK       NLDRKDETLDKRELQLEKKEDSLVARQQQIEELESKVGELVQKQQ-------TELERISN
RNY_BACCZ       NLDRKDETLDKRELQLEKKEDSLVARQQQIEELESKVGELVQKQQ-------TELERISN
RNY_BACC1       NLDRKDETLDKREQQLEKKEDSLVARQQQIEELESKVGELVQKQQ-------TELERISN
RNY_BACCR       NLDRKDETLDKREQQLEKKEESLVARQQQIEELESKVGELVQKQQ-------TELERISN
RNY_BACMK       NLDRKDETLDNRERQLEKKEESLVAKQQQIEELESKVGELVQKQQ-------TELERISN
RNY_BACCN       NLDRKDETLDKREQMLEKKEESLVARQQQIEELESKVGELVQKQQ-------TELERISN
RNY_GEOKA       NLDRKDEALNKREALLEAKEEALNERQQHIEQMESKVEALVKQQQ-------AELERISG
RNY_GEOTN       NLDRKDEALNKREALLEAKEEALNERQQHIEQMESKVETLIKQQQ-------TELERISG
RNY_LYSSC       NLDRKDDTLNKREASLERKEQALAERQQHIEQMESKVDELVASQK-------TELERISA
RNY_OCEIH       NLDRKSETLDKRESSLESKEQSLTEQQQQIEEMKSKVEAMKDEQQ-------AELERISG
RNY_LISIN       NLDRKDTSLSKREATLERKEESISKRQQQIEEKESKLAEMIQAEQ-------TELERISA
RNY_LISMO       NLDRKDTSLSKREATLERKEESISKRQQQIEEKESKLAEMIQAEQ-------TELERISA
RNY_LISMF       NLDRKDTSLSKREATLERKEESISKRQQQIEEKESKLAEMIQAEQ-------TELERISA
RNY_LISW6       NLDRKDTSLSKREATLERKEESISKRQQQIEEKESKLAEMIQAEQ-------TELERISA
RNY_LACPL       TLDHKENTFEKREDALGKKEDKIANEQKRVEQQQQSAASLITQRQ-------AELERVAA
RNY1_LACBA      TLDRKDNSLEKRENSLNRRDKKLSAEEQNLVKKQQQADSLIEKRQ-------AAVEAVAA
RNY1_PEDPA      SLDRKDNSFEKRENSLERKEQKLALDQKHIDEQQQKASSLVEERQ-------QELERVSN
RNY_LACP3       TLDRRDDTLDRKEQSLADREANLNKRQQQLDEREQDISSEISKQH-------TELERIAE
RNY_LACSS       TMDRKDATLDKKERTLEEHESRLAEQAQQLKEKQAEVETLVEQQR-------TKLQEIAE
RNY_ENTFA       TLDRKDDSLEKREGSLEEKEEKLGARQQLIDEREKEVENLINQQH-------QELERIAS
RNY_LACS1       ILDRKDTALDKREDVLEKKEAQLDSDQKVVTKQKEQASLLVKEQQ-------DKLEEIAA
RNY_LEUCK       NLDKKDAALNQRDAQLIQKENQVQQRLDDANNKQKLADNLVTSQK-------EKLEEIAQ
RNY_LEUMM       NLDKKDAALNQRDASLIQKENQVQTRLDDADKKEVLAQKLLTTQQ-------DKLEEIAQ
RNY_LACLM       ILDRKDDTLTKKEENLDSKEENLVRKTDTLSKREEQLAHIEEKKR-------LELERISN
RNY_LACLS       ILDRKDDTLTKKEENLDSKEENLVRKTDTLSKREEQLAHIEEKKR-------LELERISN
RNY_LACLA       ILDRKDDTLTKKEENLDSKEENLVRKTDTLSKREEQLAHIEEKKR-------LELERISN
RNY_STRA3       SLDRKDENLSNKEKMLDSKEQSLTDKSRHINEREQEIATLETKKV-------EELSRIAE
RNY_STRA1       SLDRKDENLSNKEKMLDSKEQSLTDKSRHINEREQEIATLETKKV-------EELSRIAE
RNY_STRA5       SLDRKDENLSNKEKMLDSKEQSLTDKSRHINEREQEIATLETKKV-------EELSRIAE
RNY_STRPM       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRPF       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRPG       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRPB       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRPC       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRP3       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRP6       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRP1       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRP8       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRPD       TLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKK-------AELEKVAA
RNY_STRMU       SLDRKDENLSSKEQLLDSKEQSLSDKSRHIDERELQVKQLEVKKA-------EELEKIAS
RNY_STRT2       SLDRKDENLSSKELALEKKEQSLADKSKHLNEREENVTQLEAEKQ-------AELERIGQ
RNY_STRT1       SLDRKDENLSSKELALEKKEQSLADKSKHLNEREENVTQLEAEKQ-------AELERIGQ
RNY_STRTD       SLDRKDENLSSKELALEKKEQSLADKSKHLNEREENVAQLEAEKQ-------AELERIGQ
RNY_STRPN       SLDRKDDNLTSKEQTLEQKEQSISDRAKNLDAREEQLEEVERQKE-------AELERIGA
RNY_STRR6       SLDRKDDNLTSKEQTLEQKEQSISDRAKNLDAREEQLEEVERQKE-------AELERIGA
RNY_STRPI       SLDRKDDNLTSKEQTLEQKEQSISDRAKNLDAREEQLEEVERQKE-------AELERIGA
RNY_STRP2       SLDRKDDNLTSKEQTLEQKEQSISDRAKNLDAREEQLEEVERQKE-------AELERIGA
RNY_STRGC       SLDRKDDNLTNKEKLLEQKEQSLSDKTKYIDEREEQLAELEKQKE-------AELERVAS
RNY_STRSV       TLDRKDDNLSNKEKALEQKEQSLSDKSKHIDAREEQVAELEKQKA-------AELERVAS
RNY_STRSY       SLDRKDDNLTNKEKTLEQKEQSLTDKAKHIDEREQEVVKLEEQKA-------LELERVAA
RNY_STRS2       SLDRKDDNLTNKEKTLEQKEQSLTDKAKHIDEREQEVVKLEEQKA-------LELERVAA
RNY_LACAC       TLDHKNSLLDEREAGLTEKEDQLKQQNASLKAKLDEADELVGIRR-------QKLYDVAK
RNY_LACH4       TLDHKNSLLDEREAGLTKKEDQLKQQYTSLKAKLTEADELVEARR-------QKLYDVAK
RNY_LACDA       TLDHRSSLLDDREKQLTQRKAQIKQQEEKVAGLLEEAHGLVEKQN-------DKLLEISR
RNY_LACDB       TLDHRSSLLDDREKQLTQRKAQIKQQEEKVAGLLEEAHGLVEKQN-------DKLLEISR
RNY_LACGA       AIDHKDSLLDQKDSQLTQKENQIKKLQAQVLEKEKRADQLVTERE-------QKLYEVAE
RNY_LACJO       AIDHKDSLLDQKDSQLTQKENQIKKLQAQVLEKENRADQLVTERE-------KKLYEVAE
RNY_AYWBP       LLNNRTESLNKREEHLDSEKQIISHTKKNLEQQIKEQETILNTQK-------QQLEKIAS
RNY_ONYPE       LFNNRTESLNKREEHLDSEQQIISHTKKNLEQQIKEQETILNTQK-------QQLEKIAS
RNY_ACHLI       ALNQRSQYLDKREIGLDAKEERHNERKEQLDIQYSKVEELIKEQE-------EKLSSISA
RNY_MAGMM       QLDRKIEQVDRRDQELDQRRGQLDKEQKKVEERQQHFERLIVDAD-------KKLEEIAG
RNY_THEMA       LLTRKEENLEKREQQVEELKANLEEKMREVEEKEKRID--------------EELKRLAG
RNY_THESQ       LLTRKEENLEKREQQVEELKANLEEKMREVEEKEKRID--------------EELKRLAG
RNY_THEP1       LLTRKEENLEKREHQIEELKANLEEKMREVEEKEKRID--------------EELKRLAG
RNY_PSELT       IISKREELVDKKETALEQLRVQLEAAKKKIEQREKELD--------------ERFTKLAG
RNY_FERNB       MLSKREELIDKRENYVENLKIELESKAKEIEEKAKEIE--------------RRFIELAG
RNY_THEM4       MVSKREELLDKKENYVEELRKELDQRQRDLEAKEKELT--------------ERFEKLAG
RNY_PETMO       SLAKKEE-------NLEKLKEKLEVQHENVLKLEKELE--------------TKLNEIAK
RNY_AQUAE       ALEKREEELLHRERELKDFERSLERWRDEIRHKEEELKHMKEEVEELKKKELEELQRIAK
RNY_BACFR       VLSQRQEEIQRKRAEADAVRENLEAQLGIVDKKKEELDKLQHQEI-------EKLEALSG
RNY_BACFN       VLSQRQEEIQRKRAEADAVRENLEAQLGIVDKKKEELDKLQHQEI-------EKLEALSG
RNY_BACTN       VLSQRQEEIQRKKLEAEAVKENLEAQLVIVDKKKEELDKLQHQEI-------EKLEAISG
RNY_BACV8       MLNQKQEEVQRKRTEAEAIKENLEAQIVIIDKKKDELDKLQMQER-------EKLEALSG
RNY_PARD8       TMNQRQEELQRRNNEVEAVKENLSSQLELVEKKKQDLDKLHQKEV-------EHLEAISG
RNY_PORGI       TLNQRQEDITKKGQEMDLMRENLTAQLSVIEKKKTELDELKTREQ-------AHLESLSG
RNY_CYTH3       TISKQMETNTRREAELDSLRENLSSQLEILNKRKEELEKLRHSQI-------EKLEKIAG
RNY_FLAJ1       QVSNELSKAKKVNDEFEAKTAEYNNKIEVLDKKQAEVDKLHKSQL-------QQLEVISG
RNY_FLAPJ       QVSGELSKAKKINDDFEAKTNEYNTKLENLEKKQVEVEKMHKSQL-------QQLEVISG
RNY_GRAFK       HVSNELGKNKKLNKDLEEKVADYDHRLDFLEKKQEDIDKLHNSKV-------QQLEVISG
RNY_PELLD       QLKKQLQDVRDTERKLQDQQKELDQAMETVGIRATELERIITEQN-------QRLESISN
RNY_CHLPM       QLKKQAQDNRDMERRLQDQRKENEQVQESVTLRAAELERIISEQN-------ERLESISG
RNY_CHLPD       QLKKQSQDLRDMERKLQDQRKEIEQTMETVNLRSSELERITLEQN-------QRLESISN
RNY_CHLCH       QLKKQSQDVRDAERKLQDQRKEVEQLSDSVKLRATELERVIVEQN-------QRLESISN
RNY_CHLTE       TLANQMRDIKETEKKLQEQREELKHQTQNVQNRSAELEKTILEQN-------QRLESISN
RNY1_BDEBA      QFKQKMEENERYLNSLKDREEKIAISENRIKDLEKKGEAHIGELK-------QKLESVAA
RNY2_BDEBA      IVQEEKKKLQDREADVKVQEQALRGQEAELGKLKEAQKALNQELV-------QKLTERLG
RNY2_LACBA      LLGQMGVRLADQTAILDERSQANRDQRQKIRDLKAQALQLRTDRD-------EMLAQQAG
RNY2_PEDPA      LLNQKKIVLTNRADALAKKRQSLLQERDNVRTTLGEAKQLITDRW-------NKLQEVAD
RNY_MYCGE       KIKLLKNQNFTESNKLIATTNELNELTSQLDNILVRIINKPLAKL-----------VNDF
RNY_MYCPN       QIVNLKQQNGAKIKELANLKDQLSELGQKFNTTLSEIINKPLVNV-----------IDEY
                                                                            

RNY_UREPA       LTAEQAKKELFNLLKIKFKKELAQEYAKIKHEFNEAQEIYAQNILVETMEQIAEPLIVER
RNY_UREP2       LTAEQAKKELFNLLKIKFKKELAQEYAKIKHEFNEAQEIYAQNILVETMEQIAEPLIVER
RNY_MYCPE       ISEYQKK---LNLEKIKLIDQMEKE---IKDNLNEKAVYY----MINAMEQHAEDIISSK
RNY_MYCCT       LTKSQAKELLIKQVKNKSEKELISILKNAELQAHSNSKMIANNIIISAMERIKVELTSQR
RNY_MYCMS       LTKSQAKELLIKQVKNKSEKELISILKNAELQAHSSSKMIANNIIISAMERIKVELTSQR
RNY_MESFL       MTSFEAKAELMKNVESKIQYEIVSQIKQAENLAHARAKELSNNIILSAMERFKTDIVNEK
RNY_CAMJR       LTQNEAKEIILKKVEENSREQIAHIVRKYEEEAKNEAKRKANFIIAQATSRFAGEFAAER
RNY_CAMJJ       LTQNEAKEIILKKVEENSREQIAHIVRKYEEEAKNEAKRKANFIIAQATSRFAGEFAAER
RNY_CAMJE       LTQNEAKEIILKKVEENSREQIAHIVRKYEEEAKNEAKRKANFIIAQATSRFAGEFAAER
RNY_CAMJ8       LTQNEAKEIILKKVEENSREQIAHIVRKYEEEAKNEAKRKANFIIAQATSRFAGEFAAER
RNY_CAMJD       LTQNEAKEIILKKVEENSREQIAHIVRKYEEEAKNEAKRKANFIIAQATSRFAGEFAAER
RNY_CAMC1       LTEEEAKEVVLKKVEEKSRADIAHIVRKYEEEAKREAKKRVNYILAQATSRFAGEFAAER
RNY_CAMC5       LTEDEAREVVLKKVEEKSRADIAHIVRKHEEEAKREAKKRVNYILAQATSRFAGEFAAER
RNY_CAMFF       LTEDEAKNMVLRKVEEKSRAEIAHIVRKYEEEAKKEAKKRANYILAQATSRYAGEFAAER
RNY_CAMHC       LTEDEAKSEILQKVEEKSRAEIAHIVRKYEEEAKKEAKRNANYILAQATTRYAGEYAAER
RNY_NITSB       LTLEEAKNLILQKAEEESRLEIANIVRKYEEEAKREAKRRANYIIAQATTRFAGEFAAER
RNY_SULDN       MTKEEATRVLLEKVEEKSRSEIAHVVRRYENEAKVEAKKRANYILAQATSRFAGEFAAER
RNY_HELHP       MTREEATNILLSHLEEELIEEKAFLIRRYEKQAYDEAKKQANFVLAQATTRYAGDFATER
RNY_WOLSU       LTQEEAKELALAKATEESRAQIAQIVRKYESEAKEEGRKRANYILAQATTRFAGEFAAER
RNY_SULNB       MTQEEAKAYILEKVEEQSRAEIASIVRRYEQLAKEEGEKKANYILAQATTRYAGEFAGER
RNY_ARCB4       LTQSEAKELMLKKVKEDSRAEISSIFRKRYKIAEQNTKNEINNMLSQAVTRYAGEFAAER
RNY_HELPY       YTKDEIKSMILEQLEEELEAQKSALIRRYEKEAKEEGKKKSYAILAEATARFAGNYAAEN
RNY_HELPH       YTKDEIKNMILEQLEEELEAQKSALIRRYEKEAKEEGKKKSYAILAEATARFAGNYATEN
RNY_HELPJ       YTKDEIKSMILEQLEEELEAQKSALIRRYEKEAKEEGKKKSYAILAEATARFAGDYATEN
RNY_HELAH       YTKEEIKSMILKQLEEELEAQKSALIRRYEKEAKEESKKKSYAILAEATARFAGNYAIEN
RNY_BORBU       LTREDARKIVIEKVEHESKRDAQVIINKSEQEAQLLADKVAKDILVSTMQRIVTEVSSEF
RNY_BORAP       LTREDARKIVIEKVEHESRRDAQVIINKSEQEAQLLADKVAKDILVSTMQRIVTEVSSEF
RNY_BORBP       LTREDARKIVIEKVEHESRRDAQVIINKSEQEAQLLADKVAKDILVSTMQRIVTEVSSEF
RNY_TREPA       LTQNQARDLIIKNLENEAKHDAQALINKIEEDAALNAERRARDILVTTMQRITADVTGDV
RNY_TREDE       LTQQQAKDLIIRDLEAEAKHDAVTIINKIEQEAQLTAEKKAQDILITTIQRLATETASDI
RNY_UNCTG       MTREEAKKILISGMEEDAKQCAAVLLQKLEQEMRENADKKSKEILSIAIQRVAADHTADI
RNY_GEOMG       LSSTEAKKILMDAMESEAKLDAAKRIKVIEEEARETADKKSKEIMALAIQRYAGEYVAER
RNY_GEOSL       MSSAEAKKILMDAMESEAKLDAAKRIKAIEEEARETADKKSKEIISLAVQRYAGEYVAEK
RNY_GEOUR       MTAAEAKKILMETMENEAKLDAAKRIKAIEEEARETADKKSKEIMALAIQRYAGEYVAER
RNY_PELPD       MSASEAKKELMTSMEDEAKHDAAKRIKAIEEEARETADKKAKEIISLAVQRYAGEYVAEK
RNY_PELCD       LGAEEAKAQLMEQMESEARHECAKKIKQIEDEAKEAADKKAQEILALAVQRYAGDFVAES
RNY_SYNFM       ISAQQAKEMLARAIENEARHDAALMVKKIETEARETADRKAKNIISLAIQRYAGDYVAEK
RNY_SYNAS       ITSEEAKDFLIRSMEAAAKRDAAMLIRKIEEDAKREADKKSREIIAYAVQRYAGDYVAEN
RNY_DESPS       ITQDEAKKLLMESIESEAQMDAAKRLSKIENEMKLEADRKARSILALAICRYAGDYVADK
RNY_DESVH       LTAEEARARIMEEVEARTRHESAKMIRVIEMEARETADRKAKEILASAIQRYAGDYVGEQ
RNY_DESVV       LTAEEARARIMEEVEARTRHESAKMIRVIEMEARETADRKAKEILASAIQRYAGDYVGEQ
RNY_DESAG       LTSEEAKARIFSEVEARTRHEAGKMIRVIETEAKETASRSAQKILATAVQRYAGDFVNEQ
RNY_LAWIP       LTVEEAKQSLFEEVKNRSRHESAKMMRLIEAEAVETANRKAKEIIANAIQRYAGDYVSEH
RNY_CLOB1       LTTEQAKEFLLEQVRKEVKHETAVMIKEIETKAKEEADKRAREVITYAIQRCAADHVAET
RNY_CLOBH       LTTEQAKEFLLEQVRKEVKHETAVMIKEIETKAKEEADKRAREVITYAIQRCAADHVAET
RNY_CLOBM       LTTEQAKEFLLEQVRKEVKHETAVMIKEIETKAKEEADKRAREVITYAIQRCAADHVAET
RNY_CLOBL       LTTEQAKEFLLEQVRKEVKHETAVMIKEIETKAKEEADKRAREVITYAIQRCAADHVAET
RNY_CLOBK       LTTEQAKEFLLEQVRKEVKHETAVMIKEIETKAKEEADKRAREVITYAIQRCAADHVAET
RNY_CLOK5       LSSEEAKDILLEEVNKEIKHESAMMIKEVETKAKEEADKRAREIITSAIQRCAADHVAET
RNY_CLONN       LSSDEARELLLEETKKEIRHDLAVMIKEMENKAKEEADKKAKEIISTAIQRCAADHVAES
RNY_CLOTE       LTSDQAKEMLLEEVRKEIKHETAMLIKEVETKAKEEADKKAREITTYAIQRCAADHVAET
RNY_CLOAB       LTSEEAKNLLLEEVNREIKHEKSIMIKEVEQKAKEEADKKAREIITYAIQRCAADHVAES
RNY_CLOPE       LSSEDARTLLLDEVRREIKHESAMLIKELETKAKEEADKKSREIITTAIQRCAADHVSET
RNY_CLOP1       LSSEDARTLLLDEVRREIKHESAMLIKELETKAKEEADKKSREIITTAIQRCAADHVSET
RNY_CLOPS       LSSEDARTLLLDEVRREIKHESAMLIKELETKAKEEADKKSREIITNAIQRCAADHVSET
RNY_CLOB8       LSSEEAREILLDEIRKEITHDAALMIKDIESKAKEEADKRAREVITTAIQRCAADHVSES
RNY_THEP3       LSREEAKAILLENVQKDIQHEMAVMIKEMENKAKEEAEMKAREIIGNAIQRCAADHAAET
RNY_THEPX       LSREEAKAILLESVQKDIQHEMAVMIKEMENKAKEEAEMKAREIISNAIQRCAADHAAET
RNY_CALS4       LTQEEAKSILLESVQKEIQHDMAVMIKEMENKAKEEADRRAREIVGLAIQRCAADHAAET
RNY_NATTJ       LTTQEAKDMLLNRVREDISHETAMMIKEMESRAKEEADKKAREIITTAIQRCAVDHVAES
RNY_ALKMQ       LTSQQARELLLSDVEKEVKYEAAMMVKDIETKAKDDADKKAREIITLAIQKCAADHVAET
RNY_ALKOO       LTSEEARELILSDVEKQTKYEVALMIKDIESKAKEESEKKAREVIAYSIQKCAADHVAET
RNY_CLOD6       ITSDKAKEIILTNAERDVRREMSIMIKEIESQAKEEADKKSREIIGYAIQKCAADHVAET
RNY_DESRM       LSSEEARQILLNDVEKELQHDMAVMIKDFENRAKEEADKKARDIISSAIQRCAADHVAEA
RNY_PELTS       MTSEEAKQALLSDIEKEIQHEAAMLIKEIESKAREEGEKRARDIISLAIQRCAADHVAEA
RNY_DESAP       LSTEEARQILLQDVEKEIQQEAALLVKEIEGRAKEEADRRARNIISLAIQRCAADHVAES
RNY_CARHZ       LSTEEARELLLKQVEEEVQQEMALLIKEIETKAKEEAEKRAREIITLAIQRCAADHAAET
RNY_DESHY       LSTEEAKQILLQSVEEEVRYESAIMIKDIETKAKEEAEKRAKNIISLAIQRCAADHVAES
RNY_HELMI       LTSEEARTLLLSNIEDEVKHEAAMMIKTIENQAKEEAEKRAREIISLAIQRCAADHVAES
RNY_MOOTA       LTTEAARNILLKNVEEEIRHETAMLIKQVEAEAKEEAEKRAREIITYAIQHCAADYVAEA
RNY_LACP7       LTSEQAKEYLIKTVEDEVKHETAVLIKELESRAKEEAEKKAKDYVVTAIQKCAADHVAET
RNY_HUNT2       LSVDEAKEVLLKNVENEVKHEMAILIKDIEAKAKEEAEIRAKNIIAMAIQKCAADHVSEV
RNY_CALS8       LTQEEARQIILKSVEQDVKHDVALMIKELEQQAKEEADKKAREIIALAIQRYSSDYVAEN
RNY_SYMTH       LTMEEARELFLKQVEQEARADAAKLIREIDAEARENAEKRARELVGLAVQRVAADHSSEL
RNY_SYNWW       LSSEEAKELLLYNVSQQIRQETAVLIRNIENEAKEEADKKAKNIVSLAIQKCAADVVSES
RNY_FINM2       LTSDEAKNIVLERVKTETIREQAAIIKEIESKTKEESEKFAREIISTSIQRYAADQVAES
RNY_FUSNN       LTKADAREILLRKVREEMTHDMAITIREFENKLDEEKEKISQKILSTAIGKAAADYVADA
RNY_ROSCS       LSQEEARAIILKRVEDETRDEAARRIREIEKTMHEEADKLARKVISMAIQRCASDYVAEV
RNY_ROSS1       LSQEEARAIILKRVEDETRDEAARRIREIEKNVREEADKLARKVISMAIQRCASEYVAEV
RNY_CHLAA       LSREEARSIILAEVERETREDAARRIRELEQQTKEEADKIARKIIGLAIQRCASDYVAEM
RNY_DEHMB       MTTEQAKTSLLEMLEGEMQQETSRRLREWEIKIKAEADEKAREVVSQAIQRCASDVVTET
RNY_DEHMC       MTTEQAKTSLLEMLEGEMQQETSRRLREWEIKIKAEADEKAREVVSQAIQRCASDVVTET
RNY_DEHM1       MTTEQAKSSLLEMLEGEMQQETSRRLREWEIKIKAEADEKAREIVSQAIQRCASDVVTET
RNY_DEIRA       LTPEVAREQILGRLNAELEEEKAIRVKAMTEKAGAEARRSARSIIAQAIQRSASETSAQL
RNY_DEIGD       LTPEAAREQILRQLDAELEEEKAIRVKAMTERATAEARRTARNVIAQAIQRSASETSSQM
RNY_THET2       LTPEEARRLVLERLDRELEEEKAQRVRAALERARLEARREAQKILAQAMQRQASETAAQL
RNY_THET8       LTPEEARRLVLERLDRELEEEKAQRVRAALERARLEARREAQKILAQAMQRQASETAAQL
RNY_SALAI       ITAEAARGELVEAIEAQAKREAALLVREIESEARNTGEERARHIVVDAIQRVASEQTAES
RNY_SALTO       LTAEAARGELVEAIEAQAKREAALRVRDIEAEARSTGEERARHIVVDAIQRVASEQTAES
RNY_ACIC1       LTAEAAKAELVALIENQAKRDAALTVREIERAATEEAERRAREIVTTAIQRVASEQTAES
RNY_FRASN       LTSAEARTELVKVVEDQARLDAAVRVRDIEARAEEEAEDRARRIVTLAIQRVASDQTAES
RNY_THEFY       LTAEEAKAALVADIVDQAKREAAVLVRAIERDARTNGEARARRIISLAIQRLAGEQTSES
RNY_CUTAK       MSLDEARDELVEHLGREARVFAENSARAIVTEATASAEAKARHIVAEVIQRCSSEMVADT
RNY_RHOBA       MTQEEAAEKLMQSLRQDLEHEIGSTVLKHQRELGRRVDAQAREMLLTAMQRYASVHTADT
RNY_OPITP       MDAESIRQALREEVQLECQDELRALRREIMEKSEQDLQTEGRRIMIAAMQRLASKPNNDL
RNY_RUBXD       LSRAEAEERLFSRVEAELERRIGRMVRNRISEAEENADLEARRILATTMERLASDLTSES
RNY_PARUW       LTSSEAKEILLSRLSNEVKTESANLIRRIRKEAEEEAEKIASTIIATSINRLAVSCASES
RNY_STAA2       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAA1       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAAE       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAAT       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAA8       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAAB       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAAC       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAAR       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAAS       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAAM       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAAW       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAAN       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAA3       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAA9       LTQEEAINEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKTAKELLATAVQRLAADHTSES
