CLUSTAL format seed alignment for MF_00336

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BIOD1_ECOLI      --------------------------------------MSKRYFVTGTDTEVGKTVASCA
BIOD1_ECO57      --------------------------------------MSKRYFVTGTDTEVGKTVASCA
BIOD_PSEVU       --------------------------------------MTERYFVTGTDTEVGKTVASCA
BIOD1_SALTI      --------------------------------------MTKRYFVTGTDTEVGKTVASCA
BIOD1_SALTY      --------------------------------------MTKRYFVTGTDTEVGKTVASCA
BIOD_SERMA       --------------------------------------MSKRWFVTGTDTEVGKSVASSA
BIOD1_YERPE      --------------------------------------MTKRWFITGTDTDVGKTVASCA
BIOD_YERPG       --------------------------------------MTKRWFITGTDTDVGKTVASCA
BIOD_BAUCH       --------------------------------------MTKRYFITGTDTNVGKTLAACA
BIOD_ALIF1       --------------------------------------MIDAFFIAGTDTDVGKTVASKA
BIOD_ALIFM       --------------------------------------MIDAFFIAGTDTDVGKTVASKA
BIOD_ALISL       --------------------------------------MIDAFFIAGTDTDVGKTVASKA
BIOD_VIBCB       --------------------------------------MIDAFFIAGTDTDVGKTVASKA
BIOD_VIBPA       --------------------------------------MIDAFFIAGTDTDVGKTVASKA
BIOD_VIBVU       --------------------------------------MMKAFFIAGTDTDVGKTVASKA
BIOD_VIBVY       --------------------------------------MMKAFFIAGTDTDVGKTVASKA
BIOD_VIBCH       --------------------------------------MRNAIFIAGTDTDVGKTVASKA
BIOD_PHOPR       --------------------------------------MTNAFFLTGTDTEVGKTVASRA
BIOD2_ECOLI      --------------------------------------MLKRFFITGTDTSVGKTVVSRA
BIOD2_ECO57      --------------------------------------MLKRFFITGTDTSVGKTVVSRA
BIOD2_SALTI      --------------------------------------MLKRFFITGTDTSVGKTVVSRA
BIOD2_SALTY      --------------------------------------MLKRFFITGTDTSVGKTVVSRA
BIOD2_YERPE      --------------------------------------MLTRLFVTGTDTAVGKTVVSRA
BIOD_YERPS       --------------------------------------MLTRLFVTGTDTAVGKTVVSRA
BIOD_AERHH       --------------------------------------MVKSFFVTGTDTDVGKTLVART
BIOD_AERS4       --------------------------------------MVKSFFITGTDTDVGKTLVART
BIOD_TOLAT       --------------------------------------MSKTFFVTGTDTDAGKTTCTLA
BIOD_ALTMD       ---------------------------------------MKQYFVTGTDTEVGKTYVTCQ
BIOD_PSEHT       ---------------------------------------MKEFFITGTDTDAGKTHVTSL
BIOD_IDILO       ---------------------------------------MNTYFIAGTDTDAGKTVAACA
BIOD_BURCM       ------------------------------------MTAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURA4       ------------------------------------MTAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURVG       ------------------------------------MSTALSVFVTGTDTEIGKTFVSAA
BIOD_BURCA       ------------------------------------MTAPLSVFVTGTDTEIGKTFVSAA
BIOD_BURCH       ------------------------------------MTAPLSVFVTGTDTEIGKTFVSAA
BIOD_BURCC       ------------------------------------MSAPLSVFVTGTDTEIGKTFVSAA
BIOD_BURCJ       ------------------------------------MTAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURM1       ------------------------------------MSTPLSLFVTGTDTEIGKTFVSAA
BIOD_BURL3       ------------------------------------MTAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURMA       ------------------------------------MSAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURM9       ------------------------------------MSAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURM7       ------------------------------------MSAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURMS       ------------------------------------MSAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURPS       ------------------------------------MSAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURP0       ------------------------------------MSAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURP1       ------------------------------------MSAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURP6       ------------------------------------MSAPLSLFVTGTDTEIGKTFVSAA
BIOD_BURTA       ------------------------------------MSAPLSLFVTGTDTEIGKTFVSTA
BIOD_PARP8       ------------------------------------MSPALSLFVTGTDTEIGKTLVSAA
BIOD_AROAE       ------------------------------------MTEPRAWFLAGTDTEIGKTFVACA
BIOD_RALPJ       ------------------------------------MPARFDCFVTGTDTEIGKTLVSAV
BIOD_RALSO       ------------------------------------MPVRFDCFVTGTDTEIGKTLASAA
BIOD_JANMA       ------------------------------------MTATFNCFVTGTDTEIGKTMISTA
BIOD_XANAC       -------------------------------------MQHPAFYVTGTDTGIGKTMGSTA
BIOD_XANC5       -------------------------------------MQHPAFYVTGTDTGIGKTMGSTA
BIOD_XANOM       -------------------------------------MQPPAFYVTGTDTGIGKTMGSTA
BIOD_XANOP       -------------------------------------MQPPAFYVTGTDTGIGKTMGSTA
BIOD_XANCP       -------------------------------------MQFPAFYVTGTDTGIGKTVASTA
BIOD_XANCB       -------------------------------------MQFPAFYVTGTDTGIGKTVASTA
BIOD_XANC8       -------------------------------------MQFPAFYVTGTDTGIGKTVASTA
BIOD_XYLFM       -------------------------------------MSLSAFYVTGTDTGIGKTFVSCI