RNY_STAES       LTQEEAVKEQLQRVEEELSQDIAILVKEKEKEAKEKVDKTAKELLATTVQRLAAEHTTES
RNY_STAEQ       LTQEEAVKEQLQRVEEELSQDIAILVKEKEKEAKEKVDKTAKELLATTVQRLAAEHTTES
RNY_STAHJ       LTQEEAVNEQLQRVEEELSQDIAVLVKEKEKEAKEKVDKKAKELLATTVQRLAADHTTES
RNY_STAS1       LTQAEAAQEQLQRVEDELSQDIAILVKEKEREAKEAVDKNAKELLATTVQRLAAEHTSES
RNY_BACHD       FSREEAREVIRAEVEQEMAHETALLIKERVAKAKEEADKKAREILSLAIQRCSADHVAET
RNY_BACSK       LSREEARMIIRQEVEQEIAHETALLIKEKTAEAKETADKRSKEILSLAIQRCSADHVAET
RNY_EXIS2       LSQDEARAIIMDETKQAAMHDAAILQKEIEQKAKEEADKKARNILSLAIQRFAAEHIAET
RNY_BACSU       LTRDEAKQIILERVENELSHDIAIMTKETENRAKEEADKKAKNILSLALQRCAADHVAET
RNY_BACVZ       LTRDEAKQIILDRVENELSHDIAIMTKETENRAKEEADKKAKNILSLALQRCAADHVAET
RNY_BACLD       LTRDEAKQIILERVENELSHDIAIMMKESENRAKEEADKKAKNILSLALQRCAADHVAET
RNY_BACP2       LTRDEAKQIILDQVENELSHDIAVMTKESENRAKEEADKKAKNILSLALQRCAADHVAET
RNY_BACAN       LTREQAKAIILGKVESEVSHEIAVMVKESEVRAKEEADKKAKEILSLAMQRCAADHVAET
RNY_BACAH       LTREQAKAIILGKVESEVSHEIAVMVKESEVRAKEEADKKAKEILSLAMQRCAADHVAET
RNY_BACHK       LTREQAKAIILGKVESEVSHEIAVMVKESEVRAKEEADKKAKEILSLAMQRCAADHVAET
RNY_BACCZ       LTREQAKAIILGKVESEVSHEIAVMVKESEVRAKEEADKKAKEILSLAMQRCAADHVAET
RNY_BACC1       LTREQAKAIILGKVESEVSHEIAVMVKESEVRAKEEADKKAKEILSLAMQRCAADHVAET
RNY_BACCR       LTREQAKAIILGKVESEVSHEIAVMVKESEVRAKEEADKKAKEILSLAMQRCAADHVAET
RNY_BACMK       LTREQAKAIILGKVESEVSHEIAVMVKESEVRAKEEADKKAKEILSLAMQRCAADHVAET
RNY_BACCN       LTREQAKSIILGKVENELSHEIAAMVKESEVRAKEEADKKAKEILSLAMQRCAADHVAET
RNY_GEOKA       LTRDDARQLILERVEKELSHEIAMMIKEAETRAKEEADKRAKAILSLAIQRCAADHVAET
RNY_GEOTN       LTRDDARHLILERVEKELSHEIAMMVKEAETRAKEEADKRAKAILSLAIQRCAADHVAET
RNY_LYSSC       LTREEAKSIILNEVEKELATDIAVMTKEAETRAKEDSDKKAREILSLALQRFAADHVAET
RNY_OCEIH       YTSEQAKQIILERIEKEVQHESAVLIKESETRAKEEADKKAKNILSLALQRCAADHVAET
RNY_LISIN       LSKEEAKSIILNQVEEELTHDTAIMVKESENRAKEESDKKAKNILSLAIQRCAADHVAET
RNY_LISMO       LSKEEAKSIILNQVEEELTHDTAIMVKESENRAKEESDKKAKNILSLAIQRCAADHVAET
RNY_LISMF       LSKEEAKSIILNQVEEELTHDTAIMVKESENRAKEESDKKAKNILSLAIQRCAADHVAET
RNY_LISW6       LSKEEAKSIILNQVEDELTHDTAIMVKETENRAKEESDKKAKNILSLAIQRCAADHVAET
RNY_LACPL       LSQEQARDQILTQTREQLTHERAVLIKENTDEVKAQSEKEAKNLIVQAIQQSAADMVSET
RNY1_LACBA      LSQDDARELIISEAKTALASERAKMIKESEETARKTAQANAKDLIVSAIQRSAADMVTET
RNY1_PEDPA      LTQEDAKNLIISETEAKLEKERALIIKEGLEDAEAEADQTARKLIAEAIQRSAADMASET
RNY_LACP3       LTHEQARQQILDQTQSELTHERAVMIKESEDEAKEAADKKAKVLIADAIQRSASDIVAET
RNY_LACSS       LSHDDAQKIILDETKRNLDHERAVLIKESEESAKEHADRTAKTLVAEAIQRSAADMVAET
RNY_ENTFA       LSKEEAKSIIMKSTEEELNHELTLMVKESEQRAKEESDRKAKNLLSLAIQRCAADSVSET
RNY_LACS1       LTRPEAKELILNETKEELIHERAVMIKESEEETKATVDRKAKSLIAQAIQRSAADMVSET
RNY_LEUCK       LTPEDAKEQILSKTKQRLVRQRAALIKEYEEDATSEAEKRARNVIVQAIQRSSADAVADV
RNY_LEUMM       LSPDEAKKQILSETKASLTRQRAALIKEAEEEATSEAEKRARNIIVQAIQRSSADSVADV
RNY_LACLM       LSMDDAREIILSETRDGLTKEMAQTIRQSEEKAQAEADKRAKNIISLAIQRVSSDSVAEQ
RNY_LACLS       LSMDDAREIILSETRDGLTKEMAQTIRQSEEKAQAEADKRAKNIISLAIQRVSSDSVAEQ
RNY_LACLA       LSTDDAREIILSETRDGLTKEMAQIIRQSEEKAQVEADKRAKNIISLAIQRVSSDSVAEQ
RNY_STRA3       LSQEEAKDIILADTEKDLAHDIATRIKEAEREVKDRSNKIAKDLLAQAMQRLAGEYVTEQ
RNY_STRA1       LSQEEAKDIILADTEKDLAHDIATRIKEAEREVKDRSNKIAKDLLAQAMQRLAGEYVTEQ
RNY_STRA5       LSQEEAKDIILADTEKDLAHDIATRIKEAEREVKDRSNKIAKDLLAQAMQRLAGEYVTEQ
RNY_STRPM       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRPF       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRPG       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRPB       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRPC       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRP3       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRP6       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRP1       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRP8       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRPD       MTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQ
RNY_STRMU       LSQEQARGIILSETEKNLAHDIANRIKEAEREIKDRTDKTAKDLLAQAMQRLAGDYVAEQ
RNY_STRT2       MTIAEAREVILTETENNLTHEIATRIKDAEAQIKDTVDKKAKNLLAQAMQRLSGDYVTEQ
RNY_STRT1       MTIAEAREVILTETENNLTHEIATRIKDAEAQIKDTVDKKAKNLLAQAMQRLSGDYVTEQ
RNY_STRTD       MTIAEAREVILTETENNLTHEIATRIKDAEAQIKDTVDKKAKNLLAQAMQRLSGDYVTEQ
RNY_STRPN       LSQAEARDIILAQTEENLTREIASRIREAEQEVKERSDKMAKDILVQAMQRIAGEYVAES
RNY_STRR6       LSQAEARDIILAQTEENLTREIASRIREAEQEVKERSDKMAKDILVQAMQRIAGEYVAES
RNY_STRPI       LSQAEARDIILAQTEENLTREIASRIREAEQEVKERSDKMAKDILVQAMQRIAGEYVAES
RNY_STRP2       LSQAEARDIILAQTEENLTREIASRIREAEQEVKERSDKMAKDILVQAMQRIAGEYVAES
RNY_STRGC       LSQNEARDLILAQTEEKLTKEIAMRIREAEQEVKERSDKMAKDILVQAMQRIAGDYVAEQ
RNY_STRSV       LSQTEARDIILTQTEDKLSKEIATRIRDAEQDIKERSDKVAKNILVQAMQRIAGDYVAEQ
RNY_STRSY       LSQEEAKEIILTDTRDKLTHEIATRIKEAEREVKERSDKMAKDLLAQAMQRISGEYVAEQ
RNY_STRS2       LSQEEAKEIILTDTRDKLTHEIATRIKEAEREVKERSDKMAKDLLAQAMQRISGEYVAEQ
RNY_LACAC       LDKDQAKKIVLDQLSDELVKERAEMIRNSNEEVMAKADRYANQVIIDAIQSSAADTVAET
RNY_LACH4       LDKEEAKKIVLNKLSDELVKERAELIRNSNEEVKAKADHYASQIIVDAIQSSAADTVAET
RNY_LACDA       LDEEEAKKIVLAQVSDHLTKEKAELIRANEEEISARADRFAHQIIVDAIQSSAADTVAET
RNY_LACDB       LDEEEAKKIVLAQVSDHLTKEKAELIRANEEEISARADRFAHQIIVDAIQSSAADTVAET
RNY_LACGA       LSQEDAKKIVLDKLSDQLVKERAEMIEESNQLAKAKADHFARKVIVDAIQSSAADTVSEK
RNY_LACJO       LNQEDAKKIVLDKLSDQLVKERAEMIEESNQLAKAKADHFARKVIVDAIQSSAADTVSEK
RNY_AYWBP       LTQDQARQIIMKETRDQTTYEMMSYIKQEEEKAKSEASKKAKTLLVLAMQKYSGDITGEK
RNY_ONYPE       LTQDQARQIIMKETRDQTTYEMMSYIKQEEEKAKSEASKKAKTLLVLAMQKYAGDITGEK
RNY_ACHLI       LSREQARELIMAQVRDSISNEIAAYIRDEEDNAKSIAQNKSKEILSLAMQKYAAETTSER
RNY_MAGMM       LTRDEAKSRIQAELVDRARHEASRQLKQIEDDTRAQAQKKAQEVICSAIQRFAGEFVVDR
RNY_THEMA       MTVEEARELILEEARQRYEHDLAKLYKEMKEQVEEEAEKEAKKVIAFAVQRYAPDYVGEI
RNY_THESQ       MTVEEARELILEEARQRYEHDLAKLYKEMKEQVEEEAEKEAKKVIAFAVQRYAPDYVGEI
RNY_THEP1       MTVEEARELILEEARQRYEHDLAKLYKEMKEQVEEEVEKEAKKVIAFAVQRYAPDYVGEI
RNY_PSELT       MTVEEARQIVIDEARQKYEHDLAILYKKIKENYEEEAEKEAKKIIATAVQRYAPEYIGEI
RNY_FERNB       ITHEQAREIVLQEAREKYEHEIAKFFVQIKTRYEDEADKYAKKIIADAIQRYAPEYIGEV
RNY_THEM4       ITPAQAKEMVLEEAREKYEYEIAKVYSQIKARYEEDSEKYAKKVIADAIQRYAPEYSGEV
RNY_PETMO       MTEEEARQVVINEARDKYEREIAQKFKEIKDHYEEESKKYARWVITTAIQRYASDVTNEI
RNY_AQUAE       LTLEEARQEIIKKVEEEAKKDAVKLMKVIEEDAKRRAEFEAKKIIATATQRLAPQIAVNY
RNY_BACFR       LSADEAKERLVESLKEEAKTQAQSYINDIMDDAKLTASKEAKRIVIQSIQRVATETAIEN
RNY_BACFN       LSADEAKERLVESLKEEAKTQAQSYINDIMDDAKLTASKEAKRIVIQSIQRVATETAIEN
RNY_BACTN       LSADEAKERLVESLKEEAKTQAQSFINDIMDDAKLTASKEAKRIVIQSIQRVATETAIEN
RNY_BACV8       LSAEEAKERLIESLKEEAKTQAASYINDIMDDAKLTANKEAKRIVIQSIQRVATETAIEN
RNY_PARD8       LSAEEAKERLIESLKDEAKTQAASYINEIVEEAKMTANKEAKKIVIQSIQRVATETAIEN
RNY_PORGI       LSAAEAKDRLVESLKDEAKGQASAYVNEIIEEAKMTANKEAKRIVIQSIQRVATETAIEN
RNY_CYTH3       LTGEEAKAQLMDTIKEEARTEASSYIKRITDEAKMTATKDAKKIVIETLQRTATENAVEN
RNY_FLAJ1       LSAEEAKEQLVEGLKAEAKTKAMSHIQETIEEAKLTAQQEAKKIIINTIQRVGTEEAVEN
RNY_FLAPJ       LSTEEAKNQLIEGLKSEAKTQAMAHIQETIEEAKLTAQQEAKKIIISTIQRVGTEEAVEN
RNY_GRAFK       LSAEDAKAQLIESLKDTAKADAMSIIQDTVEEAKLTAQQEARKIIINTIQRIGTEEAIEN
RNY_PELLD       LQADEARQMLVDNMITKAREEATETIHKIHEEAEENAGRLAEKTLLTAIQRISFEQATEN
RNY_CHLPM       LQSEDARQMLIDNMISKAREEATETIHQIHEEAEQEAERLAEKTLLTAIQRITFEQATEN
RNY_CHLPD       LQADEARQMLVDNMLAKAREEATETIHQIHEEAEQQAERLAEKTLLTAIQRISFEQATEN
RNY_CHLCH       LQADEARQMLIDNMVTQAREEASNTIHRIHEEAEQQATRMAEKTLITAIQRISFEQTTEN
RNY_CHLTE       LTAEEARQMLIDNMIAKAREEAAETVHQIHEEATQKADRIAEKIMLTAIQRISFEQATES
RNY1_BDEBA      MSQDEARRQLLTALEDEAKQEAAKKIAQIEEEANKESEKKAKRILATALSRFASEYTSER
RNY2_BDEBA      TSAEEFKTQLKNQMEEESRRRAARMIQETEADTKEHAESEAKRILSLVIDRFARPYCAER
RNY2_LACBA      IDEQAAKDHVLADTELDLKRDRDVEIKALNDNAVANAERWAKDVVLSATESGPQDLPKEH
RNY2_PEDPA      LEEQAASKLVLKETKQDAIRSKDEFVNNAQTELESSCEREAEDLIALAMEHSDVPRGQAE
RNY_MYCGE       LDEQIKQIVKLDKNSSDFHSESDN--LPFYTKLFNDFHFGVDKLININIKNPL-YNWVYS
RNY_MYCPN       LDEQFKQAANFREAELNAVLDSNDQKTVFHKRLFNKFHFGVDKLANINVKNPLNLCWVDS
                                                                            

RNY_UREPA       SLFNIDIIDENLKGKIIGRDGRNKAVFENEGGVDLIVD-RQQPIVGISTPNPIRREIARI
RNY_UREP2       SLFNIDIIDENLKGKIIGRDGRNKAVFENEGGVDLIVD-RQQPIVGISTPNPIRREIARI
RNY_MYCPE       FSFTIKLENEGMKGKIIGKDGRNKRHFEQTTKTDLIIE-PNMPAITISSPNPIRREKAKR
RNY_MYCCT       TTNIVKLPSDDLKGRIIGKDGRNMKAFKQIGGVDIVID-ETPNTVVVSSFNPIRREIATR
RNY_MYCMS       TTNIVKLPSDDLKGRIIGKDGRNMKAFEQIGGVDIVVD-ETPNTVVVSSFNPIRREIATR
RNY_MESFL       TTNLVKLPNDDIKGWIIGKDGRNLKTFEQLAGVEIIVD-DTPEVVTISSFNPIRREIATK
RNY_CAMJR       LINVINIKNDELKGRIIGKEGRNVKTLEMVLGVDIIID-DTPGAIIVSCFNLYRRAIATK
RNY_CAMJJ       LINVINIKNDELKGRIIGKEGRNVKTLEMVLGVDIIID-DTPGAIIVSCFNLYRRAIATK
RNY_CAMJE       LINVINIKNDELKGRIIGKEGRNVKTLEMVLGVDIIID-DTPGAIIVSCFNLYRRAIATK
RNY_CAMJ8       LINVINIKNDELKGRIIGKEGRNVKTLEMVLGVDIIID-DTPGAIIVSCFNLYRRAIATK
RNY_CAMJD       LINVINIKNDELKGRIIGKEGRNVKTLEMVLGVDIIID-DTPGAIIVSCFNLYRRAIATK
RNY_CAMC1       LINVVNIKNDELKGRIIGKEGRNIKTLEMVLGVDIIID-DTPHAIILSSFNLYRRAIATR
RNY_CAMC5       LINVVNIKNDELKGRIIGKEGRNIKTLEMVLGVDIIID-DTPHAIILSSFNLYRRAIATR
RNY_CAMFF       LINVVNIKNDELKGRIIGKEGRNIKTLEMVLGVDVIID-DTPHAIILSSFNLYRRAIATR
RNY_CAMHC       LINVVNIKNDDLKGRIIGKDGRNIKTLEMISGVDVIID-DTPNAIILSSHNLYRRAIAVR
RNY_NITSB       LINTVSIPSEDIKGRIIGKEGRNIKTLEMLLGVDIIID-DTPNAIILSSFNLYRRAIATK
RNY_SULDN       LTNLVHLNDDELKGRIIGKEGRNIKTLETLLGVDIIID-DTPNAILVSSFNLYRRAIATK
RNY_HELHP       LVNVINLPNDELKGRIIGKEGRNIKTLETISGVDVIVD-DTPGSIILSSFNLYRRAIATK
RNY_WOLSU       LINVVNLPNDELKGRIIGKEGRNIKTLEMLSGVDVIID-DTPGAIVLSSFNLYRRAIATR
RNY_SULNB       LINLVNLPSDEHKGRIIGKEGRNIKALEMLLGVDIVID-ETPGVILVSSFNLYRRAIATR
RNY_ARCB4       LINNIPLNDEETKGKIIGKEGRNIKALEMLLGVDIIID-DTPNTITVSSFNLYRRAVATK
RNY_HELPY       LTTRIALPCSDYIGRVIGKDGKNIEAFKKVSGVDIEFS-EDSSELCLSSFNLYRREVASE
RNY_HELPH       LTTRIALPCSDYIGRVIGKDGKNIEAFKKVSGVDIEFS-EDSSELCLSSFNLYRREVASE
RNY_HELPJ       LTSRIALPCSDYVGRVIGKDGKNIEAFKKISGVDIEFS-EDSSELCLSSFNIYRREVASE
RNY_HELAH       FTNRIALPCSEYIGRVIGKDGKNIEAFKKISGVDIEFS-EGDKELCLSSFNIFRREVASE
RNY_BORBU       TVASVELPNDEMKGRIIGKEGRNIRALETLIGADIIID-DTPEAVVISCFDPIRKELAKR
RNY_BORAP       TVASVELPNDEMKGRIIGKEGRNIRALETLIGADIIID-DTPEAVVISCFDPIRKELAKR
RNY_BORBP       TVASVELPNDEMKGRIIGKEGRNIRALETLIGADIIID-DTPEAVVISCFDPIRKELAKR
RNY_TREPA       TVSTVNLPSEEMKGRIIGREGRNIRALETLTGADVVVD-DTPEAVVISCFDPVRKEIARI
RNY_TREDE       TVSTVSLPSDEMKGRIIGREGRNIRALETLTGVDIIID-DTPEAVVVSCFDPVRKEIARV
RNY_UNCTG       TTSTIQISNDEIKGRIIGREGRNIKAFEHATGVDLIVD-DTPESITISAFDGIRRQIAKI
RNY_GEOMG       SVSVVALPSDEMKGRIIGREGRNIRALEAATGIDLIID-DTPEAVILSGFNPVRREVAKI
RNY_GEOSL       TVSVVALPSDEMKGRIIGREGRNIRALEAATGIDLIID-DTPEAVILSGFNPVRREVAKI
RNY_GEOUR       TVSVVALPSDEMKGRIIGREGRNIRALEAATGIDLIID-DTPEAVILSGFNPVRREVAKL
RNY_PELPD       TVSVVPLPSDEMKGRIIGREGRNIRALEAATGIDLIID-DTPEAVILSGFNPVRREVARM
RNY_PELCD       AVSVVPLPNDEMKGRIIGREGRNIRAIEAATGIDLIID-DTPEAVIISGFNPVRREVARL
RNY_SYNFM       TVSVVNLPNEEMKGRIIGREGRNIRAIEASTGVDLIID-DTPEAVILSGFNPVRREVARV
RNY_SYNAS       TVSVVNLPNDEMKGRIIGREGRNIRAIEAATGIDLIVD-DTPEAVVLSSFDPIRREVAKI
RNY_DESPS       TVSMVPLPSDEMKGRIIGREGRNIRAIEAATGIDIIID-DTPEAVILSGFNPVRREVARL
RNY_DESVH       TVTAVTLPSEDMKGRIIGREGRNIRALEAATGVDLIID-DTPETVILSAYSPLRRQVAKM
RNY_DESVV       TVTAVTLPSEDMKGRIIGREGRNIRALEAATGVDLIID-DTPETVILSAYSPLRRQVAKM
RNY_DESAG       TVTAVSLPSEDMKGRIIGREGRNIRALEAATGVDLIID-DTPETVILSAYSPLRRQIAKM
RNY_LAWIP       TVTAVTLPSEDMKGRIIGREGRNIRALESATGVDFIID-DTPETVVLSAYSPMRRQVAKM
RNY_CLOB1       TVHVVNLPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSGFDPIRREVARI
RNY_CLOBH       TVHVVNLPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSGFDPIRREVARI
RNY_CLOBM       TVHVVNLPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSGFDPIRREVARI
RNY_CLOBL       TVHVVNLPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSGFDPIRREVARI
RNY_CLOBK       TVHVVNLPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSGFDPIRREVARI
RNY_CLOK5       TVHVVTLPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSGFDPIRREVARI
RNY_CLONN       TVHVVSLPNDEMKGRIIGREGRNIRALETLTGVDLIID-DTPEAVILSGFDPIRRQVARI
RNY_CLOTE       TVYVVNLPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSAFDPVRREVARI
RNY_CLOAB       TVYVVSLPNDEMKGRIIGREGRNIRAIETLTGVDLIID-DTPEAVILSGFDPVRREVAKV
RNY_CLOPE       TVHVVALPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSSFDPIRREVARI
RNY_CLOP1       TVHVVALPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSSFDPIRREVARI
RNY_CLOPS       TVHVVALPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSSFDPIRREVARI
RNY_CLOB8       TVHVVALPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSSFDPIRREVARM
RNY_THEP3       TVSVVTLPNDEMKGRIIGREGRNIRTIETLTGIDLIID-DTPEAVVISGFDPIRREVARI
RNY_THEPX       TVSVVTLPNDEMKGRIIGREGRNIRTIETLTGIDLIID-DTPEAVVISGFDPIRREVARI
RNY_CALS4       TVSVVTLPNDEMKGRIIGREGRNIRTIETLTGIDLIID-DTPEAVVISGFDPIRREIARI
RNY_NATTJ       TVSVVSLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIARL
RNY_ALKMQ       TVTVVQLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREVARI
RNY_ALKOO       TVSVVQLPSDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREVARI
RNY_CLOD6       TVTVVSLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIARI
RNY_DESRM       TVAVIPLPNDEMKGRIIGREGRNIRAFETLTGIDLIID-DTPEAVILSGFDPIRREVARL
RNY_PELTS       TVSVIPLPSDEMKGRIIGREGRNIRAFETLTGIDLIID-DTPEAVILSGFDPIRREVARI
RNY_DESAP       TVAVIPLPNEEMKGRIIGREGRNIRAFETLTGVDLIID-DTPEAVIVSGFDPIRRETARM
RNY_CARHZ       TVTVVALPNDEMKGRIIGREGRNIRTFESLTGVDLIID-DTPEAVILSGFDPIRREIARR
RNY_DESHY       TVSVVALPSDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREVARV
RNY_HELMI       TVSVVALPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREVARI
RNY_MOOTA       TVSVVNLPNDEMKGRIIGREGRNIRALETLTGVDLIID-DTPEAVILSCFDPIRREIARI
RNY_LACP7       TISVVQLPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVILSGFDPIRRETARI
RNY_HUNT2       TVSVVPLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIARI
RNY_CALS8       TVSVVTLPNDEMKGRIIGREGRNIKTFETVTGIDLIID-DTPEAVILSGFDPIRREIAKL
RNY_SYMTH       TVTVVSLPNDEMKGRIIGREGRNIRTLETLTGVDLIID-DTPEAVVLSAFDPVRREVAKI
RNY_SYNWW       TVSVVPLPNDEMKGRIIGREGRNIRTFEALSGVDLIID-DTPEAVILSSFDPIRREVARV
RNY_FINM2       TVSVVNLPNDDMKGRIIGREGRNIRAFETLTGVDLIID-DTPEAVVLSAFDPVRREIARI
RNY_FUSNN       TVSVINLPNDEMKGRIIGREGRNIRTIEALTGVDVIID-DTPEAVVLSCFDGVKREVARL
RNY_ROSCS       TVSTVALPSEELKGRIIGREGRNIRAFEQLTGVDIIVD-DTPEAVTLSCHDPVRREVARL
RNY_ROSS1       TVSTVALPSEELKGRIIGREGRNIRAFEQLTGVDIIVD-DTPEAVTLSCHDPVRREVARL
RNY_CHLAA       TVSTVNLPSEELKGRIIGREGRNIRAFEQITGVDIIVD-DTPEAVTLSCHDPVRREVARV
RNY_DEHMB       TTNVVPLPSDEMKGRLIGREGRNIRALEQATGVDLIID-DTPEAVTISSFDPVRREVARQ
RNY_DEHMC       TTNVVPLPSDEMKGRLIGREGRNIRALEQATGVDLIID-DTPEAVTISSFDPVRREVARQ
RNY_DEHM1       TTNVVPLPSDEMKGRLIGREGRNIRALEQATGVDLIID-DTPEAVTISSFDPVRREIARQ