BIOD_XYLFT       -------------------------------------MSLSDFYVTGTDTGIGKTFVSCI
BIOD_XYLFA       -------------------------------------MSLSAFYVTGTDTGIGKTFVSCI
BIOD_NITMU       ------------------------------------MGMGKGYFVTGTDTGVGKTRVTCA
BIOD_PSEAE       ---------------------------------------MPAFFVTGTDTEIGKTTIAAG
BIOD_PSEA8       ---------------------------------------MPAFFVTGTDTEIGKTTIAAG
BIOD_PSEAB       ---------------------------------------MPAFFVTGTDTEIGKTTIAAG
BIOD_PSEA7       ---------------------------------------MPAFFVTGTDTEIGKTTIAAG
BIOD_CELJU       -------------------------------------MSKKAFFITGTDTDAGKTLVATG
BIOD_CHRSD       ---------------------------------------MTTYFVTGTDTDAGKTLVASG
BIOD_MARHV       -------------------------------------MAKHTFFVTGTDTGVGKTIVSAA
BIOD_MANSM       ---------------------------------------MSVFFVTGTDTSVGKTIVSRA
BIOD1_PASMU      ---------------------------------------MSSFFLTGTDTNVGKTVASRA
BIOD1_HAEIN      ---------------------------------------MSSFFVAGTDTNVGKTTAARA
BIOD_ACTSZ       ---------------------------------------MRTFFVTGTDTGVGKTICSRA
BIOD1_HAEDU      MFSDKTRNLSRKFDQEHHYTLKKVLKYKQFCNYFVKRKKIPSLFITGTDTNVGKTIVTRA
BIOD_BUCAI       --------------------------------------MIKKFFITGTDTNVGKTIVSSI
BIOD_BUCA5       --------------------------------------MIKKFFITGTDTNVGKTIVSSI
BIOD_BUCBP       --------------------------------------MKNCWFITGTDTNIGKTVSSII
BIOD_WIGBR       --------------------------------------MINRYFITGTDTNIGKTISVCA
BIOD_FRATF       ---------------------------------------MKKFFIIGTNTEVGKTYISTK
BIOD_FRATH       ---------------------------------------MKKFFIIGTNTEVGKTYISTK
BIOD_FRATO       ---------------------------------------MKKFFIIGTNTEVGKTYISTK
BIOD_FRATM       ---------------------------------------MKKFFIIGTDTEVGKTYISTK
BIOD_FRATT       ---------------------------------------MKKFFIIGTDTEVGKTYISTK
BIOD_FRAT1       ---------------------------------------MKKFFIIGTDTEVGKTYISTK
BIOD_FRATW       ---------------------------------------MKKFFIIGTDTEVGKTYISTK
BIOD_FRATN       ---------------------------------------MKKFFIIGTDTEVGKTYISTK
BIOD_FRAP2       ---------------------------------------MKKIFIIGTDTEVGKTYISTK
BIOD_LEGPC       ---------------------------------------MKRYFVTGTDTDCGKTFVTNQ
BIOD_LEGPA       ---------------------------------------MKRYFVTGTDTDCGKTFVTNQ
BIOD_LEGPL       ---------------------------------------MKRYFVTGTDTDCGKTFVTNQ
BIOD_LEGPH       ---------------------------------------MKRYFVTGTDTDCGKTFVTNQ
BIOD_BRUAB       --------------------------------------MNSRLIVTGTDTGIGKTVFSAA
BIOD_BRUA2       --------------------------------------MNSRLIVTGTDTGIGKTVFSAA
BIOD_BRUA1       --------------------------------------MNSRLIVTGTDTGIGKTVFSAA
BIOD_BRUME       --------------------------------------MNSRLIVTGTDTGIGKTVFSAA
BIOD_BRUMB       --------------------------------------MNSRLIVTGTDTGIGKTVFSAA
BIOD_BRUC2       --------------------------------------MNSRLIVTGTDTGIGKTVFSAA
BIOD_BRUO2       --------------------------------------MNSRLIVTGTDTGIGKTVFSAA
BIOD_BRUSU       --------------------------------------MNSRLIVTGTDTGIGKTVFSAA
BIOD_BRUSI       --------------------------------------MNSRLIVTGTDTGIGKTVFSAA
BIOD_AGRFC       --------------------------------------MSLRFVISGTDTGIGKTVFAAA
BIOD_OCHA4       --------------------------------------MNRTFIITGTDTGIGKTVFSAA
BIOD_BRADU       --------------------------------------MNKRIVVTGTDTGVGKTVFSAG
BIOD_BRASB       --------------------------------------MAQRIVVTGTDTGIGKTVFAAA
BIOD_NITHX       --------------------------------------MSTRIVVTGTDTGIGKTVFSAA
BIOD_NITWN       --------------------------------------MSARIVVSGTDTGVGKTVFSAA
BIOD_RHOPS       --------------------------------------MTTPIIVTGTDTGVGKTVFSAA
BIOD_RHOP2       --------------------------------------MTKPIVVTGTDTGIGKTVFAAA
BIOD_RHOP5       --------------------------------------MSPRVVVTGTDTGIGKTVFSAA
BIOD_RHOPA       --------------------------------------MSARIVVTGTDTGIGKTVFAAA
BIOD_RHOPT       --------------------------------------MSARIVVTGTDTGIGKTVFAAA
BIOD_OLICO       --------------------------------------MSTRLVVSGTDTDVGKTVFSAA
BIOD_RHOPB       --------------------------------------MTPRIVVTGTDTDIGKTVFSAG
BIOD_SPHWW       --------------------------------------MTRAIVVTATDTDVGKTVFSAG
BIOD_NOVAD       ---------------------------------------MTAFVVTGTDTGVGKTIFSAA
BIOD_SPHAL       ---------------------------------------MTRFVVTGTDTGIGKTIFSAS
BIOD_MAGSA       ---------------------------------------MRGVFVTGTDTDVGKTMVSAW
BIOD_CHLAB       ----------------------------------------MHIIIAGIDTDVGKTFVSAI
BIOD_CHLFF       ----------------------------------------MHIIIAGIDTEVGKTFVSAI
BIOD_CHLPN       ---------------------------------------MQRIIIVGIDTGVGKTIVSAI
BIOD_CYTH3       ---------------------------------------MKKYFITAISTDSGKTLVSAI
BIOD_GRAFK       --------------------------------------MPKSYFITGIGTEVGKTVVSAI
BIOD_CAMJE       ----------------------------------------MQIYVSGIHTDVGKTHFSAA
BIOD_CAMJR       ----------------------------------------MQIYVSGIHTDVGKTHFSAA
BIOD_CAMJJ       ----------------------------------------MQIYVSGIHTDVGKTHFSAA