RNY_DEIRA       SVSVVPIPSDAMKGRLIGREGRNIRAFESLTGVDLIID-DTPEAVILSSFNPLRREVARH
RNY_DEIGD       SVSVVPIPNDAMKGRLIGREGRNIRAFEALTGVDLIID-DTPEAVILSSFNPVRREVARH
RNY_THET2       AVTVVPIPSDAMKGRIIGREGRNIRAFEALTGVDLIID-DTPDAVLLSSFNPIRREIARM
RNY_THET8       AVTVVPIPSDAMKGRIIGREGRNIRAFEALTGVDLIID-DTPDAVLLSSFNPIRREIARM
RNY_SALAI       VVSVLHLPGDEMKGRIIGREGRNIRAFESVTGVNLIID-DTPEAVLLSCFDPVRREVGRL
RNY_SALTO       VVSVLHLPGDEMKGRIIGREGRNIRTFESITGVNLIID-DTPEAVLLSCFDPVRREVGRL
RNY_ACIC1       VVSVVHLPGDEMKGRIIGREGRNIRAFESITGVNLIID-DTPEAVLLSCFDPVRREIARV
RNY_FRASN       VVSVLHLPSDEMKGRIIGREGRNIRAFESVTGVNVLID-DTPEAVLLSCFDPVRREMGRI
RNY_THEFY       VVRAVPLPEEAMKGRIIGREGRNIRAFETVTGVDLIVD-DTPGVVLLSCFHPLRRETARL
RNY_CUTAK       VVSVVPLPSNEMKGRVIGREGRNIRTFEQVTGVTVIID-DTPEIVLLSCFDPMRREVARQ
RNY_RHOBA       TTSTVGVPTDDMKGRIIGREGRNIRAFEKATGVDLIID-DTPGVVVVSGFDPVRREVARM
RNY_OPITP       TSTIVSLPNEDMKGRIIGREGRNIKAFEAATGVTVLID-ESPQTVLISSFDPIRREVARG
RNY_RUBXD       TVKAVELPSDDMKGRVIGREGRNIRAFEAATGVDVIID-DTPETVVLSCFDPVRREVARI
RNY_PARUW       TVCTVTIPNEDMKGRIIGREGRNIRALERETGVNFIID-DTPGAVVLSGFDPVRKHIAKM
RNY_STAA2       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAA1       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAAE       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAAT       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAA8       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAAB       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAAC       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAAR       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAAS       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAAM       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAAW       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAAN       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAA3       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAA9       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAES       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAEQ       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAHJ       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_STAS1       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_BACHD       TVSVVNLPNDEMKGRIIGREGRNIRALETLTGIDLIID-DTPEAVILSGFDPIRREIART
RNY_BACSK       TVSVVNLPNDEMKGRIIGREGRNIRALETLTGIDLIID-DTPEAVILSGFDPIRREIARS
RNY_EXIS2       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREVAKM
RNY_BACSU       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACVZ       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACLD       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACP2       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACAN       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACAH       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACHK       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACCZ       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACC1       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACCR       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACMK       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_BACCN       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_GEOKA       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_GEOTN       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARI
RNY_LYSSC       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRRETARL
RNY_OCEIH       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIARM
RNY_LISIN       TVSVVTLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIARI
RNY_LISMO       TVSVVTLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIARI
RNY_LISMF       TVSVVTLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIARI
RNY_LISW6       TVSVVTLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVILSGFDPIRREIARI
RNY_LACPL       TVSVVSLPNDDMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVVLSGYDPIRREIAKI
RNY1_LACBA      TITVVTLPNDDMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVVLSGFDPLRREVAKI
RNY1_PEDPA      TITVVSLPNDDMKGRIIGREGRNIRNFQNVTGVDLIID-DTPEAVVLSSFDPIRREIARI
RNY_LACP3       TVTVVNLPNDDMKGRIIGREGRNIRTLETLTGIDLIID-DTPQAVVLSGFDPIRREIARI
RNY_LACSS       TVTVVTLPNDDMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVVLSGFDPIRREIARM
RNY_ENTFA       TVSVVTLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVVLSGFDPIRREIARM
RNY_LACS1       TVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIID-DTPEAVVLSGFDPVRREIAKM
RNY_LEUCK       TVSVVHLPSDDMKGRIIGREGRNIRTLESLTGIDLIID-DTPESVVLSGFDPIRRQIAKM
RNY_LEUMM       TVSVVNLPSEDMKGRIIGREGRNIRTLESLTGIDLIID-DTPESVVLSGFDPVRREIAKM
RNY_LACLM       TVSVVNLPDDGMKGRIIGREGRNIRTFEALTGIDVIID-DTPEAVVLSGFDPIRREIARM
RNY_LACLS       TVSVVNLPDDGMKGRIIGREGRNIRTFEALTGIDVIID-DTPEAVVLSGFDPIRREIARM
RNY_LACLA       TVSVVNLPDDGMKGRIIGREGRNIRTFEALTGIDVIID-DTPEAVVLSGFDPIRREIARM
RNY_STRA3       TITTVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVVLSGFDPIRREIARM
RNY_STRA1       TITTVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVVLSGFDPIRREIARM
RNY_STRA5       TITTVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVVLSGFDPIRREIARM
RNY_STRPM       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRPF       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRPG       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRPB       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRPC       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRP3       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRP6       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRP1       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRP8       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRPD       TITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVILSGFDPIRREIARM
RNY_STRMU       TITTVHLPDDSMKGRIIGREGRNIRTLESLTGIDIIID-DTPEVVVLSGFDPIRREIARM
RNY_STRT2       TVTTVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVVLSGFDPIRREIARM
RNY_STRT1       TVTTVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVVLSGFDPIRREIARM
RNY_STRTD       TVTTVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIID-DTPEVVVLSGFDPVRREIARM
RNY_STRPN       TNSTVHLPDDTMKGRIIGREGRNIRTFESLTGVDVIID-DTPEVVTLSGFDPIRREIARM
RNY_STRR6       TNSTVHLPDDTMKGRIIGREGRNIRTFESLTGVDVIID-DTPEVVTLSGFDPIRREIARM
RNY_STRPI       TNSTVHLPDDTMKGRIIGREGRNIRTFESLTGVDVIID-DTPEVVTLSGFDPIRREIARM
RNY_STRP2       TNSTVHLPDDTMKGRIIGREGRNIRTFESLTGVDVIID-DTPEVVTLSGFDPIRREIARM
RNY_STRGC       TNSTVHLPDDTMKGRIIGREGRNIRTFESLTGIDVIID-DTPDVVTLSGFDPVRREIARM
RNY_STRSV       TNSTVHLPDDSMKGRIIGREGRNIRTFESLTGIDVIID-DTPEVVTLSGFDPIRREIARM
RNY_STRSY       TITSVHLPDDAMKGRIIGREGRNIRTFESLTGIDVIID-DTPEVVVLSGFDPIRREIARM
RNY_STRS2       TITSVHLPDDAMKGRIIGREGRNIRTFESLTGIDVIID-DTPEVVVLSGFDPIRREIARM
RNY_LACAC       TVSVVDLPNEEMKGRIIGREGRNIRSFEALTGIDLIID-DTPKVVTLSGFDPIRREIAKR
RNY_LACH4       TVSVVDLPNEEMKGRIIGREGRNIRSFEALTGIDLIID-DTPKVVTLSGFDPIRREIAKR
RNY_LACDA       TVSVVDLPNDDMKGRIIGREGRNIRSFEAMTGVDLIID-DTPNTVTLSGFDSIRREVAKR
RNY_LACDB       TVSVVDLPNDDMKGRIIGREGRNIRSFEAMTGVDLIID-DTPNTVTLSGFDSIRREVAKR
RNY_LACGA       TVSVVNLPNDDMKGRIIGREGRNIRSFEALTGVDVIID-DTPDVVVLSGFDPIRREIAKR
RNY_LACJO       TVSVVNLPSDDMKGRIIGREGRNIRSFEALTGVDVIID-DTPDVVVLSGFDPIRREIAKR
RNY_AYWBP       NISVVNIPNEDMKGRIIGRQGRNIKSLEVLTGVDLIID-ESPCTVILSSFDPIRREIAKK
RNY_ONYPE       NISVVNIPNEDMKGRIIGRQGRNIKSLEVLTGVDLIID-ESPCTIILSSFDPIRREIAKK
RNY_ACHLI       TVTVVEIPNEDMKGRIIGKEGRNIRSLEALTGVDLIID-DTPEAVVLSGFDPVRREVAKR
RNY_MAGMM       TVSVVQLPTDEMKGRIIGREGRNIRALEAATGCDLIID-DTPEAVVISGFNPVRRQVARR
RNY_THEMA       TVSTVSLPSDDMKGRIIGREGRNIRTFEKITGVDLIID-DTPEVVVLSCFNPLRREIARI
RNY_THESQ       TVSTVSLPSDDMKGRIIGREGRNIRTFEKITGVDLIID-DTPEVVVLSCFNPLRREIARI
RNY_THEP1       TVSTVSLPSDDMKGRIIGREGRNIRTFEKITGVDLIID-DTPEVVVLSCFNPLRREIARI
RNY_PSELT       TVSTVSLPSDDMKGRIIGREGRNIRTFEKITGVDLIID-DTPEVVVLSSFNPIRREIARL
RNY_FERNB       TISTVALPNDDMKGRLIGREGRNIRTFEKITGVDLIID-DTPEMVTLSSFNPLRREVARR
RNY_THEM4       TVSTIMLPNDDMKGRLIGREGRNIRAFEKVTGVDLIID-DTPEMVTVSCFNPLRREIAKR
RNY_PETMO       TTSTVALPTDDMKGRIIGREGRNIRTFEKLTGTDLIID-DTPEIVVISSFNPLRREIAKR
RNY_AQUAE       TTTTVELPSNEFKGRIIGREGRNIRTFEILTGVDLIID-DTPDIVTISSFDPLRREIAKE
RNY_BACFR       SVTVFHIESDEIKGRIIGREGRNIRALEAATGVEIVVD-DTPEAIVLSAFDPVRREIARL
RNY_BACFN       SVTVFHIESDEIKGRIIGREGRNIRALEAATGVEIVVD-DTPEAIVLSAFDPVRREIARL
RNY_BACTN       SVTVFHIESDEIKGRIIGREGRNIRALEAATGVEIVVD-DTPEAIVLSAFDPVRREIARL
RNY_BACV8       SVTVFHIESDEIKGRIIGREGRNIRALEAATGVEIVVD-DTPEAIVLSAFDPVRREIARL
RNY_PARD8       SITVFHIESDEIKGRIIGREGRNIRALEAATGIEIVVD-DTPEAIVLSGFDPVRREIARL
RNY_PORGI       SVTVFHIESDEIKGRIIGREGRNIRALEAAAGIEIIVD-DTPEAIVLSGFDPVRREIARL
RNY_CYTH3       CVSIFNIESDDIKGKIIGREGRNIRALEAATGVEIIVD-DTPEAIIISGFDPVRREVARL
RNY_FLAJ1       CVSVFNIESDDVKGRIIGREGRNIRALEAATGVEIIVD-DTPEAIILSCFDPVRREIARL
RNY_FLAPJ       CVSVFNIESDDVKGRIIGREGRNIRAIEAATGVEIIVD-DTPEAIILSCFDPVRREIARL
RNY_GRAFK       CVSVFNLESDDVKGRIIGREGRNIRALEAATGVEIIVD-DTPEAIILSCFDSVRREVARL
RNY_PELLD       ALSVVHIQSDELKGRIIGREGRNIKAFENATGVDIIVD-DTPEVVILSCFDPLRREHAKL
RNY_CHLPM       ALSVVHIQTDELKGRIIGREGRNIKAFENATGVDIIVD-DTPEVVILSCFDPLRRELAKL
RNY_CHLPD       ALSVVHIQSDELKGRIIGREGRNIKAFENATGVDIIVD-DTPEVVILSCFDPLRRELAKL
RNY_CHLCH       ALSVVHIQSDELKGRIIGREGRNIKAFENATGVDIIVD-DTPEVVILSCFDPLRRELAKL
RNY_CHLTE       ALSVVHIQSDELKGRIIGREGRNIKAFENATGVDIIVD-DTPEVVILSCFDPLRREMAKL
RNY1_BDEBA      TVSVLALPNDEMKGKIIGREGRNIRTLEAHCGVDLIVD-DTPEAVVISGFDPVRRELARR
RNY2_BDEBA      GIGAVNFPDAHIRKLFCDPAGNNIKAVQDACGCDIIVE-EGMEMVGVAGFDPVRRELTRR
RNY2_LACBA      LEHTVTVPNGEIRSKIIGRDGQHIRLLETLTGTDLIFVPDDNTTLFISTHDPIRREVARV
RNY2_PEDPA      NHRSFIAENAEYLGKLIGNSGQNVRAIEALTGVDIVID-DQEKEVILNGYDPVRRAVAME
RNY_MYCGE       PSFLISESDFRKLNGISGINKKLLVEKLRIEDIVFTDLNKKY-EVNVLTESPIKAQKTVL
RNY_MYCPN       ASFTVIESDFRKLNGVGGINKKLLIEKLRIEDIIFTNIDKKYYEVQILSDSPVKVQKTVL
                    .          . .   .            .         : :      :      

RNY_UREPA       VMQKLIDSKN-IDINRIELLFKEEREKFEKKVFEIGKNVVEQTLGFFDLPEGIYSYIGRM
RNY_UREP2       VMQKLIDSKN-IDINRIELLFKEEREKFEKKVFEIGKNVVEQTLGFFDLPEGIYSYIGRM
RNY_MYCPE       TMEKLLETKN-MDIAKISLFYKEVEEGFEQTCYEIGKDALENKLHIFDIDKKMYPIVGQL
RNY_MYCCT       TLEQLIIDGR-IQPVKIENELKKQEQELEYIIQETGLSTIKELNIND-IDIELVKLIGKL
RNY_MYCMS       TLEQLIIDGR-IQPIKIENELKKQEQELEYIIQETGLSTIKELNIND-IDIELVKLIGKL
RNY_MESFL       TLEKLLIDKR-IQPIKIEKELKVQEKLIDETILEIGYQVMDELGIHD-MDKELVKLVGKL
RNY_CAMJR       VIELLVEDGR-IQPARIEEIHEKVCKEFDSAILEEGETIVMDLGLNK-IHPEIVKLIGKL
RNY_CAMJJ       VIELLVEDGR-IQPARIEEIHEKVCKEFDSAILEEGETIVMDLGLNK-IHPEIVKLIGKL
RNY_CAMJE       VIELLVEDGR-IQPARIEEIHEKVCKEFDSAILEEGETIVMDLGLNK-IHPEIVKLIGKL
RNY_CAMJ8       VIELLVEDGR-IQPARIEEIHEKVCKEFDSAILEEGETIVMDLGLNK-IHPEIVKLIGKL
RNY_CAMJD       VIELLVEDGR-IQPARIEEIHEKVCKEFDSAILEEGEIIVMDLGLNK-IHPEIVKLIGKL
RNY_CAMC1       VIELLVEDGR-IQPARIEDLHKKVTEEFEQSIQEEGENIVMDLGLNK-IHPEIVKLIGKL
RNY_CAMC5       VIELLVEDGR-IQPARIEDLHKKVTEEFEQSIQEEGENIVIDLGLSK-IHPEITKLIGKL
RNY_CAMFF       VIELLVEDGR-IQPARIEEIHKKVCDEFEASILEEGENILIDLGISK-VHPEIVKLIGKL
RNY_CAMHC       TVELLVEDGR-IQPARIEDVYKKVSEEFEAGIQEEGENIVMDLGLTK-IHPEIVKLIGKL
RNY_NITSB       VIELLVEDGR-IQPSRIEEIYEKVKEEFDQQLLEEGENIVIDLGIGL-IHPEIVKLIGRL
RNY_SULDN       TLELLIQDGR-IQPARIEEIYNKVCEDFEADTLSEGEEIVIDLDIGV-MHPELVKLIGKL
RNY_HELHP       TIEKLVEDGR-IQPSRIEEVYERVKDEMDEQMRQDGENIVLDMELGY-MHPELKFLLGKM
RNY_WOLSU       TIEALVEDGR-IQPARIEEVYKKVEQEFEEKVLEEGEGIVLDMELGY-VHPELKKLIGRL
RNY_SULNB       VIEILIEDGR-IHPGRIEEVHEKVEKEFEEKTYEEGENILIDLGLFP-MHEELVKLIGRL
RNY_ARCB4       TIRELLEDGR-IQPARIEEIYKKVKSEFDKNIQKEGEDVVMELGIKT-MHPELIKLVGRL
RNY_HELPY       TLKILIEDGR-IQPNRIEEVYHRVARNLEKELLSEGESVVLELELGA-MEDELKILIGKM
RNY_HELPH       TLKILIEDGR-IQPNRIEEVYHRVARNLEKELLSEGESVVLELELGA-MEDELKILIGKM
RNY_HELPJ       TIKILIEDGR-IQPNRIEEVYHRVARNMEKELLSEGESVVLELELGT-MEDELKILIGKM
RNY_HELAH       TLKILIEDGR-IQPNRIEEVYHRVVRNMEKELLSEGQSVVLELELGA-MEDELKILLGKM
RNY_BORBU       TLERLVTDGR-IHPARIEEVVYNVTNEINSIIQEEGEKVVFDLNIHG-LDKRLIRGLGRL
RNY_BORAP       TLERLVTDGR-IHPARIEEVVYNVTNEINSIIQEEGEKVVFDLNIHG-LDKRLIRGLGRL
RNY_BORBP       TLERLVTDGR-IHPARIEEVVYNVTNEINSIIQEEGEKVVFDLNIHG-LDKRLIRGLGRL
RNY_TREPA       SLERLVLDGR-IHPARIEEIVQKVTQEVSQKIYEEGEKVLFDLGIHD-MCPEGVRALGRL
RNY_TREDE       ALERLILDGR-IHPARIEEIVQKVTREISQKVYEEGEKVLFDLGIHN-MNQEGVRALGRL
RNY_UNCTG       ALERLIADGR-IHPARIEEVVKKVKKDMEQHLKETGEQAVIEAGVPC-SNLEIIKLLGKL
RNY_GEOMG       ALEKLITDGR-IHPGRIEEVVAKAEEEVEQTIKEAGDQAAFDLGVHG-IHPEILKLIGRL
RNY_GEOSL       ALEKLITDGR-IHPGRIEEVVAKAEEEVEQAVKEAGDQAAFDLGVHG-IHPEILKLIGRL
RNY_GEOUR       SLEKLIADGR-IHPGRIEEVVAKAEEEVELAMKEAGEQAAFDLGVHG-IHPEILKLIGRL
RNY_PELPD       SLEKLIGDGR-IHPGRIEEVVAKATEEVDLGIKEAGERAAFDLGVHG-IHPEIIKLIGRL
RNY_PELCD       ALERLIGDGR-IHPSRIEEAVNKATQDVDNAIREAGEQATFDVGVHG-IHPEIIKLIGRL
RNY_SYNFM       SLERLISDGR-IHPARIEEIVEKVNIEIENAIKESGEQAAFDVGVHG-IHPELIKLLGKL
RNY_SYNAS       SLERLITDGR-IHPGRIEDIVKKVRLEVDSIIKETGERVSFDVGVHD-IHPELINLLGSL
RNY_DESPS       ALIQLISDGR-IHPGRIEEVVEKVSKELDEVMCEAGEQATFDVGAHG-VHVELIKLLGRL
RNY_DESVH       ALERLIQDGR-IHPARIEDIVRKCEQELEVQVREVGEQATFDAGVHG-IHPDIIKLLGQL
RNY_DESVV       ALERLIQDGR-IHPARIEDIVRKCEQELEVQVREVGEQATFDAGVHG-IHPDIIKLLGQL
RNY_DESAG       ALERLISDGR-IHPARIEDIVRKCEQELEVQLREVGEQATFDVGVHG-IHPEIIKLLGQL
RNY_LAWIP       ALERLIQDGR-IHPARIEEIVRKCEEDLAIQVREIGEQATFDIGVYG-IHPELIRILGQL
RNY_CLOB1       ALEKLIVDGR-IHPARIEEMVEKAKKEVEISIKEEGEQATFETGIHG-LHIELIRLLGRL
RNY_CLOBH       ALEKLIVDGR-IHPARIEEMVEKAKKEVEISIKEEGEQATFETGIHG-LHIELIRLLGRL
RNY_CLOBM       ALEKLIVDGR-IHPARIEEMVEKAKKEVEISIKEEGEQATFETGIHG-LHIELIRLLGRL
RNY_CLOBL       ALEKLIVDGR-IHPARIEEMVEKAKKEVEVSIKEEGEQATFETGIHG-LHIELIRLLGRL
RNY_CLOBK       ALEKLIVDGR-IHPARIEEMVEKAKKEVEVSIKEEGEQATFETGIHG-LHIELIRLLGRL
RNY_CLOK5       ALEKLIIDGR-IHPARIEEMVEKAEKELENDIKEEGEQATFETGVHG-LHIELIKLLGRL
RNY_CLONN       ALEKLIIDGR-IHPARIEEMVEKAKQEVENDIKEEGEQATFETGVHG-LHQELVKLLGRL
RNY_CLOTE       ALEKLIMDGR-IHPARIEEMVEKAKKEVENNIREEGEQATFETSVHG-LHSELIKLLGRL
RNY_CLOAB       ALEKLILDGR-IHPARIEEMVEKAKKEVENNIKEEGEQATFETGVHG-LHSELTRLLGRL
RNY_CLOPE       ALEKLIVDGR-IHPARIEEMVERAIKDVENDIKEEGEQATFETGVHG-LHPEIIKLLGRL
RNY_CLOP1       ALEKLIVDGR-IHPARIEEMVERAIKDVENDIKEEGEQATFETGVHG-LHPEIIKLLGRL
RNY_CLOPS       ALEKLIVDGR-IHPARIEEMVERAIKDVENDIKEEGEQATFETGVHG-LHPEIIKLLGRL
RNY_CLOB8       ALEKLIVDGR-IHPARIEEMVERATKDVESSIKEEGEQAALETSVHG-LHPEIIRLLGRL
RNY_THEP3       ALEKLIEDGR-IHPARIEEMVEKAKKEVDNMILKAGEEAAFEVGIHG-LHPELIKLLGRL
RNY_THEPX       ALEKLIEDGR-IHPARIEEMVEKAKKEVDNMIIKAGEEAAFEVGIHG-LHPELIKLLGRL
RNY_CALS4       ALEKLIEDGR-IHPARIEEMVEKAKKEVDNMIIKAGEEAAFEVGVHG-LHPELIKLLGRL
RNY_NATTJ       ALEKLVSDGR-IHPARIEEMVEKAQKEVDEQIREEGEQATLDTGVHG-LHSELIKLLGRL
RNY_ALKMQ       ALEKLIADGR-IHPARIEEMVEKAKKEVENILKEEGEQATFDTGVHG-LHPELIRLLGRL
RNY_ALKOO       ALEKLIVDGR-IHPARIEEMVEKARKEVDNIIKEAGEQATFETGVHG-LHPELVKLLGRL
RNY_CLOD6       ALEKLIADGR-IHPARIEEMVEKARKEVDNIIKEYGEQAAFETSVHG-IHPELIRLLGRL
RNY_DESRM       ALERLISDGR-IHPARIEEMVEKAQKDVEVQIREAGEQATFETGVHG-LHPELVKLLGRL
RNY_PELTS       ALEKLIVDGR-IHPARIEEMVEKAQKEVNVQIRDAGEQAVFETGVHG-LHPELVTLLGRL
RNY_DESAP       ALEKLISDGR-IHPARIEEMVEKARKDMEVQIRDTGEQAAFDANVHG-LHPDLIKLLGRL