BIOD_CAMJ8       ----------------------------------------MQIYVSGIHTDVGKTHFSAA
BIOD_LAWIP       ----------------------------------------MQFFIIGTDTNVGKTIVSSW
BIOD_NEOSM       ----------------------------------------MAIFITGTDTNVGKTIISTW
BIOD_LEPBJ       ----------------------------------------MAVFIGATGTDIGKTLFSSL
BIOD_LEPBL       ----------------------------------------MAVFIGATGTDIGKTLFSSL
BIOD_LEPIN       ----------------------------------------MAVFIGGTGTDVGKTFFSSL
BIOD_LEPIC       ----------------------------------------MAVFIGGTGTDVGKTFFSSL
BIOD_RUTMC       ---------------------------------------MKGLFISGSGTNVGKTFVAQY
BIOD_VESOH       ---------------------------------------MKGLFISGSGTNVGKTFIAQY
BIOD_CALBD       ---------------------------------------MKAAYIVGTDTDVGKTFICAG
BIOD_CALS8       ---------------------------------------MKAVYIIGTDTDVGKTLICAG
BIOD_CLOB1       --------------------------------------MARGIFITATGTDIGKTYVTAL
BIOD_CLOBH       --------------------------------------MARGIFITATGTDIGKTYVTAL
BIOD_CLOBJ       --------------------------------------MARGIFITATGTDIGKTYVTAL
BIOD_CLOBK       --------------------------------------MARGIFITATGTDIGKTYVTAL
BIOD_CLOBL       --------------------------------------MARGIFITATGTDIGKTYVTAL
BIOD_CLOB6       --------------------------------------MVKGIFITATGTDIGKTYITAL
BIOD_CLOBM       --------------------------------------MARGVFITATGTDIGKTYVTAL
BIOD_CLOBA       --------------------------------------MAKGVFITATNTDIGKTYITAL
BIOD_CLOBB       --------------------------------------MAKGVFITATNTDIGKTYITAL
BIOD_CLOTE       --------------------------------------MSKGVFITATGTDVGKTYISAL
BIOD_CLOPE       --------------------------------------MEKGVYIIGTNTDIGKTFISGL
BIOD_CLOP1       --------------------------------------MEKGVYIIGTSTDIGKTFISGL
BIOD_BRAHW       --------------------------------------MAKAIFITATGTDIGKTYVSGL
BIOD_CLOK5       --------------------------------------MAKGIFIVGTDTDIGKTVVTAG
BIOD_CLOK1       --------------------------------------MAKGIFIVGTDTDIGKTVVTAG
BIOD_CLONN       --------------------------------------MSNGIFIVGTDTDIGKTFVTGG
BIOD_CLOAB       ---------------------------------------MRGIYLVGTDTEIGKTVISAA
BIOD_ANOFW       ---------------------------------------MKGFFITGTDTDVGKTFVTAC
BIOD_BACHD       ------------------------------------MVIIRSFFITGTDTDVGKTVVTSL
BIOD_LYSSH       ---------------------------------------MQHFWVVGTDTDVGKTFVTTL
BIOD_LYSSC       ---------------------------------------MQHFWVVGTDTDVGKTIVTTL
BIOD_FUSNN       -------------------------------------MKFKDFFVIGTDTDVGKTYVSTL
BIOD_GEOKA       --------------------------------------MGQAIFMTGTGTEIGKTVVTSI
BIOD_GEOSW       --------------------------------------MGKAIFITGTGTEIGKTVATSF
BIOD_STAES       ----------------------------------------MNIFVTGTNTDIGKTYVTKY
BIOD_STAEQ       ----------------------------------------MNIFVTGTNTDIGKTYVTKY
BIOD2_HAEIN      --------------------------------------MGKVIFISGIDTDVGKTIATGI
BIOD2_PASMU      --------------------------------------MAKVFFITGIDTDIGKTIATGW
BIOD2_HAEDU      --------------------------------------MGKIIFVSGIDTDIGKTIATGF
BIOD_NEIG1       --------------------------------------MKGVYFVSGIDTDIGKTVATGM
BIOD_NEIG2       --------------------------------------MKGVYFVSGIDTDIGKTVATGM
BIOD_NEIMF       --------------------------------------MKGVYFVSGIDTDIGKTVATGM
BIOD_NEIMB       --------------------------------------MKGVYFVSGIDTDIGKTVATGV
BIOD_NEIM0       --------------------------------------MKGVYFVSGIDTDIGKTVATGV
BIOD_NEIMA       --------------------------------------MKGVYFVSGIDTDIGKTIATGV
BIOD_CHLTE       -----------------------------MLFQKEKVMKGQVLAISGIDTGIGKTVVTGL
BIOD_HELPY       -----------------------------------------MLFISATNTNAGKTTCARL
BIOD_HELPJ       -----------------------------------------MLFISATNTNAGKTTCARL
BIOD_HELPS       -----------------------------------------MLFISATNTNAGKTTCARL
BIOD_WOLSU       ---------------------------------------MKPLFISATGTGVGKSYTTQK
BIOD_SULNB       ---------------------------------------MSSLFITATGTNVGKTHTTLK
BIOD_ANAD2       ---------------------------------------MRGLFVTGTDTGVGKTEVACA
BIOD_ANASK       ---------------------------------------MRGLFVTGTDTGVGKTEVSCA
BIOD_ANADE       ---------------------------------------MRGLFVTGTDTGVGKTEVACA
BIOD_ANADF       ---------------------------------------MRGLFITGTDTGVGKTEVTCA
BIOD_AKKM8       ---------------------------------------MRNFIVTGTDTEVGKTYVSCL
BIOD_BACVZ       ---------------------------------------MRSFFVTGTDTGVGKTIVSCG
BIOD_BACLD       ---------------------------------------MKGFFVTGTDTGVGKTFIACG
BIOD_BACSU       ---------------------------------------MRGFFVTGTDTEVGKTVISSG
BIOD_BACNA       ---------------------------------------MRGFFVTGTDTEVGKTVISSG
BIOD_BACAN       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACAA       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACAC       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACC0       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACHK       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACC3       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACAH       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACCZ       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACCR       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACC4       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_BACC2       ---------------------------------------MSGFFITATDTEVGKTVVAGA
BIOD_AQUAE       ----------------------------------------MRLLITGTDTGVGKTFITYN
BIOD_HYDS0       ----------------------------------------MILFVSATDTGVGKTYISTI
BIOD_METJA       -----------------------------------------MIFITGTDTGIGKTYVSSI
BIOD_META3       -----------------------------------------MIFITGTDTGVGKTFVSKI
BIOD_METVS       -----------------------------------------MIFVTGTDTGIGKTYVSAI
BIOD_UNCTG       --------------------------------------MYKGIFVTATDTEVGKTYVSCK
BIOD_THEYD       --------------------------------------MKAGYFITGTDTGVGKTIVTSA
BIOD_ACICJ       ---------------------------------------MSHFFITASGTEIGKTHVAAG
BIOD_METNO       ---------------------------------------MSTLFVAGAGTEIGKTYVTAA
BIOD_CAUVC       ---------------------------------------MKSLFVAGTGTDLGKTHVACA
BIOD_CAUVN       ---------------------------------------MKSLFVAGTGTDLGKTHVACA
BIOD_CAUSK       ---------------------------------------MPALFVTGTGTDIGKTHVSCA
BIOD_PHEZH       ---------------------------------------MSRYFVAGSHTDVGKTFVSCQ
BIOD_CORGL       ---------------------------------------MPFLFVSGTGTGVGKTFSTAV
BIOD_CORGB       ---------------------------------------MPFLFVSGTGTGVGKTFSTAV
BIOD_CORDI       ---------------------------------------MAIVVVTGTNTDVGKTIASAA
BIOD_COREF       ---------------------------------------MSILFISGTGTDVGKTIATAA
BIOD_CORK4       ---------------------------------------MSIVIMTGTGTDVGKTVATGA
BIOD_FRACC       ---------------------------------------MTALVVTGTGTGVGKTVVTAA
BIOD_FRASN       ---------------------------------------MSVLIVTGTGTEVGKTVVTAA
BIOD_STRAW       ---------------------------------------MSVLVITGTGTEVGKTVTTAA
BIOD_STRCO       ---------------------------------------MPVLVITGTGTEVGKTVVTAA
BIOD_SACEN       ---------------------------------------MSVLVITGTGTEVGKTVVTAA
BIOD_NOCFA       ---------------------------------------MNTLLVTGTSTDVGKTVVTAA
BIOD_RHOJR       ---------------------------------------MSILVVTGTSTDVGKTVVTAA
BIOD_RHOE4       ---------------------------------------MSIFLVTGTSTDVGKTVVTAA
BIOD_MYCBO       ---------------------------------------MTILVVTGTGTGVGKTVVCAA
BIOD_MYCTU       ---------------------------------------MTILVVTGTGTGVGKTVVCAA
BIOD_MYCTA       ---------------------------------------MTILVVTGTGTGVGKTVVCAA
BIOD_MYCBP       ---------------------------------------MTILVVTGTGTGVGKTVVCAA
BIOD_MYCBT       ---------------------------------------MTILVVTGTGTGVGKTVVCAA
BIOD_MYCMM       ---------------------------------------MTVLCVTGTCTGVGKTVVTAA
BIOD_MYCUA       ---------------------------------------MTVLCVTGTCTGVGKTVVTAA
BIOD_MYCLE       ---------------------------------------MTVVVVTGTDTGVGKTVACAA
BIOD_MYCLB       ---------------------------------------MTVVVVTGTDTGVGKTVACAA
BIOD_MYCA1       ---------------------------------------MTVLVVTGTDTGVGKTVATAA
BIOD_MYCGI       ---------------------------------------MSILVVTGTGTGIGKTVVTAA
BIOD_MYCVP       ---------------------------------------MSVLVVTGTGTGIGKTVATAA
BIOD_MYCSK       ---------------------------------------MSVLVITGTDTGVGKTVATAA
BIOD_MYCSS       ---------------------------------------MSVLVITGTDTGVGKTVATAA
BIOD_MYCSJ       ---------------------------------------MSVLVITGTDTGVGKTVATAA
BIOD_MYCS2       ---------------------------------------MTVLAVTGTDTGVGKTVTTAA
BIOD_MYCA9       ---------------------------------------MTILLVTGTSTGVGKTVATAA
BIOD_CROS5       ---------------------------------------MTTLFIVGTDTEVGKTVVTSA
BIOD_RIPO1       ---------------------------------------MNSLLITGTDTGAGKTIVTSA
BIOD_GLOC7       ---------------------------------------MAALLITATDTEVGKTVLTTS
BIOD_MICAN       ---------------------------------------MNSLLIAATDTDAGKTVVTTG
BIOD_CYAP4       ---------------------------------------MFTLLITGTDTDAGKTVLTTA
BIOD_SYNY3       ------------------------------MSNFSRAVDQKTLLVAGCDTGVGKTVTTSA
BIOD_GLOVI       ---------------------------------------MAGVLVSGTDTGAGKTILCAA
BIOD_NITMS       ---------------------------------------MKSIFVAGTDTDVGKTYITAG
BIOD_RHOBA       --------------------------------------MASLYFVTGTDTEVGKTYCTAK
                                                             : .  *  **:     

BIOD1_ECOLI      LLQAAK-AAGY-RTAGYKPVASGSEKTPE--------------GLRNSDALALQRNSSLQ
BIOD1_ECO57      LLQAAK-AAGY-RTAGYKPVASGSEKTPE--------------GLRNSDALALQRNSSLQ
BIOD_PSEVU       LLQAAA-QAGW-QTAGYKPVASGSEMTPE--------------GLRNSDALALQHNSTLA
BIOD1_SALTI      LLQAAT-QLGY-QTVGYKPVASGSEMTTD--------------GLRNSDALALQRNSSLP
BIOD1_SALTY      LLQAAT-QLGY-QTVGYKPVASGSEMTTD--------------GLRNSDALALQRNSSLP
BIOD_SERMA       LLQAAN-RAGY-PSAGYKPVASGSEMTAE--------------GLRNGDALALQANSGVA
BIOD1_YERPE      LLQAAT-AQGY-RTAGYKPVASGSQMTAD--------------GLRNSDALALQANSSQR
BIOD_YERPG       LLQAAT-AQGY-RTAGYKPVASGSQMTAD--------------GLRNSDALALQANSSQR