RNY_CARHZ       ALEKLIQDGR-IHPARIEEMVERATKEVEQDIREAGEQAAFEVNVHG-LHPEIIKLLGRL
RNY_DESHY       ALEKLIADGR-IHPARIEEMVEKSQKEVDQRIREEGEQATFETGVHG-LHPEIIRLLGRL
RNY_HELMI       ALEKLILDGR-IHPARIEEMVEKAQKEVETRIREEGEQATFETGIHG-LHPELIKLLGRL
RNY_MOOTA       ALEKLIADGR-IHPARIEEMVEKARRELDTKIREEGEQATFEVGIHG-LHPELVRLLGKL
RNY_LACP7       ALEKLIVDGR-IHPARIEEMVEKAQKEVETMIREEGEAATLEVGVHG-IHPELVRLLGKM
RNY_HUNT2       TLEKLILDGR-IHPARIEEMVEKARKEVENTIRQEGENATFETGVHG-LHPEIVRLLGKL
RNY_CALS8       TLEKLILDGR-IHPARIEEMYEKAKREVENKIREEGERVVFELGIHN-LHPELIKLIGKL
RNY_SYMTH       ALQKLIQDGR-IHPARIEEMVEKAQKEVEARIREEGDAACFELGIHN-LHPELVKLLGRL
RNY_SYNWW       ALGNLVSDGR-IHPARIEEMVEKARKEIEQEIREVGEQAAFEVGVHG-LHPELIKLLGRL
RNY_FINM2       ALEKLIVDGR-IHPTRIEEMVEKARKDVDNTIREKGEEACDETNVHG-LHPELIKILGKL
RNY_FUSNN       TIEKLITDGR-IHPGKIEEIVNKCKKDIEKEIVAAGEEALIELSIPT-MHPEIIKTLGRL
RNY_ROSCS       ALIKLLKDGR-IHPTRIEEVVHKTQQEVDQVMREEGERVAYEANVQG-LHPDLIKLLGRL
RNY_ROSS1       ALIKLLKDGR-IHPTRIEEVVSKTQQEVEQIMREEGERVAYEANVQG-LHPDLIKLLGRL
RNY_CHLAA       ALLKLLKDGR-IHPSRIEEVVHKTQLEIEQIMREEGERVAYEANVQG-LHPDLIKLLGRL
RNY_DEHMB       ALSKLIIDGR-IHPARIEEVVTKAKEEVEAAMIASGEQAAYQAGVHG-LRPEIIKVMGRL
RNY_DEHMC       ALSKLIIDGR-IHPARIEEVVTKAKEEVEAAMIASGEQAAYQAGVHG-LRPEIIKVMGRL
RNY_DEHM1       ALSKLIIDGR-IHPARIEEVVAKAKEEVEAAMIASGEQAAYQAGVHG-LRPEIIKVMGRL
RNY_DEIRA       VLDALVADGR-IHPTRIEEMVHKAQDDMKTFIHQQGEEAAIEAGVVG-LKPGLVQLLGRM
RNY_DEIGD       VLEALVADGR-IHPTRIEEMVHKAQDEMKSFIHAQGEEAAIESGVVG-LKPGLVQLLGRM
RNY_THET2       ALEELLKDGR-IHPSRIEEVVEKAKQEMKTFIYERGEEAALEAGVVG-LKPGLIQLLGRL
RNY_THET8       ALEELLKDGR-IHPSRIEEVVEKAKQEMKTFIYERGEEAALEAGVVG-LKPGLIQLLGRL
RNY_SALAI       TLEKLVLDGR-IHPHRIEEVHDLARQEVVQLCQRAAEDALVEVGITE-IHPELVSLLGRL
RNY_SALTO       TLEKLVLDGR-IHPHRIEEVHDLARQEVAQLCQRAAEDALVEVGITE-IHPELVGLLGRL
RNY_ACIC1       ALERLVDDGR-IHPLRIEEVYEASRLEVERLCQRAAEDALLAVGITG-MHPELVALLGRL
RNY_FRASN       TLTALVSDGR-IHPHRIEEEYARAEREVAAKCVRAGEDALIDVGIAE-MHPELINLLGRL
RNY_THEFY       TLEKLVADGR-INPHRIEEAYEASRREVEQQCVRAGEDALLEVGISD-MHPELVALLGQL
RNY_CUTAK       ALTDLVEDGR-IHPISIERAHQRAVDRIEDMCLDAAADALSRAGIDD-IDDRLLPILGSL
RNY_RHOBA       SLEKLIADGR-IHPSKIEETVEQAGKEIQAFILQKGQEAAGEVNVSG-LHDRVIEMLGRL
RNY_OPITP       ALEALIKDGR-IHPATIEEFVKRAHEEIELSAMQAGEDAVTRLNING-LHPEIIKLLGKL
RNY_RUBXD       AMERLVKDGR-IHPGRIEQVVAKVRKEVEKEMKAAGRQALYDAKVSGSMHGDLLRLLGAL
RNY_PARUW       ALTELVQDGR-IHPTRIEEVVEKATINVHKQIKQYGEDAALRAGAMN-LHPDLINLLGKL
RNY_STAA2       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAA1       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAAE       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAAT       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAA8       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAAB       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAAC       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAAR       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAAS       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAAM       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAAW       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAAN       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAA3       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAA9       ALVNLVSDGR-IHPGRIEDMVEKARKEVDYIIREAGEQATFEVNAHN-MHPDLVKIVGRL
RNY_STAES       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIRDAGEQATFEINVHN-MHPDLVKILGRL
RNY_STAEQ       ALVNLVSDGR-IHPGRIEDMVEKARKEVDDIIRDAGEQATFEINVHN-MHPDLVKILGRL
RNY_STAHJ       ALVNLVSDGR-IHPGRIEEMVDKARKEVDDIIRDAGEQATFEINVHN-MHPDLVKVLGRL
RNY_STAS1       ALVNLVSDGR-IHPGRIEDMVDKARKEVDDIIRDAGEQATFEINVHN-MHPDLVKILGRL
RNY_BACHD       ALEKLVQDGR-IHPARIEEMVDKARREVDEAIREYGEQTTFEMGIHG-LHPDLIKILGRL
RNY_BACSK       ALEKLVQDGR-IHPARIEEMVDKSRREVDETIREYGEQTTFEVGVHG-LHPDLIKILGRL
RNY_EXIS2       ALEKLVQDGR-IHPARIEEMVDKSRREVDERIREIGEEATYDVGIHG-IHPDLVKILGRL
RNY_BACSU       ALDKLVQDGR-IHPARIEEMVEKSRREVDDYIREMGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACVZ       ALDKLVQDGR-IHPARIEEMVEKSRREVDDYIREMGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACLD       ALDKLVQDGR-IHPARIEEMVEKSRREVDDYIREMGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACP2       ALDKLVQDGR-IHPARIEEMVEKSRREVDDYIREMGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACAN       ALDKLVQDGR-IHPARIEEMVEKSRREVDEYIREVGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACAH       ALDKLVQDGR-IHPARIEEMVEKSRREVDEYIREVGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACHK       ALDKLVQDGR-IHPARIEEMVEKSRREVDEYIREVGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACCZ       ALDKLVQDGR-IHPARIEEMVEKSRREVDEYIREVGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACC1       ALDKLVQDGR-IHPARIEEMVEKSRREVDEYIREVGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACCR       ALDKLVQDGR-IHPARIEEMVEKSRREVDEYIREVGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACMK       ALDKLVQDGR-IHPARIEEMVEKSRREVDEYIREVGEQTTFEVGVHG-LHPDLIKILGRL
RNY_BACCN       ALDKLVQDGR-IHPARIEEMVEKSRREVDEYIREVGEQTTFEVGIHG-LHPDLIKILGRL
RNY_GEOKA       ALDKLVQDGR-IHPARIEEMVEKARREVDEHIREVGEQTTFEVGVHG-LHPDLIKILGRL
RNY_GEOTN       ALDKLVQDGR-IHPARIEEMVGKARREVDEHIREVGEQTTFEVGVHG-LHPDLIKILGRL
RNY_LYSSC       ALEKLVQDGR-IHPARIEEMVEKSRREVDEQIRETGEQTTFEIGIHN-LHPDLMKILGRM
RNY_OCEIH       ALEKLVQDGR-IHPARIEEMVEKSRREVDEYIREVGEETTFEVGVHG-LHPDLVKILGRL
RNY_LISIN       ALEKLVQDGR-IHPARIEEMVDKARKEVDEHIREVGEQATFEVGIHS-IHPDLIKILGRL
RNY_LISMO       ALEKLVQDGR-IHPARIEEMVDKARKEVDEHIREVGEQATFEVGIHS-IHPDLIKILGRL
RNY_LISMF       ALEKLVQDGR-IHPARIEEMVDKARKEVDEHIREVGEQATFEVGIHS-IHPDLIKILGRL
RNY_LISW6       ALEKLVQDGR-IHPARIEEMVDKARKEVDEHIREVGEQATFEVGIHS-IHPDLIKILGRL
RNY_LACPL       ALEKLIQDGR-IHPARIEEMVEKARKEMDEKIRETGEQAVFDLGLHG-MHPDLIKLVGRL
RNY1_LACBA      ALEKLIQDGR-IHPARIEEMVAKAKKELDEHVRELGEQATFDLGIHS-MHPELVKLVGRL
RNY1_PEDPA      ALDKLIQDGR-IHPARIEEMVEKAKKEMDDNIRKTGEQAVFDLGIHS-MNPELIKLIGQL
RNY_LACP3       ALEKLIQDGR-IHPARIEEMVDKARKEMDDRIREIGEQAIFDVGIHN-MHPDLIKILGRL
RNY_LACSS       TLEKLIQDGR-IHPARIEEMVDKSRKEMDEQIRQIGEQAIFDVGIHT-MHPDLIKILGRL
RNY_ENTFA       TLEKLIQDGR-IHPARIEEMVEKSRKEMDERIREYGEQAAFEVGAHT-LHPDLIKILGRL
RNY_LACS1       ALERLIQDGR-IHPARIEEMVDKATKDMDAKIREIGEEVIFDLGIHS-MHPDLIKTIGRL
RNY_LEUCK       ALDALVADGR-INPSRIEEMVEKAKRQIDETIREKGEEAVFELGLRG-LHPDLIKMIGRM
RNY_LEUMM       ALDALVADGR-INPSRIEEMVEKSRRQMDETIREKGEQAVFELGLRG-MHPDLIKMIGRM
RNY_LACLM       TLEQLVQDGR-IHPARIEELVEKNRKALDHKMREYGEQAAFEVGAHN-LHPDLMKIMGRL
RNY_LACLS       TLEQLVQDGR-IHPARIEELVEKNRKALDHKMREYGEQAAFEVGAHN-LHPDLMKIMGRL
RNY_LACLA       TLEQLVQDGR-IHPARIEELVEKNRKALDHKMREYGEQAAFEVGAHN-LHPDLMKIMGRL
RNY_STRA3       TLESLIQDGR-IHPARIEELVEKNRLEMDQRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRA1       TLESLIQDGR-IHPARIEELVEKNRLEMDQRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRA5       TLESLIQDGR-IHPARIEELVEKNRLEMDQRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRPM       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRPF       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRPG       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRPB       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRPC       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRP3       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRP6       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRP1       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRP8       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRPD       TLESLIADGR-IHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPN-LHPDLIKIMGRL
RNY_STRMU       TLEALIQDGR-IHPARIEELVEKNRLEMDNRIREYGEAAAFEIGAPN-LHPDLIKLMGRL
RNY_STRT2       TLEALIKDGR-IHPARIEELVEKSRKEMDNRIREYGEEAAYEIGAMN-LHPDLIKIMGRL
RNY_STRT1       TLEALIKDGR-IHPARIEELVEKSRKEMDNRIREYGEEAAYEIGAMN-LHPDLIKIMGRL
RNY_STRTD       TLEALIKDGR-IHPARIEELVEKSRKEMDNRIREYGEEAAYEIGAMN-LHPDLIKIMGRL
RNY_STRPN       TMEMLLKDGR-IHPARIEELVEKNRQEIDNKIREYGEAAAYEIGAPN-LHPDLMKIMGRL
RNY_STRR6       TMEMLLKDGR-IHPARIEELVEKNRQEIDNKIREYGEAAAYEIGAPN-LHPDLMKIMGRL
RNY_STRPI       TMEMLLKDGR-IHPARIEELVEKNRQEIDNKIREYGEAAAYEIGAPN-LHPDLMKIMGRL
RNY_STRP2       TMEMLLKDGR-IHPARIEELVEKNRQEIDNKIREYGEAAAYEIGAPN-LHPDLMKIMGRL
RNY_STRGC       TMEALLKDGR-IHPARIEELVEKNRLEIDNRIREYGEAAAYEIGAPN-LHPDLMKIMGRL
RNY_STRSV       TMEALLKDGR-IHPARIEELVEKNRLEIDNRIREYGEAAAYEIGAPN-LHPDLMKIMGRL
RNY_STRSY       TMETLLQDGR-IHPARIEELVEKHRVEMDNRIREYGEAAAYEVGAPN-LHPDLIKIMGRL
RNY_STRS2       TMETLLQDGR-IHPARIEELVEKHRVEMDNRIREYGEAAAYEVGAPN-LHPDLIKIMGRL
RNY_LACAC       AMERLIKDGR-IHPARIEEMVDKARKEVNDDIYEAGESALMELGIHR-MNPELVKTLGRL
RNY_LACH4       AMERLIKDGR-IHPARIEEMVDKARKEVNDDIYEAGESALMELGIHR-MNPELVKTLGRL
RNY_LACDA       ALQKLIKDGR-IHPARIEEMVDKARKEVNDDIYEAGESALMELGIHR-MNPELVKILGRL
RNY_LACDB       ALQKLIKDGR-IHPARIEEMVDKARKEVNDDIYEAGESALMELGIHR-MNPELVKILGRL
RNY_LACGA       ALERLIKDGR-IHPARIEEMVDRARKEVNDDIYEAGESALMELGIHK-MHPELVKILGRL
RNY_LACJO       ALERLIKDGR-IHPARIEEMVDRARKEVNDDIYEAGESALMELGIHK-MHPELVKILGRL
RNY_AYWBP       TLEFLVSDGR-IHPSRIEKALETSTIEVDNFIKEMGEEATFITKIGE-VHPDLIKILGKL
RNY_ONYPE       TLEFLVSDGR-IHPSRIEKALETSTIEVDNFIKEMGEEAAFITKIGE-VHPDLIKILGKL
RNY_ACHLI       ALTILVQDGR-IHPGRIEEVVERARTEIDMFIREAGEEAVFKTGVGK-VHPDIIKLLGRM
RNY_MAGMM       ALEELVGDGR-IHPARIEEVVRKARKVVSQEIREAGEQAVYDVGISN-MHPEIIKLLGTL
RNY_THEMA       TLEKLVADGR-IHPARIEEMYEKAKQEVEKAIKEAGQEATFKAGVMG-LHPELVKLLGKL
RNY_THESQ       TLEKLVADGR-IHPARIEEMYEKAKQEVEKAIKEAGQEATFKAGVMG-LHPELVKLLGKL
RNY_THEP1       TLEKLVADGR-IHPARIEEMYEKAKQEVEKAIKEAGQEATFKAGVMG-LHPELVKLLGKL
RNY_PSELT       TLEKLVTDGR-IHPARIEEMYEKSKQEMEKMIKEAGQEATFVTGVTG-LHPELIKLLGKL
RNY_FERNB       TIEKLVQDGR-IHPARIEEMYEKAKAEVEREIKEAGQDAVITVGVGG-LHPEIIKLLGRL
RNY_THEM4       TIEKLVADGR-IHPTRIEEMYEKAKAEVEKIIREAGQEATFVTGVGG-LHPEIIKLLGRL
RNY_PETMO       TLEMLVADGR-IHPARIEELYEKSKNEIQEYIKEVGKEAVMRVGIKQ-PHLEIIKLLGRL
RNY_AQUAE       ALQRLIADGR-IHPARIEEVVDEVKREFDEKIRKIGEETVYELDLHD-INPGLYYYIGKL
RNY_BACFR       ALHQLVTDGR-IHPARIEEVVAKVRKQVEEEIIETGKRTTIDLGIHG-LHPELIRIIGKM
RNY_BACFN       ALHQLVTDGR-IHPARIEEVVAKVRKQVEEEIIETGKRTTIDLGIHG-LHPELIRIIGKM
RNY_BACTN       ALHQLVTDGR-IHPARIEEVVSKVRKQVEEEIIETGKRTTIDLGIHG-LHPELIRIIGKM
RNY_BACV8       ALHQLVTDGR-IHPARIEEVVAKVRKQVEEEIIETGKRTTIDLGIHG-LHPELIRIIGKM
RNY_PARD8       ALHQLVQDGR-IHPARIEEVVTKVKKQVEDEVVETGKRTVIDLGVHG-LHPELIRMIGKM
RNY_PORGI       ALHQLVQDGR-IHPARIEEVVSKVRKQVEEEIIETGKRTVIDLGIHG-LHPELIRLIGKM
RNY_CYTH3       SLHRLVQDGR-IHPARIEEVVTKTAKHLDEEIIEIGERTAIDLGIHG-LHPELIRLVGRM
RNY_FLAJ1       SLHKLVTDGR-IHPARIEEVVAKTAKQIDDEIIEVGKRTVIDLGIHG-LHPELIKVVGRM
RNY_FLAPJ       ALHKLVTDGR-IHPARIEEVVAKTTKQIDDEIIEVGKRTVIDLGIHG-LHPELIKVVGRM
RNY_GRAFK       SLHKLVTDGR-IHPARIEEVVKKTRKQIEEEIIDIGKRTVIDLGIHG-LQPELIKMVGRM
RNY_PELLD       TLKKLLADGV-IHPVAIEKAYLDAGKEMADVIMSAGEEALASLQIPD-MPAEIVRLIGTM
RNY_CHLPM       TLQKLLSEGV-IHPVAIEKAYEDASKEIADVIMSAGEDALSSLQLPD-MPAEVVKTVGKM
RNY_CHLPD       TLQKLLVDGI-IHPVAIEKAYEDAKKEIDDVIMSAGEETISSLQIPD-MPAEVVGLIGKM
RNY_CHLCH       TLKKLLADGI-IHPVAIEKAYADATKEIDDVVYSAGEEVAASLQLND-IPTEVIALLGKM
RNY_CHLTE       TLQKLLVDGI-IHPVAIEKAYQDAKKEIEDVIMSSGEEAISSLQIPD-MPAEIVNLIGKM
RNY1_BDEBA      TIEKLMEDGR-VHPARIEEVAEKQRNELMKSMKEEGERHVMELGIPN-MHPELVKIIGGL
RNY2_BDEBA      TLERIFKEKKNINPDFIRKIAENQKKELFKNIKHDGDSLAKELKLEG-LNAEIRQMMGSL
RNY2_LACBA      ALTNLVASRR-ISSNQIETQVENAQRDVNHSLWETGEQTVSGLHVGW-MHPDLMKLIGRL
RNY2_PEDPA      TMEMIKTEKR-VVPDTIERLVNKANKVIDQRIRQYGEDAVRELKLKY-VAPDLIKFIGRM
RNY_MYCGE       TVRNILMNDY-VDNERIESYVQQANFFFTEHCKKIGKEILESLNIFI-SSSSLHRHFGFL
RNY_MYCPN       TIRNILINDY-VDNEKIESYAREANGYFNDHCKLIGKQVLERLNIFE-ISPKLHKFFGLL
                 :  :      :    *          .       .                    .* :

RNY_UREPA       KFRNSYGQNILSHSLEVAEYAERIAKLINIDPIKAKKAAFFHDIGKTIDFESDLD--HVE
RNY_UREP2       KFRNSYGQNILSHSLEVAEYAERIAKLINIDPIKAKKAAFFHDIGKTIDFESDLD--HVE
RNY_MYCPE       NFRTSYSQNVLLHCVEAAVLAANIAQKLNIDPIKAKKAAFFHDIGKAVDFEIDND--HVN
RNY_MYCCT       KFRTSYGQNVLAHSIEVAKLSGAIASELGLDVEKAIRAGLLHDIGKAIDFEKQGS--HVV
RNY_MYCMS       KFRTSYGQNVLAHSIEVAKLSGAIASELGLDVEKAIRAGLLHDIGKAIDFEKQGS--HVV
RNY_MESFL       KYRTSYGQNVLLHSVEVAKIASSIASELGLNAKQALRAGLLHDIGKAIDFEKTGS--HVF
RNY_CAMJR       KYRASYGQNALAHSLEVAHLAGIIAAECGGDENLARRAGILHDIGKALTHDFEGS--HVD
RNY_CAMJJ       KYRASYGQNALAHSLEVAHLAGIIAAECGGDENLARRAGILHDIGKALTHDFEGS--HVD
RNY_CAMJE       KYRASYGQNALAHSLEVAHLAGIIAAECGGDENLARRAGILHDIGKALTHDFEGS--HVD
RNY_CAMJ8       KYRASYGQNALAHSLEVAHLAGIIAAECGGDENLARRAGILHDIGKALTHDFEGS--HVD
RNY_CAMJD       KYRASYGQNALAHSLEVAHLAGIIAAECGGDENLARRAGILHDIGKALTHDFEGS--HVD
RNY_CAMC1       KFRASYGQNALAHSLEVAHLAGIIAAECGGDEKLAKRAGILHDIGKALTHEYEGS--HVD
RNY_CAMC5       KFRASYGQNALAHSLEVAHLAGIIAAETGGDEKLAKRAGLLHDIGKALTHEFEGS--HVD
RNY_CAMFF       KFRASYGQNALAHSLEVAHLSGIIAAETGGDEKLAKRAGILHDIGKALTHEYEGS--HVD
RNY_CAMHC       KFRASYGQNALIHSLEVAHLAGIIAAETGGDENLARRAGILHDIGKALTHEFEGS--HVD
RNY_NITSB       KFRASYGQNALGHSLEVAHLAGIMAAEMGGDEVMAKRAGLLHDIGKALTHEYSGS--HVD
RNY_SULDN       RYRASYGQNALSHTLEVAHLAGIMASEMGGDARLAKRAGLLHDIGKALTHEHEGS--HVD
RNY_HELHP       RYRASFGQNALGHSIEVANLAAIIAGELGGDEKLARRAGILHDIGKALTQELGGS--HVD
RNY_WOLSU       KYRASYGQNALGHSLEVANLAGVIAGELGGDVKLAKRAGLLHDIGKALTHDFGGS--HVD
RNY_SULNB       KYRASYGQNALAHTLEVAKLARVMAAEMGGDEKLALRAGLLHDIGKALTQDMGGS--HVE
RNY_ARCB4       RYRASYGQNALAHTLEVAHLSGLLASQMGGDAILARRAGLLHDIGKALTHEAPGS--HVD
RNY_HELPY       RYRSSFGQNALQHSKEVALLAGLIAEQLGGDKKLARRAGILHDIGKALTQELGRD--HVN
RNY_HELPH       RYRSSFGQNALQHSKEVALLAGLIAEQLGGDKKLARRAGILHDIGKALTQELGRD--HVN
RNY_HELPJ       RYRFSFGQNALQHSKEVALLAGLIAEQLGGDKKLARRAGILHDIGKALTQELGRD--HVN
RNY_HELAH       RYRSSFGQNALQHSKEVALLAGLIAEQLGGDKKLARRAGILHDIGKALTQELGRD--HVS
RNY_BORBU       YFRSSYGQNVLSHSKETAIIGEILAKEMKLDPVVVKRACLLHDIGKGMESISDNSEGHAI
RNY_BORAP       YFRSSYGQNVLSHSKETAIIGEILAKEMKLDPIVVKRACLLHDIGKGMESISDNSEGHAI
RNY_BORBP       YFRSSYGQNVLSHSKETAIIGEILAKEMKLDPIVVKRACLLHDIGKGMESISENSEGHAI
RNY_TREPA       YFRTSYGQNVLYHSKEVALLASMLASEIGADVAIAKRGALLHDIGKGVETDSDRN--HAE
RNY_TREDE       YFRTSYGQNVLQHSKEVAIIAGMIASEIGANVEIAKRGALLHDIGKGAETDSDKN--HAE
RNY_UNCTG       KYRTSYGQSQLQHTLEVTWLAGAIAGELGLDVMFCKKAALLHDIGKAVDHEVEGT--HHQ
RNY_GEOMG       KYRTSYSQNVYQHSLEVAFLCGIMASELGINVKQAKRAGLLHDLGKAVDHEVEGS--HAV
RNY_GEOSL       KYRTSYSQNVYQHSLEVAFLCGIMASELGINVKQAKRAGLLHDLGKAVDHEVEGS--HAV
RNY_GEOUR       KYRTSYSQNVYQHSLEVAFLCGIMAAELGINVKQAKRAGLLHDLGKAVDHEVEGS--HAV
RNY_PELPD       KYRTSYTQNIYQHSLEVAFICGIMAAELGINVKQAKRAGLLHDLGKAVDHEVEGS--HAV
RNY_PELCD       RYRTSYGQNVLQHSIEVAFLCGIMAAELGINVKQAKRAGLLHDIGKAVDHEVEGS--HAV
RNY_SYNFM       KYRTSYAQNVLQHSREVAFLCGIMAAELGINEKQAKRAGLLHDIGKAIDHEMEGP--HAT
RNY_SYNAS       KYRTSYSQNVLQHSIDVAHLTGMMAAELKMNIKEAKRAGLLHDIGKAVDHKIEGT--HAA
RNY_DESPS       RYRTSYGQNVLQHSLEVAFLCGIMAAELGIDVKMAKRAGLLHDIGKAVDHEVEGS--HAV
RNY_DESVH       RYRTSFSQNVLQHSLEVSALCGMMAAELGMDIKKAKRAGLLHDIGKAVDHEVEGP--HAL
RNY_DESVV       RYRTSFSQNVLQHSLEVSALCGMMAAELGMDIKKAKRAGLLHDIGKAVDHEVEGP--HAL
RNY_DESAG       KYRTSFSQNVLQHSMEVASLCGIMAAELGMDEKRAKRAGLLHDIGKAVDHDVEGP--HAV
RNY_LAWIP       NYRTSYTQNVLRHSIEVASLCGMMAAELGVDIKKAKRAGLLHDIGKAVDHEVEGS--HAI
RNY_CLOB1       KYRTSYGQNVLKHSIEVSHLAGLMASELGIDPTLAKRVGLLHDIGKAVDHEVEGP--HAI