BIOD_BAUCH       LLQAAI-SIGY-HAAGYKPVATGYQLTLD--------------GPRNNDALALLSNSNVI
BIOD_ALIF1       ILDALN-MKGL-RTAAYKPVAAGSEDKGE--------------GVQNSDAIHLRAVANVE
BIOD_ALIFM       ILDALN-MKGL-RTAAYKPVAAGSEDKGE--------------GVQNSDAIHLRAVANVE
BIOD_ALISL       ILDALN-MKGL-RTAAYKPIAAGSEDKGD--------------GVQNSDAIHLRSVANVE
BIOD_VIBCB       ILQALG-AKGL-NTIGYKPVAAGSDKTAE--------------GWRNSDALHLQKAATLD
BIOD_VIBPA       VLQALA-AKGL-NTIGYKPVAAGSEKTEQ--------------GWRNSDALHLQKAATLE
BIOD_VIBVU       ILHALA-AKDL-RTIGYKPVAAGSDKTPE--------------GWRNSDALHLQKAATVA
BIOD_VIBVY       ILHALA-AKDL-RTIGYKPVAAGSDKTPE--------------GWRNSDALHLQKAATVA
BIOD_VIBCH       ILQALA-THNI-ATIGYKPVAAGSDKTEF--------------GYRNSDALHLMKAATVD
BIOD_PHOPR       ILHAAA-SANI-KMAGYKPVASDSTPTDE--------------GMRNSDALYIQDASVVE
BIOD2_ECOLI      LLQALA-SQGK-TVAGYKPVAKGSKETPE--------------GLRNKDALVLQSVSTIE
BIOD2_ECO57      LLQALA-SQGK-TVAGYKPVAKGSKETPE--------------GLRNKDALVLQSVSTIE
BIOD2_SALTI      LLQALS-SGGK-SVAGYKPVAKGSKETPE--------------GMRNKDALVLQSVSSLE
BIOD2_SALTY      LLQALA-SSGK-SVAGYKPVAKGSKETAE--------------GMRNKDALVLQSVSSLE
BIOD2_YERPE      LLQALS-QNGR-TAVGYKPVATESKETSE--------------GLRNQDALILQASSSIE
BIOD_YERPS       LLQALS-QNGR-TAVGYKPVATESKETSE--------------GLRNQDALILQASSSIE
BIOD_AERHH       LLLEFA-AHGL-RCAGYKPISAGCARTPD--------------GLRNLDAVLLQEAASLP
BIOD_AERS4       LLLEFV-AHGI-QCAGYKPISAGCARTPD--------------GLRNLDAVLLQEAANLS
BIOD_TOLAT       LLQAAA-AKGL-KAVAYKPVAAGCEMIEN--------------KPCNQDVLLLQKHSALP
BIOD_ALTMD       LLRAAN-NASL-TAIGYKPIAAGCELVNG--------------EWVNEDALNIQQASACA
BIOD_PSEHT       LLKLLA-QHKK-QAIGFKPLASGCEMAFD--------------QLVNADALILMESATVS
BIOD_IDILO       FVQYLV-KQSQ-QVAVMKPVASGCHWQNG--------------QLVNEDALNLMRQSNTS
BIOD_BURCM       MLHGFA-RHGL-RAAALKPVAAGAYERDG--------------VWRNEDADQLDAAANVV
BIOD_BURA4       MLHGFA-RHGL-RAAALKPVAAGAYERDG--------------VWRNEDADQLDAAANVV
BIOD_BURVG       MLHGFA-RHGL-RAAALKPVAAGAYERDG--------------IWRNEDADQLDAAANVA
BIOD_BURCA       MLHGFA-RHGL-RAAALKPVAAGAYERDG--------------VWRNEDADQLDAAANVA
BIOD_BURCH       MLHGFA-RHGL-RAAALKPVAAGAYERDG--------------VWRNEDADQLDAAANVA
BIOD_BURCC       MLHGFA-RHGL-RAAALKPIAAGAYERDG--------------VWRNEDADQLDAAANVA
BIOD_BURCJ       MLHGFA-RHGL-RAAALKPVAAGAYQRDG--------------VWRNEDADQLDAAANVV
BIOD_BURM1       LLHGFA-RHGL-RAAAMKPVAAGAYERDG--------------VWRNEDADQLDAAASVV
BIOD_BURL3       LLHGFA-RHGL-RAAALKPVAAGAYERDG--------------VWRNEDADQLDAAANVV
BIOD_BURMA       LLHGFA-RAGL-RAAAMKPVAAGAYERDG--------------AWRNEDADQLDAAANVA
BIOD_BURM9       LLHGFA-RAGL-RAAAMKPVAAGAYERDG--------------AWRNEDADQLDAAANVA
BIOD_BURM7       LLHGFA-RAGL-RAAAMKPVAAGAYERDG--------------AWRNEDADQLDAAANVA
BIOD_BURMS       LLHGFA-RAGL-RAAAMKPVAAGAYERDG--------------AWRNEDADQLDAAANVA
BIOD_BURPS       LLHGFA-RAGL-RAAAMKPVAAGAYERDG--------------AWRNEDADQLDAAANVA
BIOD_BURP0       LLHGFA-RAGL-RAAAMKPVAAGAYERDG--------------AWRNEDADQLDAAANVA
BIOD_BURP1       LLHGFA-RAGL-RAAAMKPVAAGAYERDG--------------AWRNEDADQLDAAANVA
BIOD_BURP6       LLHGFA-RAGL-RAAAMKPVAAGAYERDG--------------AWRNEDADQLDAAANVA
BIOD_BURTA       LLHGFA-RAGL-RAAAMKPIAAGAYQRDG--------------VWRNEDADQLDAAANVA
BIOD_PARP8       LLRGFV-RDGL-RAAAMKPIAAGATLVNG--------------VLHNEDADQLDAAANVL
BIOD_AROAE       LLHAAR-RDGR-SALGMKPVAAGAEWIAG--------------EWLNEDAAQLRAASSFD
BIOD_RALPJ       LLTRLA-DAGY-RAAGLKPIAAGTLAGAP--------------TRTNEDVEQLRAAASVN
BIOD_RALSO       LLTALA-GAGY-RTAGLKPVAAGTLAGAP--------------ERTNEDIEQLRAAATVG
BIOD_JANMA       LLHALV-QQGV-KAAAIKSVAAGATAIQTNEGE----------VWHNDDADALAQAANVV
BIOD_XANAC       LLHALR-ARGH-RAVGMKPVASGCEHTPH--------------GWRNEDALALQAASDPQ
BIOD_XANC5       LLHALR-ARGH-RAVGMKPVASGCEHTPQ--------------GWRNEDALALQAASDPQ
BIOD_XANOM       LLHALR-ARGH-TAVGMKPVASGCERTPQ--------------GWRNEDALALQAASNPQ
BIOD_XANOP       LLHALR-ARGH-TAVGMKPVASGCERTPQ--------------GWRNEDALALQAASNPQ
BIOD_XANCP       LLHAVR-ARGH-TAVGMKPVASGCVATPQ--------------GWHNEDALALQAASQPQ
BIOD_XANCB       LLHAVR-ARGH-TAVGMKPVASGCVATPQ--------------GWHNEDALALQAASQPQ
BIOD_XANC8       LLHAVR-ARGH-TAVGMKPVASGCVATPQ--------------GWHNEDALALQAASQPQ
BIOD_XYLFM       LLHMLR-GRGQ-RAVGMKPVASGCTYSDT--------------GWRNEDALALQAASDPT
BIOD_XYLFT       LLHMLR-GRGQ-RAVGMKPVASGCTYSDT--------------GWRNEDALALQAASDPT
BIOD_XYLFA       LLHMLR-GRGQ-RAVGMKPVASGCTYSDT--------------GWRNEDALALQAASDPT
BIOD_NITMU       LLHAFA-ATGK-TVVGMKPVAAGCENGMW------------------PDVELLAAASNIS
BIOD_PSEAE       LLHAAR-SAGL-STAAAKPVASGCEPTAQ--------------GLRNGDALVLLGQCSLA
BIOD_PSEA8       LLHAAR-SAGL-STAAAKPVASGCEPTAQ--------------GLRNGDALVLLGQCSLA
BIOD_PSEAB       LLHAAR-RAGL-STAAAKPVASGCEPTAQ--------------GLRNGDALALLGQCSLA
BIOD_PSEA7       LLHAAR-SAGL-STAAAKPVASGCEATAQ--------------GLRNGDALALLGECSLA
BIOD_CELJU       LLAAAR-LRGL-STLGLKPVAAGCTRTEQ--------------GLRNSDALALQAQSTLP
BIOD_CHRSD       LLALAR-RRGL-TTLGLKPVASGCESTTE--------------GLRNIDALTLQAQSMPT
BIOD_MARHV       ILEAAK-AAGK-RTLAMKPIASGCDQTPE--------------GLRNEDALMLQAAITEK
BIOD_MANSM       IIQAMQ-NAGI-QIVGYKPLACGQDDPVYTDVQ--ESGQTDYDNMDNRDVLVLQDSTNEE
BIOD1_PASMU      IIQALQ-NQGI-QIVGYKPVAFSREECVYTDMENQQAAESDYDSQNNSDVLTLMKSTHEK