RNY_CLOBH       KYRTSYGQNVLKHSIEVSHLAGLMASELGIDPTLAKRVGLLHDIGKAVDHEVEGP--HAI
RNY_CLOBM       KYRTSYGQNVLKHSIEVSHLAGLMASELGIDPTLAKRVGLLHDIGKAVDHEVEGP--HAI
RNY_CLOBL       KYRTSYGQNVLKHSIEVSHLAGLMASELGIDPTLAKRVGLLHDIGKAVDHEVEGP--HAI
RNY_CLOBK       KYRTSYGQNVLKHSIEVSHLAGLMASELGIDPTLAKRVGLLHDIGKAVDHEVEGP--HAI
RNY_CLOK5       KYRTSYGQNVLKHSVEVAYLAGLMASEIGIDPTIAKRAGLLHDIGKAVDHEVEGP--HAV
RNY_CLONN       KYRTSYGQNVLKHSMEVAYLAGLMASELGMDPTLAKRSGLLHDIGKAVDHEIEGP--HAL
RNY_CLOTE       KYRTSYGQNVLKHSIEVSYLAGLMASELGMDPTLAKRAGLLHDIGKAVDHEVEGP--HAI
RNY_CLOAB       KYRTSYGQNVLKHSIEVSYLAGFMAAELGIDPTFAKRAGLLHDIGKAVDHEVEGP--HAL
RNY_CLOPE       KYRTSYGQNVLKHSIEVSYLAGLMASELGLDVNLARRAGLLHDIGKGVDQEYEGP--HAV
RNY_CLOP1       KYRTSYGQNVLKHSIEVSYLAGLMASELGLDVNLARRAGLLHDIGKGVDQEYEGP--HAV
RNY_CLOPS       KYRTSYGQNVLKHSIEVSYLAGLMASELGLDVNLARRAGLLHDIGKGVDQEYEGP--HAV
RNY_CLOB8       KYRTSYGQNVLKHSIEVSYLAGLMASELGLDVTLAKRAGLLHDIGKAVDQEQEGP--HAL
RNY_THEP3       KFRTSYGQNVLKHSIEVAHLAGLMAYELGADALVAKRAGLLHDIGKAVDHEVEGP--HVM
RNY_THEPX       KFRTSYGQNVLKHSIEVAHLAGLMAYELGADALVAKRAGLLHDIGKAVDHEVEGP--HVM
RNY_CALS4       KFRTSYGQNVLKHSIEVAHLAGLMAYELGADASIAKRAGLLHDIGKAVDHEVEGP--HVM
RNY_NATTJ       KFRTSYGQNVLNHSIEVARLCGVMAHELGTDVNTAKRAGLLHDIGKAVDHEYEGP--HVT
RNY_ALKMQ       KYRTSYGQNVLKHAIEVSHLAGLMATELGADPKLAKRAGLLHDIGKAVDHEVEGT--HIE
RNY_ALKOO       KYRTSYGQNVLNHSIEVSYLAGIMAAELGADVKLAKRAGLLHDIGKAVDHEIEGT--HVE
RNY_CLOD6       NYRTSYGQNVLKHSIEVAHIAGIMAAEIGADIRLAKRAGLLHDIGKAVDHEMEGT--HVE
RNY_DESRM       KFRTSYGQNVLKHSIEVCHLAGLMAAELGIDVKLAKRAGLLHDIGKAVDHEVEGP--HVA
RNY_PELTS       KFRTSYGQNVLKHSIEVAHLAGLMASEIGVDIQMAKRAGLLHDIGKAVDHEVEGP--HVA
RNY_DESAP       KYRTSYGQNVLKHSVEVAYLAGLMAAELRADEKLARRAGLLHDVGKAVDHEVEGP--HVT
RNY_CARHZ       KFRTSYGQNILKHSIEVAHLAGLMAAELGADVALAKRAGLLHDIGKAVDHEVEGS--HVE
RNY_DESHY       KFRTSYGQNVLKHSMEVSHLAGLMAAELGVDVQLAKRAGLLHDLGKAVDHDTEGT--HVQ
RNY_HELMI       RWRTSYGQNVLKHSIEVAHLAGLMAAELGADPILARRAGLLHDIGKAVDHEMEGN--HVS
RNY_MOOTA       KYRTSYGQNVLKHSLEVAFLAGAMAAELGVDVLVAKRAGLLHDIGKAVDFEVEGP--HVN
RNY_LACP7       KFRTSYGQNALKHSIEVAILSGLLAGEIGVDVRIAKRAGLLHDIGKSVDHEMEGT--HVQ
RNY_HUNT2       KFRTSYGQNVLSHSIEVARLAGLMAAELGVDVNLAKRAGLLHDIGKAVDHEVEGS--HVT
RNY_CALS8       RYRTSYGQNVLAHSIEVANIAGIMAAELGLDQSIAKRAGLLHDIGKAVDHEVEGS--HAL
RNY_SYMTH       KFRTSYGQNVLKHSIEVAHLAGIMAAELGVNVEVAKRAGLLHDIGKAVDHEIEGS--HVA
RNY_SYNWW       KYRTSYGQNVLRHSVEVAHLAGIMAAELEVDIMLAKRSGLLHDIGKAVDHEVSGP--HVE
RNY_FINM2       HYRTSYGQNVLKHSIEVSNIAGMLASELGVNVKLAKRGGLLHDLGKAIDHEIEGP--HVE
RNY_FUSNN       KYRTSYGQNVLTHSIEVAKIASTMAAEIGANVELAKRGGLLHDIGKVLVNEIETS--HAI
RNY_ROSCS       KYRTSYGQNVLQHSLECALLAAHIAAEIGANINVAKTAALLHDIGKAVDHEVQGP--HAL
RNY_ROSS1       KYRTSYGQNVLQHSLECALLAAHIAAEIGANINVAKTAALLHDIGKAVDHEVQGP--HAL
RNY_CHLAA       KYRTSYGQNVLQHSLECALLAAHMAAELGANVNIAKTAALLHDIGKAVDHEVQGP--HAL
RNY_DEHMB       KYRTSYGQNVLQHSIEVAQMSGMIGSELGVNVTLARRAGFLHDIGKAVDRDVEGT--HTQ
RNY_DEHMC       KYRTSYGQNVLQHSIEVAQMSGMIGSELGVNVTLARRAGFLHDIGKAVDRDVEGT--HTQ
RNY_DEHM1       KYRTSYGQNVLQHSIEVAQMSGMIGSELGVNVTLARRAGFLHDIGKAVDRDVEGT--HTQ
RNY_DEIRA       YFRTSYSQNVLKHSVQVAHLTGIMADELGLDAALARRAGLMHDVGKSIDREIEGT--HVE
RNY_DEIGD       YFRSSYGQNVLKHSVQVAHLTGIMADELGLDAALARRAGLMHDIGKSIDREIEGT--HVE
RNY_THET2       HFRSSYGQNVLKHSIQVAHLAGIMAAELGLDAALARRAGLLHDIGKSVDREVEGS--HVE
RNY_THET8       HFRSSYGQNVLKHSIQVAHLAGIMAAELGLDAALARRAGLLHDIGKSVDREVEGS--HVE
RNY_SALAI       RYRTSYGQNVLKHLVETAHIAGIMAAELRLDVPTIKRCAFLHDIGKALTHEVEGS--HAI
RNY_SALTO       RYRTSYGQNVLKHLVESAHIAGIMAAELRLDVPTIKRCAFLHDIGKALTHEVEGS--HAI
RNY_ACIC1       RYRTSYGQNVLKHLVETAHLAGVMAAELHIDPQLVKRGALLHDIGKALSHEVEGS--HAL
RNY_FRASN       RYRTSYGQNVLAHLVESAHLAGIMAAELRLPPAIAKRGTLLHDLGKALTHEVEGS--HAI
RNY_THEFY       RYRTSYGQNVLAHLVESAHLAGMMAAELGADVPLAKRCALLHDIGKALTHEVEGS--HAV
RNY_CUTAK       RFRTSYGQQVLDHCVECARLAANLAAEIGADIEICRRAAFLHDLGKSLTPGVEGSS-HAA
RNY_RHOBA       HFRTSYSQNVLRHSVEVAFLAGMMAEMIGLDGDLARRCGLLHDIGKAADHELEGG--HPK
RNY_OPITP       KFRFSYNQNVLDHSVETASLASMIASEVGLDPNVAKRAGLLHDIGKAVNADYEGS--HAH
RNY_RUBXD       KYRSSYGQNVLAHSVEVANIAGMMAQELGANVKIARRAALLHDVGKAIDHEAEGT--HAL
RNY_PARUW       KFRFSYGQNVLDHSLEVSHLMGLMAAELGLDIRLAKRIGLLHDLGKAVTHEIEGS--HAI
RNY_STAA2       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAA1       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAAE       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAAT       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAA8       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAAB       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAAC       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAAR       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAAS       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAAM       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAAW       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAAN       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAA3       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAA9       NYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAES       NYRTSYGQNVLKHSIEVAHLSGMLAAELGEDVTLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAEQ       NYRTSYGQNVLKHSIEVAHLSGMLAAELGEDVTLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAHJ       NYRTSYGQNVLKHSIEVAHLSGMLAAELGEDVSLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_STAS1       QYRTSYGQNVLKHSIEVAHLSGMLAAELGEDITLAKRAGLLHDVGKAIDHEVEGS--HVE
RNY_BACHD       KFRTSYGQNVLKHSMEVAYLAGLMAAELGEDVKLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACSK       RFRTSYGQNVLKHSMEVAHLAGIMAAELGEDVKLAKRAGLLHDIGKAIDHEVEGS--HVE
RNY_EXIS2       KYRTSYGQNVLFHSLEVAHLAGMMAAELGEDVTLAKRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACSU       KFRTSYGQNVLKHSMEVAFLAGLMASELGEDAKLAKRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACVZ       KFRTSYGQNVLKHSMEVAFLAGLMASELGEDAKLAKRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACLD       KFRTSYGQNVLKHSMEVAFLTGLMASELGEDVTLAKRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACP2       KFRTSYGQNVLKHSIEVAHLAGLMASELGEDAKLAKRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACAN       KYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEKLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACAH       KYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEKLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACHK       KYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEKLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACCZ       KYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEKLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACC1       KYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEKLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACCR       KYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEKLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACMK       KYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEKLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_BACCN       KYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEKLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_GEOKA       KFRTSYGQNVLKHSVEVAFLAGLMAAELGEDEMLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_GEOTN       KFRTSYGQNVLKHSVEVAFLAGLMAAELGEDEMLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_LYSSC       KYRTSYGQNVLKHSIEVAHLAGLLAAELGEDVALARRAGLLHDIGKAIDHEVEGS--HVE
RNY_OCEIH       KYRTSYGQNGLKHSAEVAYLSGLLAAELGEDVTLARRAGLLHDIGKAIDHEVEGS--HVE
RNY_LISIN       RYRTSYGQNVLNHSLEVSKLAGILAGELGEDVTLAKRAGLLHDIGKAIDHEIEGS--HVE
RNY_LISMO       RYRTSYGQNVLNHSLEVSKLAGILAGELGEDVTLAKRAGLLHDIGKAIDHEIEGS--HVE
RNY_LISMF       RYRTSYGQNVLNHSLEVSKLAGILAGELGEDVTLAKRAGLLHDIGKAIDHEIEGS--HVE
RNY_LISW6       RYRTSYGQNVLNHSLEVSKLAGILAGELGEDVTLAKRAGLLHDIGKAIDHEIEGS--HVE
RNY_LACPL       NYRTSYGQNVLNHSIEVAKLAGVLAAELGEDVTLAKRAGLLHDIGKAVDHEVEGS--HVE
RNY1_LACBA      NFRISHGQNALAHSIEVAKITGVLAAELGEDVTLAKRAGLLHDIGRAAEHEDDNS--YIT
RNY1_PEDPA      KYRTSYGQNVLNHSIEVANLAGVLAAELGEDVTVAKRAGLLHDIGKAVQHETDTS--HAQ
RNY_LACP3       HFRTSYGQNVLDHSIQVAKLTGVMAAELGEDVTLAKRAGLLHDIGKALDHEVDGS--HVE
RNY_LACSS       HFRTSYGQNVLNHSIEVAKLTGILAAELGEDVTLAKRAGLLHDIGKALDHEVDGS--HVE
RNY_ENTFA       RFRTSYGQNVLNHSIEVAKLAGVLAAELGEDVQLAKRAGLLHDIGKALDHEIEGS--HVE
RNY_LACS1       NYRTSYGQNVLNHSIEVAKISGILAAELGEDVILAKRAGLLHDIGKAVDHEIEGS--HVE
RNY_LEUCK       NYRTSYGQNVLQHSIEVAKLAGMMAAELKMDVALAKRAGLIHDIGKAVDAEVEGS--HVE
RNY_LEUMM       NYRTSYGQNVLQHSIEVAKLAGMMAAELKMDVALAKRAGLIHDIGKAVDAEVEGS--HVE
RNY_LACLM       HFRTSYGQNVLDHSVEVAHIAGNLAGEMGENEALAKRSGFLHDIGKALDHEVEGS--HVE
RNY_LACLS       HFRTSYGQNVLDHSVEVAHIAGNLAGEMGENEALAKRAGFLHDIGKALDHEVEGS--HVE
RNY_LACLA       HFRTSYGQNVLDHSVEVAHIAGNLAGEMGENVALAKRAGFLHDIGKALDHEVEGS--HVE
RNY_STRA3       QFRTSYGQNVLRHSVEVGKLAGILAGELGENVDLARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRA1       QFRTSYGQNVLRHSVEVGKLAGILAGELGENVDLARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRA5       QFRTSYGQNVLRHSVEVGKLAGILAGELGENVDLARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRPM       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRPF       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRPG       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRPB       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRPC       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRP3       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRP6       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRP1       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRP8       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRPD       QFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGS--HVE
RNY_STRMU       QFRTSYGQNVLRHSVEVGKLAGLLASELGENVDLARRAGFLHDIGKAIDREVEGS--HVE
RNY_STRT2       QFRTSYGQNVLRHSVEVGKLAGIMASELGENVALARRAGFLHDMGKAIDKEVEGS--HVE
RNY_STRT1       QFRTSYGQNVLRHSVEVGKLAGIMASELGENVALARRAGFLHDMGKAIDKEVEGS--HVE
RNY_STRTD       QFRTSYGQNVLRHSVEVGKLAGIMASELGENVALARRAGFLHDMGKAIDKEVEGS--HVE
RNY_STRPN       QFRTSYGQNVLRHSIEVAKLAGIMASELGENAALARRAGFLHDIGKAIDHEVEGS--HVE
RNY_STRR6       QFRTSYGQNVLRHSIEVAKLAGIMASELGENAALARRAGFLHDIGKAIDHEVEGS--HVE
RNY_STRPI       QFRTSYGQNVLRHSIEVAKLAGIMASELGENAALARRAGFLHDIGKAIDHEVEGS--HVE
RNY_STRP2       QFRTSYGQNVLRHSIEVAKLAGIMASELGENAALARRAGFLHDIGKAIDHEVEGS--HVE
RNY_STRGC       QFRTSYGQNVLRHSIEVAKLAGVIAGELGENATLARRAGFLHDIGKAIDREVEGS--HVE
RNY_STRSV       QFRTSYGQNVLRHSIEVAKLSGIIAAELGENANLARRAGFLHDIGKSIDREVEGS--HVE
RNY_STRSY       HFRTSYGQNVLRHSIEVAKLAGVLAAELGENVNLARRAGFLHDVGKAIDREVDGS--HVE
RNY_STRS2       HFRTSYGQNVLRHSIEVAKLAGVLAAELGENVNLARRAGFLHDVGKAIDREVDGS--HVE
RNY_LACAC       KYHTSYGQNVLSHSIEVGKLAGTMAAELGLDEKLAVRAGLLHDIGKAIDHDIEGS--HVE
RNY_LACH4       KYRTSYGQNVLSHSIEVGKLAGTMAAELGLDEKLAVRAGLLHDIGKAIDHDIEGS--HVE
RNY_LACDA       KYRTSYGQNVLAHSIEVGKLAGTMAAELGLDEKLAVRAGLLHDIGKAIDHDIEGS--HVE
RNY_LACDB       KYRTSYGQNVLAHSIEVGKLAGTMAAELGLDEKLAVRAGLLHDIGKAIDHDIEGS--HVE
RNY_LACGA       KYRTSYGQNVLSHSIEVGKLTGVMAAELGLDEKIAVRAGLLHDIGKSIDHEIEGS--HVE
RNY_LACJO       KYRTSYGQNVLSHSIEVGKLTGVMAAELGLDEKIAVRAGLLHDIGKSIDHEIEGS--HVE
RNY_AYWBP       HFRISYSQNVLKHSLEVAFLAGKLASEIGENEILARRAGLFHDIGKALDHEMEGS--HVE
RNY_ONYPE       HFRISYSQNVLKHSLEVAFLAGKLASEIGENEILARRAGLFHDIGKALDHEMEGS--HVE
RNY_ACHLI       TFRTSYGQNVLKHSIEVAFLAGKLAAEIGENEMLARRAGLFHDIGKAIDHEVEGS--HVS
RNY_MAGMM       KFRTSYTQNVLAHSVEVAHFAGIMAEEMGLDGKLARRCGLLHDIGKAVDHDNPGS--HAV
RNY_THEMA       KYRTSYGQNVLNHSIEVALLAGYMASELGLNADKARRGGLLHDIGKAVDQELEGS--HTT
RNY_THESQ       KYRTSYGQNVLNHSIEVALLAGYMASELGLNADKARRGGLLHDIGKAVDQELEGS--HTT
RNY_THEP1       KYRTSYGQNVLNHSIEVALLAGYMASELGLNADKARRGGLLHDIGKAVDQELEGS--HTT
RNY_PSELT       KFRTSYGQNVLDHSIEVAQLAALMAEELGLDVDRTRRGGLLHDIGKALDHEVEGS--HTE
RNY_FERNB       KFRTSYGQNVLAHSVEVAQIAGLLAAELGLNVDKAKRGGLLHDIGKAIDHEVEGS--HTD
RNY_THEM4       KFRTSYGQNVLNHSIEVALIAGLIASELGVNVEKAKRGGLLHDIGKALDHEVEGS--HTV
RNY_PETMO       KFRTSYGQDVLEHSIEVAQFAGMMASELGLNVELAKRAALLHDLGKAVDHEVEGS--HAI
RNY_AQUAE       YFRTSYSQNVLLHSKEVAYIAGLMAEELGLDAKLARRAGLLHDIGKAISHELGGS--HTD
RNY_BACFR       KYRSSYGQNLLQHARETANLCAVMASELGLNPKKAKRAGLLHDIGKVPDEEPELP--HAL
RNY_BACFN       KYRSSYGQNLLQHARETANLCAVMASELGLNPKKAKRAGLLHDIGKVPDEEPELP--HAL
RNY_BACTN       KYRSSYGQNLLQHARETANLCAVMASELGLNPKKAKRAGLLHDIGKVPDEEPELP--HAL
RNY_BACV8       KYRSSYGQNLLQHARETANLCAVMASELGLNPKKAKRAGLLHDIGKVPDEEPELP--HAL
RNY_PARD8       KYRSSYGQNLLQHARETANLCAVMASELGLNPKKAKRAGLLHDIGKVPDDEPELP--HAI
RNY_PORGI       KYRSSYGQNLLQHSRETANLCAIMASELGLNPKKAKRAGLLHDIGKVPDDEPELP--HAL
RNY_CYTH3       RFRSSYGQNLLQHSREVAKLCATMASELGLNAKVAKRAGLLHDIGKVYPDEPELP--HAI
RNY_FLAJ1       KYRSSYGQNLLQHSREVSKLCGIMAAELGLNVKLAKRAGLLHDIGKVPDTESDLP--HAL
RNY_FLAPJ       KYRSSYGQNLLQHSREVSKLCGIMAAELGLNVKLAKRAGLLHDIGKVPDAESDLP--HAL
RNY_GRAFK       KYRSSYGQNLLQHSREVAKLCGVMAAELGLNPKLAKRAGLLHDIGKVPETETEVP--HAI
RNY_PELLD       KFHSVYGQNLLQHSREVAMLAGIMATELKLDPRLAKRAGLLHDIGLVLP-DTDQP--HAL
RNY_CHLPM       KFHTVYGQNLLQHSREVAMLAGVMATELKLDARLAKRAGLLHDIGLVLP-ATDEP--HAI
RNY_CHLPD       KYHTVYGQNLLQHSREVAMLAGLMASELKLDARVAKRAALLHDIGLVLP-ESDEP--HAI
RNY_CHLCH       KFHTVYGQNLLQHSREVAMLAGVMAAELKLDARMAKRAGLLHDIGLVLP-ESDEP--HAI
RNY_CHLTE       RFHTVYGQNLLQHSREVAMLAGLMAAELKLDAKQAKRAGLLHDIGLVLP-ETEMP--HAL
RNY1_BDEBA      KYRSYQGQNALNQSLEVATIAGLLAAELGVSVKLARRAGLLHNIGKAIDHTVEGS--YAF
RNY2_BDEBA      RYRYSFTQNQYFHCGEVGWLAGLMAAELGIDIKKARRVGMLHDIGKSMDHTVEGG--HAV
RNY2_LACBA      KYRTSYGQNVLLHSIEVAQLTGAMAARLGYNTRLARRAGLLHDLGKAIDHEVEGT--HVE
RNY2_PEDPA      HYRTSYGQNILEHSIETAKLAGIFAVELGEDATLARRAGLLHDIGKSIDRDIEAT--HVE
RNY_MYCGE       AFRYSFGQNVLSHSLETAFLTAHLAALIELDSELSLKCGLLHDIGKSNDDNGKES--HTI
RNY_MYCPN       AFRYSFGQNVLSHCLETGFLTAYLALLVNFKPDVALKCGLYHDIGKADDENGKKN--HTV
                 ::    *.   :  :       :.              : *::*            :  

RNY_UREPA       AGLLIAKKFNLD-DYIYNAIESHHNKV-IPTTIYGALVKIVDTLSAARPGARVNS-YDEY
RNY_UREP2       AGLLIAKKFNLD-DYIYNAIESHHNKV-IPTTIYGALVKIVDTLSAARPGARVNS-YDEY
RNY_MYCPE       SGVELAKKFNFE-DYIINAIESHHNKV-SPKTVYAALVKVVDKLSASRPGARFVS-NDEY
RNY_MYCCT       LGAEIAKKYNED-PIVINCIESHHEDK-EKESEIAAIVAIADSISASRPGARYNA-IDEF
RNY_MYCMS       LGAEIAKKYNED-PIIINCIESHHEDK-EKESEIAAIVAIADSISASRPGARYNA-IDEF
RNY_MESFL       LGVEVARKYGED-EVIINSIEAHHEDV-AKESEIAVIVAIADAISASKPGARNNS-IEDF
RNY_CAMJR       LGAELCKRYKEH-PVVINAIYAHHGHE-EATSIESAAVCAADTLSAARPGARREV-LEAF
RNY_CAMJJ       LGAELCKRYKEH-PVVINAIYAHHGHE-EATSIESAAVCAADTLSAARPGARREV-LEAF
RNY_CAMJE       LGAELCKRYKEH-PVVINAIYAHHGHE-EATSIESAAVCAADTLSAARPGARREV-LEAF
RNY_CAMJ8       LGAELCKRYKEH-PVVINAIYAHHGHE-EATSIESAAVCAADTLSAARPGARREV-LEAF
RNY_CAMJD       LGAELCNRYKEH-PVVINAIYAHHGHE-EATSIESAAVCAADTLSAARPGARREV-LEAF
RNY_CAMC1       LGAEICKRYKEH-PVVINAIYAHHGHE-EATSIESAAVCAADALSAARPGARREV-LESF
RNY_CAMC5       LGAEICKRYKEH-PVVINAIYAHHGHE-EATSIESAAVCAADCLSAARPGARREV-LESF
RNY_CAMFF       LGAEICKRYKEH-PVVINAIYAHHGHE-EALSVECAAVCAADALSAARPGARREV-LESF
RNY_CAMHC       LGAEICKRYKEN-PVVINAIYAHHGHE-EPTSVESAAVCTADVLSAARPGARREV-LEAF
RNY_NITSB       LGAEICKRYKEP-DVVINAIYAHHGHE-EPRSIEAAAVCAADTLSAARPGARREV-LEAF
RNY_SULDN       LGVQVCNRYNEH-SVVINAIYAHHGHE-EINSIECGAVCAADALSAARPGARREV-LESF
RNY_HELHP       LGVEVCTCYKEH-PVVINAIKAHHGYE-EIQSIECAAVCAADTLSAARPGARREA-LENF