BIOD1_HAEIN      MIQALQ-GQGV-QVVGYKPIACCGEESIYPVAQ--SENTSDYDHFVNADVLTLMHSTKEN
BIOD_ACTSZ       IIQALQ-EMDT-QIVGFKPIASGQDEPVYADSL--DDPKNDYGDEDNRDVLILQNSTKEN
BIOD1_HAEDU      ILQVLA-QHNF-SVVGYKPIACGGDDDLPTEPN-----QTDYTSEDNSDVLIILDSCPQP
BIOD_BUCAI       LLKKAT-MSGY-QTAGYKPVSSGG--------------QKKSSGFFNQDAILLKKSSSII
BIOD_BUCA5       LLKKAT-MSGY-QTAGYKPVSSGG--------------QKKSSGFFNQDAILLKKSSSII
BIOD_BUCBP       LLELAR-RYGY-NTSGYKPIAAGC--------------RTNDFKQYNSDAVLLRKFSTVK
BIOD_WIGBR       LLQYLN-KLGN-KSVGCKLISSGC--------------KKIKNKIFNEDVVNIMKYNNIK
BIOD_FRATF       LIEVCE-HQNI-KSLCLKPVASGQSQFSE----------------LCEDVESILNAYKHK
BIOD_FRATH       LIEVCE-HQNI-KSLCLKPVASGQSQFSE----------------LCEDVESILNAYKHK
BIOD_FRATO       LIEVCE-HQNI-KSLCLKPVASGQSQFSE----------------LCEDVESILNAYKHK
BIOD_FRATM       LIEVCE-HQNI-KSLCLKPVASGQSQFSE----------------LCEDVESILNAYKHK
BIOD_FRATT       LIEVCE-HQNI-KSLCLKPVASGQSQFSE----------------LCEDVESILNAYKHK
BIOD_FRAT1       LIEVCE-HQNI-KSLCLKPVASGQSQFSE----------------LCEDVESILNAYKHK
BIOD_FRATW       LIEVCE-HQNI-KSLCLKPVASGQSQFSE----------------LCEDVESILNAYKHK
BIOD_FRATN       LIEVCE-HQNI-KSLCLKPVASGQSQFSE----------------LCEDVESILNAYKHK
BIOD_FRAP2       LIEACE-HENI-KSLCLKPVASGQSQFSE----------------LCEDVENILNAYKNK
BIOD_LEGPC       LVNYFS-S-----SAAIKPIASGCEYSKN----------------QLVNSDALLHQQQNH
BIOD_LEGPA       LVNYFS-N-----SAAIKPIASGCEYSEN----------------QLVNSDALLHQQQNH
BIOD_LEGPL       LVNYFS-S-----SAAIKPIASGCEYSEN----------------QLVNSDALLHQQQNH
BIOD_LEGPH       LVNYFS-D-----SAAIKPIASGCEYSEN----------------QLVNSDALLHQQQNH
BIOD_BRUAB       LCH------AL-GAVYWKPVQSGLEE-----------------ETDSEIVARLAQASPQR
BIOD_BRUA2       LCH------AL-GAVYWKPVQSGLEE-----------------ETDSEIVARLAQASPQR
BIOD_BRUA1       LCH------AL-GAVYWKPVQSGLEE-----------------ETDSEIVARLAQASPQR
BIOD_BRUME       LCH------AL-GAVYWKPVQSGLEE-----------------ETDSEIVARLAQASPQR
BIOD_BRUMB       LCH------AL-GAVYWKPVQSGLEE-----------------ETDSEIVARLAQASPQR
BIOD_BRUC2       LCH------AL-GAAYWKPVQSGLEE-----------------ETDSEIVARLAQASPQR
BIOD_BRUO2       LCH------AL-GAAYWKPVQSGLEE-----------------ETDSEIVARLAQASPQR
BIOD_BRUSU       LCH------AL-GAAYWKPVQSGLEE-----------------ETDSEIVARLAQASPQR
BIOD_BRUSI       LCH------AL-GAAYWKPVQSGLEE-----------------ETDSEIVARLAQASPQR
BIOD_AGRFC       LTH------AL-EAHYWKPVQSGLEE-----------------ETDSQTVARLAGASHAR
BIOD_OCHA4       LAG------AL-NAYYWKPVQSGLEE-----------------ATDSETVVQLAGLSRRN
BIOD_BRADU       LAG------LL-GANYWKPVQAGLEQ-----------------EIDSECIRRLGGLSSDR
BIOD_BRASB       LTD------LL-GACYWKPVQAGLAE-----------------ETDSHRVQRLADLADDR
BIOD_NITHX       LAG------AL-DGFYWKPIQAGLDD-----------------ETDTQTVLRLSGLAAER
BIOD_NITWN       LAG------AL-DGYYWKPVQSGLDE-----------------ETDSQTVMRLSGLGAER
BIOD_RHOPS       LAG------AL-EATYWKPVQAGLDE-----------------ETDRLAVLRLSGLPETR
BIOD_RHOP2       LAG------AL-DAFYWKPVQAGIED-----------------ETDRQAVLRLSGLPDAR
BIOD_RHOP5       LVG------AL-DGVYWKPVQAGLDE-----------------ETDRDTVLRLSGLPAER
BIOD_RHOPA       LAG------AL-DATYWKPVQSGLED-----------------ETDSGAVQRLSGLAADR
BIOD_RHOPT       LAG------AL-DATYWKPVQSGLED-----------------ETDSGAVQRLSGLAADR
BIOD_OLICO       LAG------AL-DADYWKPVQAGRDD-----------------GTDALRVARLSGLPPER
BIOD_RHOPB       LAG------FL-QASYWKPVQAGLDG-----------------GTDSSRVAALSGLPPQR
BIOD_SPHWW       LAG------LL-DGCYWKPVQAGLAD-----------------GTDSDTVRRLSGLPDDR
BIOD_NOVAD       LTG------AL-NAHYWKPVQAGLED-----------------GADRDHVARLAGVPASH
BIOD_SPHAL       LAR------AT-GTPYWKPVQSGLEE-----------------ETDSEIVARLAGVP---
BIOD_MAGSA       LAQ------HW-RADYWKPIQTGSTE-----------------GTDFESVARL--APAAR
BIOD_CHLAB       LTV------LL-QAEYWKPIQSGSLN-----------------HSDSAIVHALSG---AR
BIOD_CHLFF       LAT------LF-QAEYWKPIQSGSLD-----------------RSDSTIVRELSG---AV
BIOD_CHLPN       LAR------AL-NAEYWKPIQAGNLE-----------------NSDSNIVHELSG---AY
BIOD_CYTH3       LTN------AL-QADYWKPVQAG-LE-----------------ETDSNTIRTLLHSGHSI
BIOD_GRAFK       VAE------AL-KADYWKPIQAGDLE-----------------NSDSHKVKKLVSNKDSV
BIOD_CAMJE       FCA------NF-NYDYFKLIQAGTPT-----------------DSEF----IAKFSPKTK
BIOD_CAMJR       FCA------NF-NYDYFKLIQAGTPT-----------------DSEF----IAKFSPKTK
BIOD_CAMJJ       FCA------NF-NYDYFKLIQAGTPT-----------------DSEF----IAKFSPKTK
BIOD_CAMJ8       FCA------NF-NYDYFKLIQAGTPT-----------------DSEF----IAKFSPKTK
BIOD_LAWIP       LCL------HT-AYDYFKMIQTGSIN-----------------GTDSD---ILKKLTYSK
BIOD_NEOSM       ICL------HL-GWGYFKPIQTGG-------------------NSDSD---FVSSTTGVP
BIOD_LEPBJ       ILGKYG-K-SL-GLKYFKPVQTG--N-----------------DSDRVTLMNLTGLHESY
BIOD_LEPBL       ILGKYG-K-SL-GLKYFKPVQTG--N-----------------DSDRVTLMNLTGLHESY
BIOD_LEPIN       ILGKYG-E-SL-GLKYFKPVQTG--D-----------------DSDRITLMRLTGLHESY
BIOD_LEPIC       ILGKYG-E-SL-GLKYFKPVQTG--D-----------------DSDRITLMRLTGLHESY
BIOD_RUTMC       LIRLLS-N-TL-KVSARKPVESDCENKNGRL-----------IPKDALLLSKACNINEPI
BIOD_VESOH       LIKFLT-N-IL-KVRVRKPVESDCKNKNGKL-----------IPKDALLLSKACNIIESI
BIOD_CALBD       LCWALK-EKGY-NIGYFKPVLSGAKRRGK-----------------MLIPQDTEFVVNFA
BIOD_CALS8       LCWALK-EKGY-NIGYFKPVLSGAKRRGK-----------------MLIPQDTEFVVNFA
BIOD_CLOB1       IIKRLR-ETNI-NCGYYKAALSGAERRDG-----------------KLIAGDANYVYNIA