RNY_WOLSU       LGAEVCSRYKEH-PVVINAIFAHHGHE-EAKSIESAAVCAADALSAARPGARREV-LESF
RNY_SULNB       IGAELCRRYNEH-PTVINAIYAHHGHE-EPDSVESAAVCAADTLSAARPGARREV-LESF
RNY_ARCB4       LGAEICKRYDEC-DTVINAIYAHHGHE-EPINVESAAVCAADALSAARPGARREV-LESF
RNY_HELPY       LGVEVCKRHKED-PVVINAIYAHHGHE-EILSVECASVCAADALSAGRPGARRKS-DEEY
RNY_HELPH       LGVEVCKRHKED-PVVINAIYAHHGHE-EILSVECASVCAADALSAGRPGARRKS-DEEY
RNY_HELPJ       LGVEVCKRHKED-PVVINAIYAHHGHE-EIMSVECASVCAADALSAGRPGARRKS-DEEY
RNY_HELAH       LGVEVCKRNKED-PVVINAIYAHHGHE-EIMSIECASVCAADALSAGRPGARRKS-DEEY
RNY_BORBU       TGAELAQSCGES-EIVVNAIAAHHNEVK-PESLEAIVVQIADAISASRPGARRES-LNNY
RNY_BORAP       TGAELAQSCGES-EIVVNAIAAHHNEVK-PESLEAIVVQIADAISASRPGARRES-LNNY
RNY_BORBP       TGAELAQSCGES-EIVVNAIAAHHNEVK-PESLEAIVVQIADAISASRPGARRES-LNNY
RNY_TREPA       IGMEMARKMNED-PRVVNAVGSHHNDIE-PCCVESWLVQVADAISAARPGARREM-VDHY
RNY_TREDE       IGMELAKRINED-PRVVNAVGAHHNDIE-PTCIESVIVQIADAISAARPGARRET-MDNY
RNY_UNCTG       ISANIAKKYGES-HKMINAILSHHEGFEVPSSPEAFVIATADAISAARPGARKES-VERY
RNY_GEOMG       IGAELARKYGES-PKIVHAIMAHHEDE-KPNTVLAVLVQAADALSGARPGARREM-METY
RNY_GEOSL       IGAELARKYGES-PKIVHAIMAHHEDE-KPNSILAVLVQAADALSGARPGARREM-METY
RNY_GEOUR       IGAELAKKYGES-PKIVHAIMAHHEDE-KPATVLAILVQAADALSGARPGARREM-METY
RNY_PELPD       IGADLARKYGES-AKIVHAIMAHHEDE-KPNSVLAVLVQAADALSGARPGARREM-METY
RNY_PELCD       IGANLARKYGES-AKIVHALAAHHEDE-KPSTVLAVLVQAADALSGARPGARREM-LETY
RNY_SYNFM       LGADLTRRYGEA-PPIIHAIAAHHEDV-PAEDVLAILVQAADALSGARPGARKEL-LETY
RNY_SYNAS       IGADYAKRFGES-QRIVQAIAAHHDDG-RTNTLLGVLVQAADTLSAARPGARREM-LETY
RNY_DESPS       IGRDLAKKYGEP-DEIVYAIGAHHADQ-PPKSVLDILVQAADALSGARPGARKEM-LQSY
RNY_DESVH       IGADIAKKYGEG-KDIIHAIAAHHEDQ-PPKTALAVLVQAADSISGARPGARKEL-LENY
RNY_DESVV       IGADIAKKYGEG-KDIIHAIAAHHEDQ-PPKTALAVLVQAADSISGARPGARKEL-LENY
RNY_DESAG       IGADLAKKYGES-KDIIHAIAAHHEDV-PPKSALAVLVQAADSLSGARPGARKEL-LENY
RNY_LAWIP       IGAELAKKFNET-EEIVHAIEAHHEEKGKPETALAILVQASDCLSGARPGARLEL-LESY
RNY_CLOB1       IGSEIAKKYRES-ALVVNAIGAHHGDM-EPQSLEAILVQAADAISAARPGARRET-LEAY
RNY_CLOBH       IGSEIAKKYRES-ALVVNAIGAHHGDM-EPQSLEAILVQAADAISAARPGARRET-LEAY
RNY_CLOBM       IGSEIAKKYRES-ALVVNAIGAHHGDM-EPQSLEAILVQAADAISAARPGARRET-LEAY
RNY_CLOBL       IGSEIAKKYRES-ALVVNAIGAHHGDM-EPQSLEAILVQAADAISAARPGARRET-LEAY
RNY_CLOBK       IGSEIAKKYRES-ALVVNAIGAHHGDM-EPQSLEAILVQAADAISAARPGARRET-LEAY
RNY_CLOK5       IGAEIAKKYRES-PVVVNAIGAHHGDL-EFQSLEDVLVQAADAISAARPGARRET-LEAY
RNY_CLONN       IGSEMAKKYHES-SVVVNAIAAHHGDV-EYESIEAILVQAADAISAARPGARRET-LEAY
RNY_CLOTE       IGAEVAKRYHES-SIVVNAIAAHHGDE-EFESIEAILVQAADAISAARPGARRET-LEAY
RNY_CLOAB       IGAEVSKKYHEL-PLIVNAIGAHHGDV-EPQSLEAILVQAADAISAARPGARRET-LEAY
RNY_CLOPE       IGGELAKKYHES-PAVVNAIAAHHGDT-EMQTLEAVLVQAADAISAARPGARRET-LEAY
RNY_CLOP1       IGGELAKKYHES-PAVVNAIAAHHGDT-EMQTLEAVLVQAADAISAARPGARRET-LEAY
RNY_CLOPS       IGGELAKKYHES-PAVVNAIAAHHGDT-EMQTLEAVLVQAADAISAARPGARRET-LEAY
RNY_CLOB8       IGGDLAKKYHES-PLVINAIAAHHSDV-EMQSLEAVLVQAADAISAARPGARRET-LEAY
RNY_THEP3       IGAELAKRYHES-DAVIHAIMAHHNDV-EPQTVEAVLVQAADAISAARPGARREA-LEAY
RNY_THEPX       IGAELAKRYHES-DAVIHAIMAHHNDV-EPQTVEAVLVQAADAISAARPGARREA-LEAY
RNY_CALS4       IGAELAKRYHES-DAVVHAIMAHHNDV-EPQTIEAVLVQAADAISAARPGARREA-LEAY
RNY_NATTJ       IGAELGKKYGES-SNVLHAIATHHGDE-EPETIEAVLVQAADAISAARPGARRET-LESY
RNY_ALKMQ       IGMELLRKYKET-KDVIHAMSTHHGDF-EPETIEAILVTAADAISAARPGARRET-LESY
RNY_ALKOO       IGMELLKKYKES-KDVIHAMSTHHGDY-EPESIEAILVTAADAISAARPGARRET-LESY
RNY_CLOD6       IGMDLLRRYKES-KEVIHAMSTHHGDY-EPQTVEAVLVTAADAISAARPGARRET-LEAY
RNY_DESRM       IGVNLCQKYKES-PEVIHAIAAHHGDE-EPRTIEAVLVQAADAISAARPGARRET-LESY
RNY_PELTS       IGIDLAKKYREA-QEIIHAIAAHHGDE-EPKSIIAVLVQAADAISAARPGARRET-LEAY
RNY_DESAP       IGVDLAKKYGES-PEVLHAIAAHHGDE-EPETVEAVLIQAADAISAARPGARRET-LEAY
RNY_CARHZ       IGVELAKKYREH-PEVLHAIATHHGDE-EPKTVEAVLVQAADAISAARPGARRET-LEAY
RNY_DESHY       IGVDLAKKYKES-WEVIHAIEAHHGDV-EAKTIEAVLVAAADAVSAARPGARRET-LESY
RNY_HELMI       IGIDLAKKYRES-REVIHCIAAHHGDE-EPRTIEAVLVAAADAVSAARPGARRET-LESY
RNY_MOOTA       LGVELAKKYRES-PEVIHAIEAHHGDV-EPKSIEAGLVQAADAISAARPGARRET-LEAY
RNY_LACP7       IGVDLCRKYKES-PIVINAVEAHHGDV-EFQSLIACIVQAADTISAARPGARRET-LETY
RNY_HUNT2       IGADIAKKYKES-NEVVNAIASHHGDV-EATSIIAVLVQAADSISAARPGARRET-LESY
RNY_CALS8       IGYDLAKRYKETNPDVLEAIGGHHGEM-ETRSIYNVLIQAADSVSAARPGARRES-LESY
RNY_SYMTH       IGVSLLRRYKEH-PDVIHAMECHHGDV-EPRSVEAHLVAAADAISAARPGARRET-LETY
RNY_SYNWW       IGVDLAKKYREN-KDVIHGIEAHHGDI-EPETVEAVLVQAADAISASRPGARRET-LETY
RNY_FINM2       LGVNAAKRFKEP-KDVINCIEAHHGDV-EPTCIESILVQSADAISAARPGARRES-MENY
RNY_FUSNN       VGGEFIKKFGEK-QDVINAVMAHHNEV-EFETVEAILVQAADAVSASRPGARRET-LTAY
RNY_ROSCS       IGAEIARRLGKS-PAIVHAIAAHHNDE-EPQTVEAWLVQAVDAISGGRPGARRET-LDLY
RNY_ROSS1       IGAEIARRLGKS-PAIVHAIAAHHNDE-EPQTVEAWLVQAVDAISGGRPGARRET-LDLY
RNY_CHLAA       IGAEIARRLGRS-AAIVHAIAAHHYDE-EPQTVEAFLVIAADAISGARPGARRET-LDLY
RNY_DEHMB       IGADMVKQWEKS-PEVIKGVAEHHFDT-PTVSIWGFIVSAADAISSARPGARRES-LENY
RNY_DEHMC       IGADMVKQWEKS-PEVIKGVAEHHFDT-PTVSIWGFIVSAADAISSARPGARRES-LENY
RNY_DEHM1       IGADMVKQWEKS-PEVIKGVAEHHFDT-PTVSIWGFIVSAADAISSARPGARRES-LENY
RNY_DEIRA       IGINLARRFGEP-AEVIDAIAHHHDPE-NGETLYSVLVAAADAISAARPGARREA-LESY
RNY_DEIGD       IGINLAKRFGEP-PEVIDAIAHHHDPE-NGETLYSVLVAAADAISAARPGARREE-LEAY
RNY_THET2       IGIALARRFGEP-MEVVDAIAHHHDPD-NAETLYAVLVAAADALSAARPGARRES-LEEY
RNY_THET8       IGIALARRFGEP-KEVVDAIAHHHDPD-NAETLYAVLVAAADALSAARPGARRES-LEEY
RNY_SALAI       VGADVARKYGES-EDVVHAIEAHHNEV-PPQTIEAVLTQASDACSGGRPGARRES-LEAY
RNY_SALTO       VGADVARRYGES-EDVVHAIEAHHNEV-PPQTVEAVLTQASDACSGGRPGARRES-LEAY
RNY_ACIC1       IGAELARRYGEH-EDVVHAIEAHHNEV-EPRTIEAVLTQAADAISGGRPGARRES-LESY
RNY_FRASN       VGAEIARRYGEH-EDVVHAIEAHHNEV-EPRSIGAVLTQAADQISGGRPGARRDS-LESY
RNY_THEFY       IGAQLARRYGEC-EEVAHAIEAHHNEV-EARTVEAVLTQAADAISGGRPGARRAS-MESY
RNY_CUTAK       IGAELARRYGES-EEVIHAIAAHHDEI-DPVSVTDFIVKAADAISAARPGARRES-LEAH
RNY_RHOBA       IGADLLRRSKEN-DEVVHAAKGHHDEI-VTEFPYTMLVATADACSASRPGARRES-LERY
RNY_OPITP       IGAEFIRRYGET-PIVVNSVAAHHEEV-KPETVYAGLVILADTISATRPGARAES-MAGY
RNY_RUBXD       IGGRFAKKCGES-DEVVRAISAHHHEV-EMQTVEDVIVATADAVSAARPGARRET-TEVY
RNY_PARUW       IGHDLALKLGEN-KEVANGIGCHHHEM-APLTIEADLCSAADAISASREGARIEA-VEEY
RNY_STAA2       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAA1       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAAE       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAAT       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAA8       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAAB       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAAC       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAAR       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAAS       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAAM       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAAW       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAAN       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAA3       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAA9       IGVELAKKYGEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAES       IGVELAKKYNEN-NIIINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAEQ       IGVELAKKYNEN-NIIINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAHJ       IGVELAKKYAEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_STAS1       IGVELAKKYAEN-ETVINAIHSHHGDV-EPTSIISILVAAADALSAARPGARKET-LENY
RNY_BACHD       IGVELATKYKEH-PVVINAIASHHGDT-EATSIISSLVAAADALSAARPGARRET-LETY
RNY_BACSK       IGVELATKYKEH-PVVINAIASHHGDT-ESTSIISTLVAAADALSAARPGARRET-LETY
RNY_EXIS2       IGVELGTKYKEH-PTVINAIASHHGDT-EATSVISVLVAAADALSAARPGARQET-LESY
RNY_BACSU       IGVELATKYKEH-PVVINSIASHHGDE-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACVZ       IGVELATKYKEH-PVVINSIASHHGDE-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACLD       IGVELATKYKEH-PVVINSIASHHGDQ-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACP2       IGVELATKYKEH-PVVINSIASHHGDQ-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACAN       IGVELATKYKEH-PVVINSIASHHGDT-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACAH       IGVELATKYKEH-PVVINSIASHHGDT-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACHK       IGVELATKYKEH-PVVINSIASHHGDT-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACCZ       IGVELATKYKEH-PVVINSIASHHGDT-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACC1       IGVELATKYKEH-PVVINSIASHHGDT-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACCR       IGVELATKYKEH-PVVINSIASHHGDT-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACMK       IGVELATKYKEH-PVVINSIASHHGDT-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_BACCN       IGVELATKYKEH-PVVINSIASHHGDT-EPTSIIAVLVAAADALSAARPGARSET-LENY
RNY_GEOKA       IGVELATKYKEH-PVVINSIASHHGDT-EPTSVIAVLVAAADALSAARPGARSET-LENY
RNY_GEOTN       IGVELATKYKEH-PVVINSIASHHGDT-EPTSVIAVLVAAADALSAARPGARSET-LENY
RNY_LYSSC       IGVELATKYKEH-PVVINSIASHHGDT-EATSVIAVLVAAADALSAARPGARSET-LENY
RNY_OCEIH       IGKELAMKYKEH-EVVINSIASHHGDE-EATSIIAVLVAAADALSAARPGARSET-LENY
RNY_LISIN       IGVELATKYKEN-DVVINSIASHHGDT-EATSVIAVLVAAADALSAARPGARSET-LENY
RNY_LISMO       IGVELATKYKEN-DVVINSIASHHGDT-EATSVIAVLVAAADALSAARPGARSET-LENY
RNY_LISMF       IGVELATKYKEN-DVVINSIASHHGDT-EATSVIAVLVAAADALSAARPGARSET-LENY
RNY_LISW6       IGVELATKYKEN-DVVINSIASHHGDT-EATSVIAVLVAAADALSAARPGARSET-LENY
RNY_LACPL       IGVELTTKYKES-PVVINTIASHHGDV-EAKSIIAVLVATSDSISAARPGARSES-LENY
RNY1_LACBA      TGMELTKKYRES-SVVVNAIAAQAEET-AAQSVIAELVSTADIISATRPGARSDS-LESY
RNY1_PEDPA      LGVELAKKYKES-ATVINAIAAHHDGV-EAQHVISVLVAAANSISAARPGARSDT-LQSY
RNY_LACP3       IGVELATKYKEP-KTVINAIASHHGDV-EPTSVISVLVAAADAISAARPGARSES-LENY
RNY_LACSS       IGVELATRYKEP-ATVINAIGSHHGDI-EATSIISVLVAASDAISAARPGARSES-LENY
RNY_ENTFA       IGAELAAKYKEN-SVVINAIASHHGDV-EATSVISVLVAAADALSAARPGARSES-LENY
RNY_LACS1       LGVELTKKYNES-ETVVNTIASHHGDT-EPKSVIAVLVAAADAISAARPGARSES-LENY
RNY_LEUCK       LGVRLAEKFNEK-PVVINAIASHHGDV-ETISPISELVAAADAISAARPGARSES-LENY
RNY_LEUMM       LGVRLAEKFNEK-PIVINAIASHHGDV-AAISPIAELVAAADAISAARPGARSES-LENY
RNY_LACLM       IGTELARKYKEN-PIVINTIASHHGDT-EPLSNIAVLVAAADALSAARPGARRES-IENY
RNY_LACLS       IGTELARKYKEN-PIVINTIASHHGDT-EPLSNIAVLVAAADALSAARPGARRES-IENY
RNY_LACLA       IGTELARKYKEN-PIVINTIASHHGDT-EPLSNIAVLVAAADALSAARPGARRES-IENY
RNY_STRA3       IGMEFARKYKEH-PIVVNTIASHHGDV-EPDSVIAVIVAAADALSSARPGARNES-MENY
RNY_STRA1       IGMEFARKYKEH-PIVVNTIASHHGDV-EPDSVIAVIVAAADALSSARPGARNES-MENY
RNY_STRA5       IGMEFARKYKEH-PIVVNTIASHHGDV-EPDSVIAVIVAAADALSSARPGARNES-MENY
RNY_STRPM       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRPF       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRPG       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRPB       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRPC       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRP3       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRP6       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRP1       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRP8       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRPD       IGMEFARKYKEH-PVVVNTIASHHGDV-EPDSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRMU       IGTEFARKYKEN-PVVINTIASHHGDV-EAQSVIAVLVAAADALSSARPGARNES-MENY
RNY_STRT2       IGTEFARKYKEH-PVVVNAIASHHGDV-EPESVIAVIVAAADALSSARPGARNES-VENY
RNY_STRT1       IGTEFARKYKEH-PVVVNAIASHHGDV-EPESVIAVIVAAADALSSARPGARNES-VENY
RNY_STRTD       IGTEFARKYKEH-PVVVNAIASHHGDV-EPESVIAVIVAAADALSSARPGARNES-VENY
RNY_STRPN       IGMELARKYKEP-PVVVNTIASHHGDV-EAESVIAVIVAAADALSAARPGARSES-LESY
RNY_STRR6       IGMELARKYKEP-PVVVNTIASHHGDV-EAESVIAVIVAAADALSAARPGARSES-LESY
RNY_STRPI       IGMELARKYKEP-PVVVNTIASHHGDV-EAESVIAVIVAAADALSAARPGARSES-LESY
RNY_STRP2       IGMELARKYKEP-PVVVNTIASHHGDV-EAESVIAVIVAAADALSAARPGARSES-LESY
RNY_STRGC       IGTELARKYKEN-PIVVNTIASHHGDV-EAESVIAVIVAAADALSAARPGARSES-LESY
RNY_STRSV       IGTELARKYKEH-PVVVNTIASHHGDV-EAESVIAVIVAAADALSAARPGARSES-LESY
RNY_STRSY       IGTELAKKYKEN-PIVINAIASHHGDV-EATSTIAVIVAAADALSAARPGSRRES-MEAY
RNY_STRS2       IGTELAKKYKEN-PIVINAIASHHGDV-EATSTIAVIVAAADALSAARPGSRRES-MEAY
RNY_LACAC       IGVELTRKYHEP-DVVVNAIAAHHGDV-PKLSFIAELVVAADTISSARPGARSES-LENY
RNY_LACH4       IGVELTRKYHES-DVVVNAIAAHHGDV-PKLSFIAELVVAADTISSARPGARSES-LENY
RNY_LACDA       IGVELTRKYHEP-DLVVNAIAAHHGDV-PKLSFIADLVVAADTISSARPGARSES-LENY
RNY_LACDB       IGVELTRKYHEP-DLVVNAIAAHHGDV-PKLSFIADLVVAADTISSARPGARSES-LENY
RNY_LACGA       IGVELARKYHEP-DLVVNAIAAHHDDV-PKLSFIAELVVAADTISSARPGARSES-LENY
RNY_LACJO       IGVELARKYHEP-DLVVNAIAAHHDDV-PKLSFIAELVVAADTISSARPGARSES-LENY
RNY_AYWBP       IGVSIASKYKEK-KEVIDAIASHHEDQ-EPQSIIAALVAIADTLSSARPGARKES-VENY
RNY_ONYPE       IGVFIASKYKEK-KEVIDAIASHHEDQ-EPQSIIAVLVAIADTLSSARPGARKES-VENY
RNY_ACHLI       IGVELMSRYKEP-KEVIDAIASHHGDS-EPESIIAVLVAAADALSAARPGARSES-MDSY
RNY_MAGMM       LGGELCKKYKED-DTVTNAVWSHHFDI-EPNSVYGPLTNAADALSAARPGARREN-VETY
RNY_THEMA       IGAELARRYGEK-EDIINMILSHHGEE-EPMTPEAVLVAAADALSAARPGARRES-LENY
RNY_THESQ       IGAELARRYGEK-EDIINMILSHHGEE-EPMTPEAVLVAAADALSAARPGARRES-LENY
RNY_THEP1       IGAELARRYGEK-EDIINMILSHHGEE-EPMTPEAVLVAAADALSAARPGARRES-LENY
RNY_PSELT       IGAEIARRYGES-DHIINMIMSHHGEQ-EPVCPESVLVAAADALSAARPGARRES-LETY
RNY_FERNB       IGAEMLKRYGES-DEIINMVMAHHGQE-EPITPEAAIVAAADAISAARPGARRED-VENY
RNY_THEM4       IGAEILRRYGES-REIINMVMAHHGEE-EPVTPEAVIVAAADALSAARPGARRED-VENY
RNY_PETMO       VGGQIAKRYGEK-LEVVNAIQYHHNEV-DPMTPEAVLVAASDALSASRPGARKET-LENY
RNY_AQUAE       IGVELARKYGEP-DAVINAIRAHHEEE-PVRYPEVALVCAADALSAARPGARRET-LEAY
RNY_BACFR       LGMKLAEKFKEK-PDICNAIGAHHDEI-EMTSLLAPIVQVCDAISGARPGARREI-VEAY
RNY_BACFN       LGMKLAEKFKEK-PDICNAIGAHHDEI-EMTSLLAPIVQVCDAISGARPGARREI-VEAY
RNY_BACTN       LGMKLAEKYKEK-PDICNAIGAHHDET-EMTSLLAPIVQVCDAISGARPGARREI-VEAY
RNY_BACV8       LGMKIAEKYKEK-PDICNAIGAHHDET-EMTSLLAPIVQVCDAISGARPGARREI-VEAY
RNY_PARD8       LGMKLCEKYKEK-PDICNAVGAHHDEV-EMQTLLAPIVQVCDAISGARPGARREI-VEAY
RNY_PORGI       LGMKLCEKFKEK-PDICNAVGAHHDEV-EMMSLIAPIVQVCDAISGARPGARREI-VEAY
RNY_CYTH3       LGMELAKKYKES-AEICNAIGAHHDEI-EMTGLISPIVQVCDAISGARPGARREV-MEQY
RNY_FLAJ1       LGMQWAEKYGEK-DEVCNAIGAHHDEI-EMKSLLSPIVQVCDAISGARPGARRQV-LDSY
RNY_FLAPJ       LGMQWAEKYGEK-EEVCNAIGAHHDEI-EMKSLLSPIVQVCDAISGARPGARRQV-LDSY
RNY_GRAFK       LGMQWAEKHGEK-PEVCNAIGAHHDEI-EMNSLLSPIVQVCDAISGARPGARRQV-LDSY
RNY_PELLD       AASEFLRKFKES-AVVLNAIAAHHGEA-EKESPIAELVDAANVISLARPGARGAVTADGN
RNY_CHLPM       SGRNFLKRFNES-GVVLNAIAAHHGEV-EKESPIAELVDAANVISLSRPGARGAMTADGN
RNY_CHLPD       AGRNFLKKFNES-AVVLNAVAAHHGDV-VKESPIAELVDAANVISLSRPGARGAVTADGN
RNY_CHLCH       TGMNFMKKFNES-DQLLNAIGAHHGDM-EKESPLADLVDAANTISLSRPGARGAVTADGN
RNY_CHLTE       AGMEFLKKFNMS-PVVLNAIGAHHGEV-EKASPIADLVDAANIVSLSRPGARGAVTAEGN
RNY1_BDEBA      VGAEAAKKYNES-EDVCHAIRAHDEEE-KPHSILAWIVHAAYTLSSSRPGARRPQ-MDTF
RNY2_BDEBA      IGADFIAARGEA-PDVVHAVKAHHFDE-QPSTDHAFLVIAADAVSGARPGARRST-IESY
RNY2_LACBA      IGTEFAQKYGED-DVVINAIAAHHGDV-EKTSPLAELVAAADAISGARPGARSES-VEDY
RNY2_PEDPA      LGVELTTKYRES-PVIVNTIASHHGDV-EARYVIANLVEAADAISGARQGARSES-VADY
RNY_MYCGE       TGAKLAEQFQLP-DDIKYTIANHHNKH--IDNTYCRLTQIADKLSAARIGARSDS-SLLF