BIOD_CLOBH       IIKRLR-ETNI-NCGYYKAALSGAERRDG-----------------KLIAGDANYVYNIA
BIOD_CLOBJ       IIKRLR-ETNI-NCGYYKAALSEAERRDG-----------------KLIAGDANYVYNIA
BIOD_CLOBK       IIKRLR-ETNI-NCGYYKAALSGAERRDG-----------------KLIAGDANYVYNIA
BIOD_CLOBL       IIKRLR-ETNI-NCGYYKAALSGAERRDG-----------------KLIAGDANYVYNIA
BIOD_CLOB6       IVKKLR-EFNI-NCGYYKAALSGAERIDG-----------------KLIAGDANYVYNIA
BIOD_CLOBM       IIKKLR-EVNI-NCGYYKAALSGAERIDS-----------------KLIAGDANYVYNIA
BIOD_CLOBA       IVKKLR-EANI-NCGYYKAVLSGAEIINN-----------------NIVAGDAKYVYNVA
BIOD_CLOBB       IVKKLR-EANI-NCGYYKAALSGAEIINN-----------------NIVAGDAKYVYNVA
BIOD_CLOTE       LVKKLK-QQGI-NAGYYKAALSGGVMIDG-----------------NIVAKDAEYVLKMS
BIOD_CLOPE       ILKKLR-EEGR-NAGYYKAVLSGAIKEKN-----------------GLIPLDCEEVMKIS
BIOD_CLOP1       ILKKLR-EEGR-NAGYYKAVLSGAIKDKK-----------------GLIPLDCEEVMEIS
BIOD_BRAHW       IAKHMK-DKGL-NIGYYKAALSGSL---------------------DITDSDAWYVKQQA
BIOD_CLOK5       LMHVLR-SRGY-NAVYFKAALSGALEIDN-----------------KLIPSDTKLVSDVS
BIOD_CLOK1       LMHVLR-SRGY-NAVYFKAALSGALEIDN-----------------KLIPSDTKLVSDVS
BIOD_CLONN       ILYLLR-KNGV-NASYFKAALSGAIKVNE-----------------RLIPGDTKFVSDLS
BIOD_CLOAB       LVYILC-KAGY-KTAYFKAALSDAEELNG-----------------KLIPGDTEFVCSLS
BIOD_ANOFW       MLRTLV-DKRI-RATAYKPVQSGAQWREG-----------------KWIAPDVDVYRKVI
BIOD_BACHD       LTRFLI-DMGV-NAFPYKPVQSGATTNGA-----------------RMIPSDAQMYQLVR
BIOD_LYSSH       LMRNLQ-KQGV-RVTPYKPVQTGEVYDGE-----------------QAYYFDTAMYEKYS
BIOD_LYSSC       LMCQLQ-RLGL-EIIPFKPVQTGEIYDNL-----------------HSYYADTAMYEKYS
BIOD_FUSNN       LYKALK-K--Y-NFQYYKPIQSGCFLKDG-----------------KLTAPDVDFLTKFV
BIOD_GEOKA       VALALE-RLGM-SVSVLKPVQTGLAEDG----------------------VSFAEQYWYE
BIOD_GEOSW       LAFAFQ-KMGL-NTKIFKPIQTGLAEDG----------------------VSFADQYWYE
BIOD_STAES       LYKALR-TRGY-RVCIFKPFQTEEIGGG----------------------RYPDLEIYKN
BIOD_STAEQ       LYKALR-TRGY-RVCIFKPFQTEEIGGG----------------------RYPDLEIYKN
BIOD2_HAEIN      YAKKLM-EQGC-SVITQKMIQTGCKNIAD-----------------DLLVHRKIQ--GID
BIOD2_PASMU      YAKKLM-QQGA-SVITQKMIQTGCRGIAE-----------------DLLTHRKIQ--GIE
BIOD2_HAEDU      YAKRLM-QQGF-SVITQKMIQTGCQHISA-----------------DIIKHRQLQ--GIE
BIOD_NEIG1       LAKQLL-QQGK-SVITQKPVQTGCQDIAE-----------------DIAVHRKIM--GIP
BIOD_NEIG2       LAKQLL-QQGK-SVITQKPVQTGCQDIAE-----------------DIAVHRKIM--GIP
BIOD_NEIMF       LAKQLL-QQGK-SVITQKPVQTGCQDIAE-----------------DIAVHRKIM--GIP
BIOD_NEIMB       LAKQLL-QQGK-SVITQKPVQTGCQNIAD-----------------DIAVHRKIM--GIP
BIOD_NEIM0       LAKQLL-QQGK-SVITQKPVQTGCQNIAD-----------------DIAVHRKIM--GKP
BIOD_NEIMA       LAKQLL-QQGK-SVITQKPVQTGCQNIAD-----------------DIAVHRKIM--GIP
BIOD_CHLTE       LARCFA-ETGW-RTITQKIAQTGCEGVSE-----------------DIAEHRKLM--GID
BIOD_HELPY       LAQYCN-ACGV-KTILLKPIETGVNDAIN-----------------HSSDAHLFLQDNRL
BIOD_HELPJ       LAQYCN-ACGV-KTILLKPIETGVNDAIN-----------------HSSDAHLFLQDNRL
BIOD_HELPS       LAQYCN-ACGV-RTILLKPIETGVNDTTN-----------------HFSDVHLFLQDNRL
BIOD_WOLSU       LLQSLH-QSGR-KPLALKPIETGANPTPE-----------------DAL-LHLQLMQKLQ
BIOD_SULNB       LLDALA-AKGR-SVGVFKPIETGVLDSAP-----------------DATILLESCRKVNR
BIOD_ANAD2       LVRAAR-AAGL-DAVGMKPAQSGHVPG------------------EPSDAERLREASDRV
BIOD_ANASK       LLRAAR-AAGL-DAVGMKPAQSGHVPG------------------EPSDAERLREASDCV
BIOD_ANADE       LVRAAR-AAGL-DAVGMKPAQSGHVAG------------------EPSDAERLREASGGV
BIOD_ANADF       LVANAR-AAGL-DAVPMKPAQSGVAPG------------------EPTDADRLHAACDGA
BIOD_AKKM8       IVKSLR-EAGI-NAAGFKPVACG----------------------DRQDARLLREAGPKD
BIOD_BACVZ       LAAAFR-QKQA-DIGVFKPFLSGVPRTH-----------------PESDTSLLKDMSQTA
BIOD_BACLD       LAALLK-EQHV-DVGVFKPFLSGELASD-----------------PQSDTALLKNMSETP
BIOD_BACSU       LAALLK-DNNR-HVGVYKPFLSGISRHH-----------------PDSDTSLLKDMSQTS
BIOD_BACNA       LAALLK-EHNR-DVGVYKPFLSGISRHH-----------------PDSDTSLLKDMSQTS
BIOD_BACAN       LAGVFR-ELGY-NIGVYKALQSGHVASN-----------------PEGDAARLKVLSGVP
BIOD_BACAA       LAGVFR-ELGY-NIGVYKALQSGHVASN-----------------PEGDAARLKVLSGVP
BIOD_BACAC       LAGVFR-ELGY-NIGVYKALQSGHVASN-----------------PEGDAARLKVLSGVP
BIOD_BACC0       LAGVFR-ELGY-NIGVYKALQSGHVASN-----------------PEGDAARLKVLSGVP
BIOD_BACHK       LAGVFR-ELGY-NIGVYKALQSGHVASN-----------------PEGDAARLKVLSGVP
BIOD_BACC3       LAGVFR-ELGY-NIGVYKPLQSGHVASN-----------------PEGDAARLKVLSGVP
BIOD_BACAH       LAGVFR-ELGY-NIGVYKPLQSGHVASN-----------------PEGDAARLKVLSGVP
BIOD_BACCZ       LAGVFR-ELGY-NIGVYKPLQSGHVASN-----------------PEGDAARLKALSGVP
BIOD_BACCR       IAGVFR-ELGY-NVGVYKPLQSGHVASN-----------------PEGDAARLKSLSGVP
BIOD_BACC4       IAGVFR-ELGY-NVGVYKPLQSGHVASN-----------------PEGDAARLKSLSGVP
BIOD_BACC2       IAGVFR-ELGY-NVGVYKPLQSGHVASN-----------------PEGDAARLKVLSGVP
BIOD_AQUAE       LAKELK-ERGY-KVGCLKPVETYVREV---------------------PEDGSLLSKATG
BIOD_HYDS0       LVEYLK-NKGI-NVDYIKPIETGVDEK---------------------PEDAYKVSSILG
BIOD_METJA       LAENLK-KMGI-NVGYLKPVETGGRE----------------------DTLTLKNILNTD
BIOD_META3       IGKHLKYKENI-NTGYLKPIESGGIE----------------------DTATLKEALNLD
BIOD_METVS       LGKILK-EKGI-NVGYMKPVESGGIE----------------------DTAYVRSELGLN
BIOD_UNCTG       IAETLE-KSGI-NTGVFKPVSTGNRN----------------------DAKALIKAAKID