RNY_MYCPN       TGAKIGDEFYFE-NDVKYTIANHHNKN--VDNVYCRLTQIGDKLSAGRLGARSDS-SVLF
                 .             :      :                     *  : *:*        

RNY_UREPA       YSRVKELETICMR-FEGVKSAYVIK-SGRQLRVIVDSNL----VSDEQLELLGHEIKVAI
RNY_UREP2       YSRVKELETICMR-FEGVKSAYVIK-SGRQLRVIVDSNL----VSDEQLELLGHEIKVAI
RNY_MYCPE       FKRIEELEKICKS-FEGVSDAYVIK-SGREIEVIIDPSL----VSDDECKILIKDIKFKL
RNY_MYCCT       ILRMTEIEKIGNS-IPGVAKTYALQ-SGRQIRLIVDPLV----ASDLDLAMILEKMKEEI
RNY_MYCMS       ILRMTEIEKIGNS-IPGVAKTYALQ-SGRQIRLIVNPLV----ASDLDLAMILEKMKEEI
RNY_MESFL       IVRMKEIEKIGNS-IPGISKTYAFQ-AGRQIRVIVDPVT----TDDKDLAGILETLKNDL
RNY_CAMJR       LKRVSELEDIAKS-KEGIKNAYAIN-AGREIRVIANAQL----VNDDESVLLAKEIAAEI
RNY_CAMJJ       LKRVSELEDIAKS-KEGIKNAYAIN-AGREIRVIANAQL----VNDDESVLLAKEIAAEI
RNY_CAMJE       LKRVSELEDIAKS-KEGIKNAYAIN-AGREIRVIANAQL----VNDDESVLLAKEIAAEI
RNY_CAMJ8       LKRVSELEDIAKS-KEGIKNAYAIN-AGREIRVIANAQL----VNDDESVLLAKEIAAEI
RNY_CAMJD       LKRVSELEDIAKS-KEGIKNAYAIN-AGREIRIIANAQL----VNDDESVLLAKEIAAEI
RNY_CAMC1       LKRVEEIENIAKS-KEGIKQAYAIN-AGREIRVIANAKL----INDDEAVLVAKEIAQEI
RNY_CAMC5       LKRVEEVENIAKS-KDGIKQAYAIN-AGREIRVIANAKL----INDDEAVLVAKEIAKEI
RNY_CAMFF       LKRVEEIESIAIS-KEGIKGAYAIN-AGREIRVIANAKL----VNDDEAVLLAKEIAEEI
RNY_CAMHC       LKRVSEIENIATS-KEGVKQAYAIN-AGREIRVIANAKL----VNDDEAVLLAKEIAEEI
RNY_NITSB       LKRVQAIEEIALS-KPGVKKAYAIN-AGREVRVIVNADL----VNDNEAVLLAKEIAKDI
RNY_SULDN       LKRVTAIEEIASQ-HSGVKQAYAIN-AGREVRVIVNASL----INDDESILLAKEIASEI
RNY_HELHP       LKRMQDIERIAMD-KIGVKQAYAIN-AGREVRVIARADL----VSDGQSVILAREIAKEI
RNY_WOLSU       LKRVQEIEKIAME-KLGVRQAYAIN-AGREVRVIVNADL----INDEESVLLAQEIAKEI
RNY_SULNB       TKRVKEIEEIATS-KENVERAYAIN-AGREIRVFVNANR----MSDNEAVLLSKEIAKEI
RNY_ARCB4       LKRVEEVENISTS-KLGVLNAYAIN-AGREVRVIVKAEL----VNDDEAVLLATEIAKEI
RNY_HELPY       AKRMQALEEIALE-FDGVEKAYAME-SGRELRVIVKSNQ----VRDNQVPIIARKIAKKI
RNY_HELPH       AKRMQALEEIALE-FDGVEKAYAME-SGRELRVIVKSNQ----VRDNQVPIIARKIAKKI
RNY_HELPJ       AKRMQALEEIALE-FDGVEKAYAME-SGRELRVIVKSNQ----VRDNQVPIIARKIAKRI
RNY_HELAH       AKRMQALEEIALG-FEGVEKAYAME-SGRELRVIVKSNQ----VRDNQVPIIARKIAKKI
RNY_BORBU       INRLKRLEDIAYS-FEGVQKCYAIQ-AGREVRIIVDNAL----INDEKSILLARDIAKKI
RNY_BORAP       INRLKRLEDIAYS-FEGVQKCYAIQ-AGREVRIIVDNAL----INDEKSILLARDIAKKI
RNY_BORBP       INRLKRLEDIAYS-FEGVQKCYAIQ-AGREVRIIVDNVL----VNDEKSILLARDIAKKI
RNY_TREPA       VKRLENLEAIAEG-FSGVEKAYAIQ-AGRELRVLVNNDK----IPDRDVKALGRDIAKKI
RNY_TREDE       VKRLENLEQLAEG-FNGVEKAYAIQ-AGRELRVVINNEK----ISDADTKILARDIAKKI
RNY_UNCTG       LKRLEKLEKVVKE-FRGVSIAYAMQ-AGREVRILVEPEK----INDNQTQILAHDIAKKI
RNY_GEOMG       VKRLDDLERIATS-FVGVNNSFAIQ-AGREIRVMVSSDE----VTDERAVVLAKDIAKKI
RNY_GEOSL       VKRLEDLERISCS-FGGVNNSFAIQ-AGREIRVMVSSEE----VSDERAVLLAKDIAKKI
RNY_GEOUR       VKRLDDLERIACS-FSGVTNSFAIQ-AGREIRVMVSSEE----ISDERTLILAKDIAKKI
RNY_PELPD       VKRLDDLERIATS-FGGVTNSFAIQ-AGREIRVMVSSDH----VTDEQSLIMARDIAKKI
RNY_PELCD       VKRLQDLERIGTS-FAGVTNCYAIQ-AGREIRVMVSSEE----VSDVQSHTLAKQIARQI
RNY_SYNFM       VKRLEDLERIAGS-FPGINKAYAIQ-AGRELRIIVESGQ----VNDADVVLLSRDIAKKI
RNY_SYNAS       VKRLEELENIANS-FNGVDKCFAIQ-AGREIRILVGSEK----LSDNDAMMLCKDIVKKI
RNY_DESPS       VKRLEDLEAIANK-FPGVDKSYAIQ-AGRDLRIIADAQK----ISDAEATLLSRNIAASI
RNY_DESVH       VKRLEDLENIATG-FEGVSKVYAIQ-AGREIRVMVNSEN----VDDDQTYMLCKDIAAKI
RNY_DESVV       VKRLEDLENIATG-FEGVSKVYAIQ-AGREIRVMVNSEN----VDDDQTYMLCKDIAAKI
RNY_DESAG       VKRLEDLEGIANG-MEGVSKAYAIQ-AGREIRVLVNSDE----VDDDTTYMLCKDISEKI
RNY_LAWIP       VKRLEHLENIAGE-FEGVSKAYAIQ-AGREVRVMVDADS----IGDDQTYLLCKDIAGRI
RNY_CLOB1       IKRLEKLEEIANE-CEGVEKSYAIQ-AGREIRIMVKPEV----LDDTGCIEMARNIVKQI
RNY_CLOBH       IKRLEKLEEIANE-CEGVEKSYAIQ-AGREIRIMVKPEV----LDDTGCIEMARNIVKQI
RNY_CLOBM       IKRLEKLEEIANE-CEGVEKSYAIQ-AGREIRIMVKPEV----LDDTGCIEMARNIVKQI
RNY_CLOBL       IKRLEKLEEIANE-CEGVEKSYAIQ-AGREIRIMVKPEV----LDDTGCIEMARNIVKQI
RNY_CLOBK       IKRLEKLEEIANE-CEGVEKSYAIQ-AGREIRIMVKPEV----LDDTGCIEMARNIVKQI
RNY_CLOK5       IKRLEKLEKIANT-CEGVEKSYAIQ-AGRELRIMVKPED----IDDAGALEMARNIVKKI
RNY_CLONN       IKRLEKLEEIANS-YEGVEKSYAIQ-AGREVRIMVKPED----IDDYGCIEMSKNIVKRI
RNY_CLOTE       IKRLEKLEEIANS-YEGVEKSYAIQ-AGRELRIIVKPEV----VDDAGSYEMARNMAKTI
RNY_CLOAB       IKRLEKLEEIANS-YEGVEKSYAIQ-AGREIRIMVKPET----VDDAGSIEMARGIVKKI
RNY_CLOPE       IKRLEKLEEIATS-YEGVEKSYAIQ-AGREIRIMVKPDQ----VDDAGAIEMARNIVKKI
RNY_CLOP1       IKRLEKLEEIATS-YEGVEKSYAIQ-AGREIRIMVKPDQ----VDDAGAIEMARNIVKKI
RNY_CLOPS       IKRLEKLEEIATS-YEGVEKSYAIQ-AGREIRIMVKPDQ----VDDAGAIEMARNIVKKI
RNY_CLOB8       IKRLEKLEEIANS-HEGVEKSYAIQ-AGREIRIMVKPDK----VDDAGTIELARNLVKSV
RNY_THEP3       IKRLDKLEQIANS-FEGVEKSYAIQ-AGREIRIMVKPEI----VDDDDIVILARNISKKI
RNY_THEPX       IKRLDKLEQIANS-FEGVEKSYAIQ-AGREIRIMVKPEI----VNDDDIVILARNISKKI
RNY_CALS4       IKRLDKLEQIANS-FEGVEKAYAIQ-AGREIRIMVKPEA----ISDDELVILARNISKKI
RNY_NATTJ       IKRLEKLEEIADS-YKSVEKAYAIQ-AGREVRIMVKPEQ----ADDETSINLARDISKQI
RNY_ALKMQ       IKRLEKLEDIANN-YDGVEKSFAIQ-AGREIRIIVKPEV----YNDDEIYMFAREITKKI
RNY_ALKOO       IKRLEKLEEIANG-HDGVEKSYAIQ-AGREIRIIVKPEV----YNDEEIFMLARNITKKI
RNY_CLOD6       IKRLEKLEEIANS-YEGVEKSFAIQ-AGREIRIMVKPEA----INDEEIHLLARDMTKKI
RNY_DESRM       IKRLQKLEEIAGT-FEGVEKSFAIQ-AGREIRIMVKPDK----IDDLAAIRLVRDIAKKI
RNY_PELTS       IKRLTKLEEIANS-FDGVEKSYAIQ-AGREVRIMVKPEK----IDDLGAIRLVREITKKI
RNY_DESAP       VKRLTKLEDIANS-FPGVEKAFAIQ-AGREIRIMVKPDK----VDDLGAVRLVRDIARKI
RNY_CARHZ       LKRLEKLEGIANE-FEGVEKSYAIQ-AGRELRILVKPEK----IDDLASVRLAREIAKKI
RNY_DESHY       IKRLQKLEEIADT-YDGVEKSYAIQ-AGREIRIIVRPDK----IDDVLAPKVAREISKRI
RNY_HELMI       IKRLQKLEEIADS-FEGVEKAFAIQ-AGREIRIMVKPDK----VDDAESLRVAREIVKRI
RNY_MOOTA       IKRLEKLEEIANS-FSGVEKSYAIQ-AGREVRILVKPDK----IDDAMAVRLARDIVKTI
RNY_LACP7       TNRLKQLEDITNG-FKGVDKSFAIQ-AGREVRVMVVPDQ----VTDDDMVLLARDLSKKI
RNY_HUNT2       IKRLEKLEEIANS-FDGVDKCFAIQ-AGREIRIMVKPED----VSDSDIALIARDIVKRI
RNY_CALS8       IKRLQKLEEIANS-FDGVEKAYAIQ-AGREIRIMVKPDH----VSDDDIVIMAREIVKRI
RNY_SYMTH       IKRLEKLEALADS-FDGVDKSYAIQ-AGREIRVMVKPEK----IDDYAALKLTKEIARKI
RNY_SYNWW       IKRLEKLENVAES-FSGVDRTFAIQ-AGREIRIIVKPEE----IDDLHSINLARDIAAKI
RNY_FINM2       IQRLENLEQIANS-FDGIESSYAIQ-AGREIRIMVKPDV----IDESSMVILAKDVAHKI
RNY_FUSNN       IKRLENLEEIANS-FEGVESSYAIQ-AGRELRIVINPDK----VSDDEATLMSREVAKKI
RNY_ROSCS       IKRLEALETVATS-FSGVQRAFAVQ-AGREVRVMVQPDA----IDDLGSIHLARDVAKKI
RNY_ROSS1       IKRLEALETVATS-FTGVQRAFAVQ-AGREVRVMVQPDA----IDDLGSIHLARDVAKKI
RNY_CHLAA       IKRLEALETVATS-FPGVQRAFAVQ-AGREVRVMVQPDQ----IDDLASIHLARNVAKKI
RNY_DEHMB       IKRLKALEEIADS-FKGVEKSFAIQ-AGREVRIMVKPDE----IDDLGAMRLARDIVKRI
RNY_DEHMC       IKRLKALEEIADS-FKGVEKSFAIQ-AGREVRIMVKPDE----IDDLGAMRLARDIVKRI
RNY_DEHM1       IKRLKALEEIADS-FKGVEKSFAIQ-AGREVRIMVKPEE----IDDLGAMRLARDIVKKI
RNY_DEIRA       VRRLEQLEQIAVA-FPGVQQAYAIQ-AGREVRVIVQPEK----VTDAQATLLARDIAGRV
RNY_DEIGD       VRRLEQLEQIAIA-FPGVQQAYAIQ-AGREVRVLVQPEK----VTDAQATLLAREIAGRI
RNY_THET2       LQRLEALERIALS-FPGVETAFAVQ-AGREVRVIVKPEK----ISDAKATLLAREIASRI
RNY_THET8       LQRLEALERIALS-FPGVETAFAVQ-AGREVRVIVKPEK----ISDAKATLLAREIASRI
RNY_SALAI       VRRLERIEEIAAG-KLGVERVFAMQ-AGREVRVMVRPED----VDDISASVLARDVAKQI
RNY_SALTO       VRRLERIEEIAGG-KLGVERVFAMQ-AGREVRVMVRPDD----VDDLSASMLARDVAKQI
RNY_ACIC1       VQRLERLEEIASA-YEGVEKVFAMQ-AGRELRVMVLPDV----VDDIQAQVIARDIAKQI
RNY_FRASN       VKRLERIEQIAAE-RPGVEKVFAMQ-AGREVRVMVVPEL----VDDVAAHLLARDVAKQI
RNY_THEFY       VKRLQRMEEIAYAVSDGVEKVFVMQ-AGREIRVMVQPEA----VDDVQAQVIARDIAKRV
RNY_CUTAK       VRRMDTIEEIATS-FPGVVRAFALQ-AGREMQILVDPGA----VDDHQASRLARQIALAI
RNY_RHOBA       VKRMEELESIAQR-FDGVQQAYAIS-AGRELRVMVGSQQ----VSDERAAAICRDIASTF
RNY_OPITP       IQRLGRLEKLAMA-IDGVQQAFAIQ-AGREIRVVVSPQT----VTDDRAREIAKELRKRI
RNY_RUBXD       LERLRNLEDIALS-HRGVDKAYAIQ-AGREIRVMVQPSE----VDDRIAAKLAYDISRKI
RNY_PARUW       IKRLRKLEEIALE-FAGVDKAYAMQ-AGREIRIVVLPDQ----VDDAGVVNLARDLTKRI
RNY_STAA2       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAA1       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAAE       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAAT       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAA8       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAAB       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAAC       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAAR       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAAS       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAAM       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAAW       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAAN       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAA3       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAA9       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVIVSPEE----IDDLKSYRLARDIKNQI
RNY_STAES       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVVVSPEE----IDDLKSYRLARDIKNQI
RNY_STAEQ       IRRLERLETLSES-YDGVEKAFAIQ-AGREIRVVVSPEE----IDDLKSYRLARDIKNQI
RNY_STAHJ       IRRLERLETLSEG-YDGVEKAFAIQ-AGREIRVIVSPDE----IDDLKSYRLARDIKTQI
RNY_STAS1       IRRLERLETLSES-YEGVEKAFAIQ-AGREIRVIVSPDT----IDDLKSHRLARDIKSQI
RNY_BACHD       IRRLEKLEEISES-FDGVEKTYAIQ-AGREVRIMVKPDI----VDDVLAHKLARDITKKI
RNY_BACSK       IRRLEKLEEISES-FDGVEKTFAIQ-AGREVRIMVRPDV----VDDALAHKLARDITKKI
RNY_EXIS2       IRRLERLEEISES-FDGVEKSFAIQ-AGREVRIIVRPDV----VDDVLAHKMASDIRKKI
RNY_BACSU       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRIMVKPDS----INDLEAHRLARDIRKRI
RNY_BACVZ       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRIMVKPDS----INDLEAHRLARDIRKRI
RNY_BACLD       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRIMVKPDS----INDLEAHRLARDIRKRI
RNY_BACP2       IRRLEKLEDISES-YEGVEKSFAIQ-AGREVRIMVKPDS----INDLEAHRLARDIRKRI
RNY_BACAN       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRILVKPDT----IDDLEAHRLARDIRKRI
RNY_BACAH       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRILVKPDT----IDDLEAHRLARDIRKRI
RNY_BACHK       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRILVKPDT----IDDLEAHRLARDIRKRI
RNY_BACCZ       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRILVKPDT----IDDLEAHRLARDIRKRI
RNY_BACC1       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRILVKPDT----IDDLEAHRLARDIRKRI
RNY_BACCR       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRILVKPDT----IDDLEAHRLARDIRKRI
RNY_BACMK       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRILVKPDT----IDDLEAHRLARDIRKRI
RNY_BACCN       IRRLEKLEEISES-YEGVEKSFAIQ-AGREVRILVKPDT----IDDLEAHRLARDIRKRI
RNY_GEOKA       IRRLEKLEEIAES-YEGVEKSYAIQ-AGREVRIMVKPDM----IDDLEAHRLARDIRKRI
RNY_GEOTN       IRRLEKLEEIAES-YEGVEKSYAIQ-AGREVRIMVKPDM----IDDLEAHRLARDIRKRI
RNY_LYSSC       IRRLEKLEEISES-YDGVEKSYAIQ-AGREIRIIVQPEK----IDDLASHRLARDIRKRI
RNY_OCEIH       IKRLEKLEEISES-FDGVEKSFAIQ-AGREIRIMVRPDE----IDDIESISIARDIRKRI
RNY_LISIN       IRRLEKLEEISES-YDGVEKSYAIQ-AGREVRIIVEPDT----IDDLSSYRLARDIRKRI
RNY_LISMO       IRRLEKLEEISES-YDGVEKSYAIQ-AGREVRIIVEPDT----IDDLSSYRLARDIRKRI
RNY_LISMF       IRRLEKLEEISES-YDGVEKSYAIQ-AGREVRIIVEPDT----IDDLSSYRLARDIRKRI
RNY_LISW6       IRRLEKLEEISES-YDGVEKSYAIQ-AGREVRIIVEPDT----IDDLSSYRLARDIRKRI
RNY_LACPL       IHRLEKLEAIANN-EDGVKKSYAIQ-AGREIRVIVKPNE----ISDLQATVLAHDVKKQI
RNY1_LACBA      IHRLDKLETIANE-FDGVDHSFAIQ-AGREVRVIVRPDR----ISDTDAVVLARDIKQQI
RNY1_PEDPA      IHRLEKLEQISNN-FDGVKKSYAIQ-AGREVRVIVKPNK----INDLKAVMLTHNIRKAI
RNY_LACP3       LHRLEKLEAIANS-HAGVDHSFAIQ-AGREVRVIVQPEK----LSDDQSVILARDIRNEI
RNY_LACSS       IHRLEKLESITNS-FKGVDHSFAIQ-AGREVRVIVKPEQ----VTDDQATVLARDVKNQI
RNY_ENTFA       IRRLENLENISNS-FEGVDSSFAVQ-AGREVRVMVKPEE----ISDLESVRLVRDIRKKI
RNY_LACS1       IHRLEKLEDISNE-FKGVQKSYAIQ-AGREVRVIVQPNE----VSDLEATVLARDIRMKI
RNY_LEUCK       VQRLKDLEAIANH-YDGVETAFAIQ-AGREVRVIVEPTK----LNDLQATVLAHDIKTDV
RNY_LEUMM       VQRLKDLEAIANN-NQEVHTAYAIQ-AGREVRVIVEPTK----VTDLQAKVLAHDIKSDV
RNY_LACLM       IKRLKDLEAISTS-FDGVETAFALQ-AGREIRVMVKPDK----LTDDQIVILARDVKNRI
RNY_LACLS       IKRLKDLEAISTS-FDGVETAFALQ-AGREIRVMVKPDK----LTDDQIVILARDVKNRI
RNY_LACLA       IKRLKDLEAISTS-FEGVETAFALQ-AGREIRVMVKPEK----LTDDQIVILARDVKNRI
RNY_STRA3       IKRLRDLEEIANG-FEGVQNAFALQ-AGREIRIMVQPGK----VSDDQVVIMSHKVREKI
RNY_STRA1       IKRLRDLEEIANG-FEGVQNAFALQ-AGREIRIMVQPGK----VSDDQVVIMSHKVREKI
RNY_STRA5       IKRLRDLEEIANG-FEGVQNAFALQ-AGREIRIMVQPGK----VSDDQVVIMSHKVREKI
RNY_STRPM       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRPF       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRPG       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRPB       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRPC       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRP3       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRP6       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRP1       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRP8       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRPD       IKRLRDLEEIATS-FDGVQNSFALQ-AGREIRIMVQPEK----ISDDQVVILSHKVREKI
RNY_STRMU       IKRLRDLEEIATS-FDGVQNSYALQ-AGREIRIMVQPEK----LSDDDVTILAHKVREKI
RNY_STRT2       VKRLRDLEEIASS-FDGVQTSFALQ-AGREIRIMVHPNK----ISDDEVTILSHKIREQI
RNY_STRT1       VKRLRDLEEIASS-FDGVQTSFALQ-AGREIRIMVHPNK----ISDDEVTILSHKIREQI
RNY_STRTD       VKRLRDLEEIASS-FDGVQTSFALQ-AGREIRIMVHPNK----ISDDEVTILSHKIREQI
RNY_STRPN       IKRLHDLEEIANG-FEGVQTSFALQ-AGREIRIMVNPGK----IKDDKVTILAHKVRKKI
RNY_STRR6       IKRLHDLEEIANG-FEGVQTSFALQ-AGREIRIMVNPGK----IKDDKVTILAHKVRKKI
RNY_STRPI       IKRLHDLEEIANG-FEGVQTSFALQ-AGREIRIMVNPGK----IKDDKVTILAHKVRKKI
RNY_STRP2       IKRLHDLEEIANG-FEGVQTSFALQ-AGREIRIMVNPGK----IKDDKVTILAHKVRKKI
RNY_STRGC       IKRLHDLEEIANE-FDGVKTSFALQ-AGREIRIMVHPEK----IKDDKVTILAHDVREKI
RNY_STRSV       IKRLQDLEEIANS-FKGVKNSFALQ-AGREIRIMVQPDK----IKDDKITILAHDVREKI
RNY_STRSY       IKRLQDLEEIANS-FEGIKQSYAIQ-AGREIRIIVHPNK----VTDDQITILAHDVREKI
RNY_STRS2       IKRLQDLEEIANS-FEGIKQSYAIQ-AGREIRIIVHPNK----VTDDQITILAHDVREKI
RNY_LACAC       IRRLTDLEKIAKS-YQGVKQAYAIQ-AGREVRVMVEPDE----ISDDRTVILARDIRNQV
RNY_LACH4       IRRLTELEKIAKS-YQGVKQAYAIQ-AGREVRVMVEPDE----ISDDRTVILARDIRNQV
RNY_LACDA       IRRLTELEDIAGS-YDGVKQAYAIQ-AGREVRVMVEPGK----ISDDEITVLAHEIRDRV
RNY_LACDB       IRRLTELEDIAGS-YDGVKQAYAIQ-AGREVRVMVEPGK----ISDDEITVLAHEIRDRV
RNY_LACGA       IRRLEQLETIAKG-HIGVKQAYAIQ-AGREIRVMVEPDK----ISDARTTILAHDIKNQI
RNY_LACJO       IRRLEQLETIAKG-HIGVKQAYAIQ-AGREIRVMVEPDK----ISDARTTILAHDIRNQI
RNY_AYWBP       IQRLTKLETIANS-TKGVAKSYAIQ-AGREIRVIVEPDK----IADNFIFQTARTIKEQI
RNY_ONYPE       IQRLTKLETIANA-TEGVAKSYAIQ-AGREIRVIVEPDK----IADNFIFQTARTIKEQI
RNY_ACHLI       MKRLTQLEEISND-VTGVDKAYAIQ-AGREVRVMVLPDK----VDDLGLINIARTIKEKI
RNY_MAGMM       IRRLEELERIATE-FKGVEKAYAIQ-AGRELRVMVAYDR----VNDEGSMLLAREIAQQV
RNY_THEMA       IKRLMKLEEIAKS-FKYVEKAYAIQ-AGREIRVIVEPDK----VDDALAEKLAYDISKKI
RNY_THESQ       IKRLMKLEEIAKS-FKYVEKAYAIQ-AGREIRVIVEPDK----VDDALAEKLAYDISKKI
RNY_THEP1       IKRLMKLEEIAKS-FKYVEKAYAIQ-AGREIRVIVEPDK----VDDALAEKLAYDISKKI
RNY_PSELT       IRRLVKMEKIAMS-FKNVEKAYAIQ-AGREVRVIVEPEK----IDDVEADKMAYEIAKKI
RNY_FERNB       IKRLMKLEEIAKS-YKYVENAYAIQ-AGREIRVIVQPDK----TDDATIEKLAHDIATRI
RNY_THEM4       IKRLIKLEEIAKS-FKYVENAYAIQ-AGREVRVIVQPDK----IDDVLADKLSHDIAIKI
RNY_PETMO       IRRIEQLEEIAKS-FRYVDKAYAIQ-AGRELRIIVQPDK----VEDEIAEKLAHDISVQI
RNY_AQUAE       IRRLEKLEEIVKS-FKGVANAYAVQ-AGREVRVIVNPEE----ISDEEAYLLSKEIPKKI
RNY_BACFR       IKRLNDLEQLAMS-YPGVTKTYAIQ-AGRELRVIVGADK----IDDKQTENLSGEIAKKI
RNY_BACFN       IKRLNDLEQLAMS-YPGVTKTYAIQ-AGRELRVIVGADK----IDDKQTENLSGEIAKKI
RNY_BACTN       IKRLNDLEQLAMA-YPGVTKTYAIQ-AGRELRVIVGADK----IDDKQTESLSGEIAKKI
RNY_BACV8       IKRLNDLEQLAMS-YPGVTKTYAIQ-AGRELRVIVGADK----IDDKQTESLSGEIAKKI
RNY_PARD8       IKRLNDLEQLALS-YPGVVKTYAIQ-AGRELRVIVGADK----IDDKDTENLSAEIAKKI
RNY_PORGI       IKRLNDLEQLAMS-YPGVIKTYAIQ-AGRELRVIVGADK----TDDASVETLSNEIAKRI
RNY_CYTH3       IKRLKDLEQLALS-FDGVLKCYAIQ-AGRELRIMVDAEN----VSDDKAGILSFDIAQKI
RNY_FLAJ1       IQRLKDLEDVAYG-FSGVKNAYAIQ-AGRELRVIVESEK----VSDDNAANLSFEISQKI
RNY_FLAPJ       IQRLKDLEEVAYG-FNGVKSAYAIQ-AGRELRVIVESEK----VSDDNASNLSFEISQKI
RNY_GRAFK       IQRLKDLEEIAFG-FGGVKKAYAIQ-AGRELRVIVESEK----VSDEKASNLSFEISQKI
RNY_PELLD       VKRLESLEEIAKG-FPGVLKTYALQ-AGREIRVIVEGDN----VSDSQADVLAHDIAHKI
RNY_CHLPM       VKRLESLEEIAKG-FPGVIKTYALQ-AGREIRVIVEGDN----VSDSQADVLAHDIAHKI
RNY_CHLPD       VKRLESLEEIAKG-FPGVLKTYALQ-AGREIRVIVEGDN----VSDSQADVLAHDIARKI
RNY_CHLCH       VKRLESLEEIAKG-FPGVLKTYALQ-AGREIRVIVEGDN----VSDSQADMLAHDIARKI
RNY_CHLTE       VKRLESLEEIART-FPGVIKTYALQ-AGREIRVIVEGDN----VSDSQADVLAHDIASKI
RNY1_BDEBA      IHRLEDLESIGNS-FDGVLKTLALQ-AGKDIRVLVESSR----VTDDQAVMLSRDIARKI
RNY2_BDEBA      NQKVSELQDIARS-FPGVTDCFVLS-GGRECRVMVNGKK----VDDTQAMDLSRKIAARI
RNY2_LACBA      INRLRALEKIAND-QSGVAESYAIQ-AGRELRIIVKPQE----LDDTAAANLTQEVAQQI
RNY2_PEDPA      IQRIKSLEEIANK-HPEVKESYAIQ-AGRELRVIVQPKE----TDDKTIHSLATNVKNQI
RNY_MYCGE       KQLKDELKKIVDKTINNFHTTILLGQSGRRLMIWLETKNQNQLLSNEQIIEMVEKIKAEI
RNY_MYCPN       SQLKQELKQIVEETLAQFKTTILLGQSGRRLVIWLETNQHNNIIDNQQLTDLATTIKSKI
                      :: :       .     .  .*:   :            :         :   .

RNY_UREPA       EENDLLTNYKIKIVLIKEKRISIDTNIIG--------------
RNY_UREP2       EENDLLTNYKIKIVLIKEKRISIDTNIIG--------------
RNY_MYCPE       EDSDLVNKQPIQITLIRKFTQSITTLGSASRLRT---------
RNY_MYCCT       KN-KVIIPGEITITVIRERKETDVLK-----------------
RNY_MYCMS       KN-KVIIPGEITITVIRERKETDVLK-----------------
RNY_MESFL       KN-SVIIPGEITITAIREKREILVFN-----------------
RNY_CAMJR       QE-KMQYPGEIKVNVIRELRAVEYAK-----------------
RNY_CAMJJ       QE-KMQYPGEIKVNVIRELRAVEYAK-----------------
RNY_CAMJE       QE-KMQYPGEIKVNVIRELRAVEYAK-----------------
RNY_CAMJ8       QE-KMQYPGEIKVNVIRELRAVEYAK-----------------
RNY_CAMJD       QE-KMQYPGEIKVNVIRELRAIEYAK-----------------
RNY_CAMC1       ES-KVQYPGEIKVSVIRETRAVDFAK-----------------
RNY_CAMC5       EE-KVQYPGEIKVSVIRETRAVDYAK-----------------
RNY_CAMFF       QD-KIQYPGEIKVNVIRELRAIEFAK-----------------
RNY_CAMHC       QA-KVQYPGEIKVNIIRETRAVDYAK-----------------
RNY_NITSB       ET-GVQYPGEIKVNVIRENRAIEYAR-----------------
RNY_SULDN       EH-GVQYPGEIKVNVIRESRAVEFAK-----------------
RNY_HELHP       ES-TLQYPGEIKVSVIRETRAVEFAR-----------------
RNY_WOLSU       ET-KVQYPGEIKVSVIREVRAVEFAK-----------------
RNY_SULNB       KD-KVQFPGEIKVNVIRETRAVSIAK-----------------
RNY_ARCB4       EE-KVQYPGEIKVNVIRETRAESYAR-----------------
RNY_HELPY       EE-SAQYVGEVGVQVVRESRFKTTATLKQ--------------
RNY_HELPH       EE-SAQYVGEVGVQVVRENRFKTTATLKQ--------------
RNY_HELPJ       EE-STQYVGEVGVQVVRENRFKTTATLKQ--------------
RNY_HELAH       EE-SAQYVGEVGVQVVRESRFKTTATLKQ--------------
RNY_BORBU       EA-EMRYPGKIKVTIIRETRVIEYAR-----------------
RNY_BORAP       EA-EMRYPGKIKVTIIRETRVIEYAR-----------------
RNY_BORBP       EA-EMRYPGKIKVTIIRETRVIEYAR-----------------
RNY_TREPA       ES-DLKYPGRIRVTLIRETRVVEYAR-----------------
RNY_TREDE       EN-DLQYPGRIRVTLIRETRIVEYAR-----------------
RNY_UNCTG       EQ-ELEYPGQIKITVVRETRVQEIAK-----------------
RNY_GEOMG       EA-EMTYPGQIKVNVIRETRAIEYAR-----------------
RNY_GEOSL       EA-EMTYPGQIKVNVIRETRAIEYAR-----------------
RNY_GEOUR       ET-EMTYPGQIKINVIRETRATEYAR-----------------
RNY_PELPD       EA-EMTYPGQIKVNVIRETRAVEYAR-----------------
RNY_PELCD       EE-EMAYPGQIKINVIRETRAVEFAK-----------------
RNY_SYNFM       EG-ELTYPGQIKVTVIRETRAVEYAK-----------------
RNY_SYNAS       ES-ELTYPGQIKVTVIRETRVSDFAK-----------------
RNY_DESPS       EE-KLTYPGQIRVTVIRETRSVEYAK-----------------
RNY_DESVH       EK-NLTYPGQIRVTVIRERRAVGYAK-----------------
RNY_DESVV       EK-NLTYPGQIRVTVIRERRAVGYAK-----------------
RNY_DESAG       EK-NLTYPGQIRVTVIRERRAVGVAK-----------------
RNY_LAWIP       EE-SLTYPGQIRVTVIREHRAVGYAK-----------------
RNY_CLOB1       ES-ELEYPGQIKVNVIRETRAIEYAK-----------------
RNY_CLOBH       ES-ELEYPGQIKVNVIRETRAIEYAK-----------------
RNY_CLOBM       ES-ELEYPGQIKVNVIRETRAIEYAK-----------------
RNY_CLOBL       ES-ELEYPGQIKVNVIRETRAIEYAK-----------------
RNY_CLOBK       ES-ELEYPGQIKVNVIRETRAIEYAK-----------------
RNY_CLOK5       EE-ELEYPGQIKVNVIRETRAIEYAK-----------------
RNY_CLONN       ES-ELEYPGQIKVNIIREVRAVEYAK-----------------
RNY_CLOTE       EN-ELEYLVKLR-------------------------------
RNY_CLOAB       EE-QLEYPGQIKVNVIRETRAVEYAK-----------------
RNY_CLOPE       EE-QLEYPGQIKINVIRETRAVDYAK-----------------
RNY_CLOP1       EE-QLEYPGQIKINVIRETRAVDYAK-----------------
RNY_CLOPS       EE-QLEYPGQIKINVIRETRAVDYAK-----------------
RNY_CLOB8       EE-ELEYPGQIKINVIRETRAVDFAK-----------------
RNY_THEP3       EE-EVEYPGQIKVTVIRETVAVDYAK-----------------
RNY_THEPX       EE-EVEYPGQIKVTVIRETVAVDYAK-----------------
RNY_CALS4       EE-EVEYPGQIKVTVIRETVAIDYAK-----------------
RNY_NATTJ       EA-ELDYPGQIKITVIRETRAVEYAK-----------------
RNY_ALKMQ       EA-DLEYPGQIKVNVIRETRAIEYAK-----------------
RNY_ALKOO       EF-ELEYPGQIKVNVIRETRAIEYAK-----------------
RNY_CLOD6       ED-ELEYPGQIKVSIIRETRAIEYAK-----------------
RNY_DESRM       EN-ELDYPGQIKVIIIRETRYVEYAK-----------------
RNY_PELTS       EN-ELDYPGQIKVVIIRETRVVEYAK-----------------
RNY_DESAP       EN-ELEYPGQIKVVIIRETRVVEYAK-----------------
RNY_CARHZ       EE-EVEYPGQIKVTVIRETRAVDYAK-----------------
RNY_DESHY       ED-ELEYPGQIKVVVIRETRAVDYAK-----------------
RNY_HELMI       ES-ELEYPGQIKVVVIRETRAVDYAK-----------------
RNY_MOOTA       EQ-TMEYPGQIKVVVIRETRAVDYAK-----------------
RNY_LACP7       ES-ELEYPGMIKVNVIRESRVTDYAK-----------------
RNY_HUNT2       EN-ELDYPGQIKVNVIRETRYIEYAK-----------------
RNY_CALS8       ES-ELDYPGQIKVNVIREVRAVEYAK-----------------
RNY_SYMTH       EE-ELEYPGQIRVVVVRETRAVEYAR-----------------
RNY_SYNWW       EQ-DLDYPGQIKVVVIRETRSVEYAK-----------------
RNY_FINM2       ES-ELEYPGQIKVNVIRENRVSDYAK-----------------
RNY_FUSNN       ED-TMQYPGQIKVTILRETRAVEYAK-----------------
RNY_ROSCS       EE-SLQYPGQIKVTVIRETRAVDYAR-----------------
RNY_ROSS1       EE-SLQYPGQIKVTVIRETRAVDYAR-----------------
RNY_CHLAA       EE-SLQYPGQIKVTIIRETRAVDYAR-----------------
RNY_DEHMB       ED-GLEYPGQIKVTVIRETRSVDFAK-----------------
RNY_DEHMC       ED-GLEYPGQIKVTVIRETRSVDFAK-----------------
RNY_DEHM1       ED-GLEYPGQIKVTVIRETRSVDFAK-----------------
RNY_DEIRA       EQ-DMEYPGQVQVTVVRESRAVGVAR-----------------
RNY_DEIGD       EQ-DMEYPGQVQVTVVRESRAVEVAR-----------------
RNY_THET2       EK-EMNYPGQVQVTVVRETRAVEYAR-----------------
RNY_THET8       EK-EMNYPGQVQVTVVRETRAVEYAR-----------------
RNY_SALAI       EE-ELTYPGQIRVTVVRESRVTEIAR-----------------
RNY_SALTO       EE-ELTYPGQIRVTVVRESRVTEIAR-----------------
RNY_ACIC1       ET-ELTYPGQIRVTVVRETRASEFAH-----------------
RNY_FRASN       ED-ELTYPGQIRVTVVRETRAVGMAR-----------------
RNY_THEFY       EE-ELTYPGQVRVTVIRESRAVETAR-----------------
RNY_CUTAK       GE-QVTVPGRTRVTVIRSFQAIETVGDA---------------
RNY_RHOBA       EK-ELTYPGEIKVTVVREARFTNTAK-----------------
RNY_OPITP       EA-ELQYPSTIKITVIREQRFTETAT-----------------
RNY_RUBXD       ED-ELEYPGQIKVTVIRESRVSEVAR-----------------
RNY_PARUW       EQ-ELSYPGKIKVTVIREKRVVEYAV-----------------
RNY_STAA2       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAA1       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAAE       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAAT       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAA8       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAAB       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAAC       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAAR       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAAS       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAAM       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAAW       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAAN       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAA3       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAA9       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAES       EE-ELQYPGHIKVTVVRETRAIEYAK-----------------
RNY_STAEQ       EE-ELQYPGHIKVTVVRETRAIEYAK-----------------
RNY_STAHJ       ED-ELQYPGHIKVTVVRETRAVEYAK-----------------
RNY_STAS1       ED-ELQYPGHIKVTVVRETRAIEYAK-----------------
RNY_BACHD       EE-ELDYPGHIRVTVIRETRAVEYAK-----------------
RNY_BACSK       EQ-ELDYPGHIRVTVIRETRAVEYAK-----------------
RNY_EXIS2       EE-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACSU       ED-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACVZ       ED-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACLD       ED-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACP2       ED-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACAN       EN-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACAH       EN-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACHK       EN-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACCZ       EN-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACC1       EN-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACCR       EN-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACMK       EN-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_BACCN       EN-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_GEOKA       EE-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_GEOTN       EE-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_LYSSC       EE-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_OCEIH       EG-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_LISIN       EE-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_LISMO       EE-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_LISMF       EE-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_LISW6       EE-ELDYPGHIKVTVIRETRAVEYAK-----------------
RNY_LACPL       EN-ELEYPGHIKVTVIREVRAVDYAK-----------------
RNY1_LACBA      EG-DLDYPGHVKVSVIREVRSVEYAK-----------------
RNY1_PEDPA      EK-ELEYAGKVKVTVVREVRAVDYAK-----------------
RNY_LACP3       EK-ELEYPGHIKVTVIRETRTVEYAK-----------------
RNY_LACSS       ED-QLEYPGHIKVTVIRETRTVEYAK-----------------
RNY_ENTFA       ED-DLDYPGHIKVTVIRETRAVDYAK-----------------
RNY_LACS1       ED-ELEYPGHIKVTVIRETRAVEYAK-----------------
RNY_LEUCK       EE-KLEYPGHVKITVVRETRATDYAH-----------------
RNY_LEUMM       EE-KLEYPGHIKVTVIRETRAIDYAH-----------------
RNY_LACLM       ED-EMDYPGNIKVTVIRETRAIDYAK-----------------
RNY_LACLS       ED-EMDYPGNIKVTVIRETRAIDYAK-----------------
RNY_LACLA       ED-EMDYPGNIKITVIRETRAIDYAK-----------------
RNY_STRA3       EQ-NLDYPGNIKVTVIREMRAVDFAK-----------------
RNY_STRA1       EQ-NLDYPGNIKVTVIREMRAVDFAK-----------------
RNY_STRA5       EQ-NLDYPGNIKVTVIREMRAVDFAK-----------------
RNY_STRPM       EN-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRPF       EN-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRPG       EN-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRPB       EN-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRPC       EN-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRP3       EN-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRP6       EN-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRP1       EN-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRP8       EH-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRPD       EH-NLDYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRMU       EN-NLDYPGNIKVTVIRELRAIDYAK-----------------
RNY_STRT2       EK-NLDYPGNIKVTVIREFRAVDYAK-----------------
RNY_STRT1       EK-NLDYPGNIKVTVIREFRAVDYAK-----------------
RNY_STRTD       EK-NLDYPGNIKVTVIREFRAVDYAK-----------------
RNY_STRPN       EN-NLDYPGNIKVTVIRELRAVDYAK-----------------
RNY_STRR6       EN-NLDYPGNIKVTVIRELRAVDYAK-----------------
RNY_STRPI       EN-NLDYPGNIKVTVIRELRAVDYAK-----------------
RNY_STRP2       EN-NLDYPGNIKVTVIRELRAVDYAK-----------------
RNY_STRGC       EN-NLEYPGNIKVTVIRELRAVDYAK-----------------
RNY_STRSV       EN-NLEYPGNIKVTVIREMRAVDYAK-----------------
RNY_STRSY       EN-NLDYPGNIKITVIRETRATDVAK-----------------
RNY_STRS2       EN-NLDYPGNIKITVIRETRATDVAK-----------------
RNY_LACAC       EK-ELDYPGNIKITVIREKRVVAIAK-----------------
RNY_LACH4       EK-ELDYPGNIKITVIREKRVVAIAK-----------------
RNY_LACDA       EK-ELDYPGNIKITVIREKRAVAVAK-----------------
RNY_LACDB       EK-ELDYPGNIKITVIREKRAVAVAK-----------------
RNY_LACGA       EQ-DMEYPGNIKVTVIREKRAVAIAK-----------------
RNY_LACJO       EQ-DMEYPGNIKVTVIREKRAVAIAK-----------------
RNY_AYWBP       EK-EIIYNGVIKVTVLRETRAVEMAKL----------------
RNY_ONYPE       EK-DISYNGVIKVTVIRETRAVEMAKL----------------
RNY_ACHLI       EA-QMTYPGTIKVTVIREKRATDVAK-----------------
RNY_MAGMM       ES-EMTYPGEIKVTVIREMRASEIAR-----------------
RNY_THEMA       EE-ELEYPGVLKVVVIREKRSVAYAK-----------------
RNY_THESQ       EE-ELEYPGVLKVVVIREKRSVAYAK-----------------
RNY_THEP1       EE-ELEYPGVLKVVVIREKRSVAYAK-----------------
RNY_PSELT       EE-EVEYPGVLKVVVIREKRSIAYAK-----------------
RNY_FERNB       EN-ELQYPGVLKVVVIREKRSVSYAK-----------------
RNY_THEM4       EE-ELQYPGVLKVVVIREKRSVAYAK-----------------
RNY_PETMO       EE-KVQYPGVIKVTVIREKRSISYAS-----------------
RNY_AQUAE       EE-ELDFPGQIKVVVIRETRHVEYAK-----------------
RNY_BACFR       QD-EMTYPGQVKITVIRETRAVSFAK-----------------
RNY_BACFN       QD-EMTYPGQVKITVIRETRAVSFAK-----------------
RNY_BACTN       QD-EMTYPGQVKITVIRETRAVSFAK-----------------
RNY_BACV8       QD-EMTYPGQVKITVIRETRAVSFAK-----------------
RNY_PARD8       QD-EMTYPGQVKITVIRETRAVSYAK-----------------
RNY_PORGI       QD-EMTYPGQVKITVIRESRSVSYAK-----------------
RNY_CYTH3       EK-EMQYPGQIKVTVIREMRAVNFAK-----------------
RNY_FLAJ1       QT-EMTYPGQVKVTVIRETRAVNIAK-----------------
RNY_FLAPJ       QT-EMTYPGQVKVTVIRETRAVNIAK-----------------
RNY_GRAFK       QT-DMTYPGQVKITVIRETRAVNVAK-----------------
RNY_PELLD       ES-EAQYPGQIKVSIVRERRSVAYAK-----------------
RNY_CHLPM       ES-EAQYPGQIKVSIVREKRSVAYAK-----------------
RNY_CHLPD       ES-EVQYPGQIKVSIIRERRSIAYAK-----------------
RNY_CHLCH       ES-EAQYPGQIKVSIIREKRSVAYAK-----------------
RNY_CHLTE       ES-EAQYPGQIKVTILREKRSVAFAK-----------------
RNY1_BDEBA      ER-EMPQAGQVKVTVVRETRSVEHAR-----------------
RNY2_BDEBA      EE-ECNYPGSIKVVVVRETVVTEQTRKELA-------------
RNY2_LACBA      ES-TLTYPGKIKVTTIRKSTAVEYVGDEKKKKSKKKKKKAANA
RNY2_PEDPA      EE-DVTYPGQVKVTVVRKLEIVEYVE----------KKQA---
RNY_MYCGE       AKNPITNHFPIKVVIRYNFEHSFNTKS----------------
RNY_MYCPN       VQNNITNRFPIKVVLRYNFEHSFDTKDKN--------------