BIOD_THEYD       ILRSFI-KKGL-KVGAMKVIETGCLNKDGIL--------------LPSDGMLLRDMAEMN
BIOD_ACICJ       MIRHWRAGDVP--ARALKPVASGYQPALSA---------------SSDAGILLRAMGSSM
BIOD_METNO       LTRALRASGRP--VRALKPVASGVPDLSDPDF-------------SASDTALLLAAQDLP
BIOD_CAUVC       LLEAARAGGLS--VDAFKPVVSGFDPDAPD---------------DSDPARLARALGRP-
BIOD_CAUVN       LLEAARAGGLS--VDAFKPVVSGFDPDAPD---------------DSDPARLARALGRP-
BIOD_CAUSK       LIRALKVRGAV--VDAFKPVVSGFDPKDAA---------------GSDPARLAIALGDP-
BIOD_PHEZH       LIRAERAAGRS--ATAFKPVLSGFDPDRAE---------------ASDAGQLLEALGEPV
BIOD_CORGL       LVRYLADQGHD--VLPVKLVQTGELP-------------------GEGDIFNIERLTGI-
BIOD_CORGB       LVRYLADQGHD--VLPVKLVQTGELP-------------------GEGDIFTIERLTGI-
BIOD_CORDI       VCQHYSRQGFR--VVPVKPVQTGEPK-------------------GSGDAQTIEKLTGI-
BIOD_COREF       LASAFHHRGDR--VIPVKPVQTGEPD-------------------GRGDIHTVEKLSGI-
BIOD_CORK4       VACVLQKEGYE--PFIVKPAQTGEPE-------------------GEGDAPRVTALTGI-
BIOD_FRACC       IGALAHDRHHA--VAVVKPAQTGVGP---G---------------ELGDVDLVRDLTGI-
BIOD_FRASN       LAALAADRGTA--VAVVKPAQTGVRA---G---------------ELGDVDLVRDLSGV-
BIOD_STRAW       VAAVAVAAGRS--VAVLKPAQTGVRP---D---------------ERGDADEVARLAGA-
BIOD_STRCO       VAAAALAGGRT--VAVLKAAQTGVGP---D---------------EAGDAQEVARLAGT-
BIOD_SACEN       IA--ALAPGR---VAVLKAAQTGVAA---G---------------EDGDVAEVARLAGP-
BIOD_NOCFA       LTALARAEALP--VAVCKPAQTGVAP---G---------------EPGDLAEVRRLAGP-
BIOD_RHOJR       LAAAAREAGLS--VAVCKPAQTGVAP---G---------------GPGDLAEVTRLSGV-
BIOD_RHOE4       LASVALQSGKS--VAVLKPAQTGVDV---D---------------GAGDLAEIERLTGGG
BIOD_MYCBO       LASAARQAGID--VAVCKPVQTGTAR-------------------GDDDLAEVGRLAGV-
BIOD_MYCTU       LASAARQAGID--VAVCKPVQTGTAR-------------------GDDDLAEVGRLAGV-
BIOD_MYCTA       LASAARQAGID--VAVCKPVQTGTAR-------------------GDDDLAEVGRLAGV-
BIOD_MYCBP       LASAARQAGID--VAVCKPVQTGTAR-------------------GDDDLAEVGRLAGV-
BIOD_MYCBT       LASAARQAGID--VAVCKPVQTGTAR-------------------GDDDLAEVGRLAGV-
BIOD_MYCMM       LASQANQAGID--VVVCKPVQTGTGI-------------------GDDDLAEIGRLSGV-
BIOD_MYCUA       LASQANQAGID--VVVCKPVQTGTGN-------------------GDDDLAEIGRLSGV-
BIOD_MYCLE       LACHARQAGIE--VAVCKPVQTGTQI-------------------GDDDLAEVARLSGV-
BIOD_MYCLB       LACHARQAGIE--VAVCKPVQTGTQI-------------------GDDDLAEVARLSGV-
BIOD_MYCA1       LACHARRAGID--VAVCKPVQTGTDD-------------------GDDDLAEVARLSGV-
BIOD_MYCGI       LACHARLAGLD--VAVCKPIQTGTRD-------------------GDDDLAVVARLAGV-
BIOD_MYCVP       LACHARLHGID--VAVCKPVQTGTRD-------------------GDDDLAEVARLAGV-
BIOD_MYCSK       LACAARVAGID--VAVCKPVQTGTGPVGGT---------------GDDDLVEIGRLAGV-
BIOD_MYCSS       LACAARVAGID--VAVCKPVQTGTGPVGGT---------------GDDDLVEIGRLAGV-
BIOD_MYCSJ       LACAARVAGID--VAVCKPVQTGTGPAGGT---------------GDDDLVEIGRLAGV-
BIOD_MYCS2       LACAARLARRD--VAVCKPVQTGTID-------------------GDDDLGEVRRLSGV-
BIOD_MYCA9       LAAAAVRQGID--VTVCKPVQTGDDH----------------------DAGEVARLSGV-
BIOD_CROS5       LAAYWQTYHSSESLGVIKLLQTGI-----------------------GDVEHYQRLLP--
BIOD_RIPO1       LAAYWHKYYPSQRLGVIKLLQTGI-----------------------GDHEHYQAMFAGQ
BIOD_GLOC7       LTAYWQTYRGKKGLGLMKLLQTGV-----------------------GDQERYHQLFGAD
BIOD_MICAN       LVAYWQKYYPSKALGLMKLMQTGQ-----------------------GDREWYEGLFQG-
BIOD_CYAP4       LAAYWRTYFPSQSVALLKPLQSGV-----------------------GDRELYRELFALN
BIOD_SYNY3       LAAYWWKCGKDQSFGLMKLMQTGL-----------------------GDDELYQQLFGHL
BIOD_GLOVI       LAAWWLAHRRT-PAAILKPVQCGP-----------------------GDREYYRTVFGD-
BIOD_NITMS       LAVALR--KMNVDVGVMKPFAAGTAQKKG---------------FKSEDVEILAKAAQVA
BIOD_RHOBA       TVERMRECGQR--VGVYKPVASGCELRADG-------------QRYSVDAATLWQAAGRP
                                  *                                          

BIOD1_ECOLI      LDYAT----VNPYTFAEPTSPHIISAQEGRP--IESLVMSAGLRALEQQ-----------
BIOD1_ECO57      LDYAT----VNPYTFAEPTSPHIISAQEGRS--IESSVMSSGLRALEQQ-----------
BIOD_PSEVU       LRYEA----VNPYTFAEPTSPHIVSAALGQP--IEAETLSAGLRMLEAQ-----------
BIOD1_SALTI      QPYSA----INPYTFAEPTSPHIASADEGRA--IDAAVLSRGLRTLEAQ-----------
BIOD1_SALTY      QPYSA----INPYTFAEPTSPHIVSADEGRA--IDAAVLSRGLRTLEAQ-----------
BIOD_SERMA       LDYDE----VNPYVFAEPTSPHIVSADEGRP--IDAARLSDGLRRLEQR-----------
BIOD1_YERPE      LGYSQ----VNPFTFLEATSPHIASESEGRA--IPLTALSQGLRQLEPS-----------
BIOD_YERPG       LGYSQ----VNPFTFLEATSPHIASESEGRA--IPLTALSQGLRQLEPS-----------
BIOD_BAUCH       LSYSQ----VNPLVFSEPTSPHIACRAEGRN--IELSELSAGLKVIEQK-----------
BIOD_ALIF1       LRYEE----VNPYALLMPASPHIAAEAENVV--IDYSVLSEGLASLKEK-----------
BIOD_ALIFM       LRYEE----VNPYALLMPASPHIAAEAENVV--IDYSVLSEGLASLKEK-----------
BIOD_ALISL       LSYDE----VNPYALLLPTSPHIAAAAENIV--IDYSVLSKGLASLKAK-----------
BIOD_VIBCB       IAYDD----VNPYALELPTSPHIAAKHEHVE--IKYEVLSEKLAHHKEQ-----------
BIOD_VIBPA       VAYED----VNPYALELPASPHIAAKHEQVE--IEYDLLSEKLAQHKEQ-----------
BIOD_VIBVU       VDYED----INPYALELPASPHIAAKHEKVE--IDYAVLSRKLAQHKEN-----------
BIOD_VIBVY       VDYED----INPYALELPASPHIAAKHEKVE--IDYAVLSRKLAQHKEN-----------
BIOD_VIBCH       MPYED----VNPYALVLPTSPHIAAKHENVT--IDYALLSNKLSKHKQN-----------
BIOD_PHOPR       LDYQE----VNPYAFEAAISPHLAAEQEGQV--IDFDVLSAGLEHLKSK-----------
BIOD2_ECOLI      LPYEA----VNPIALS----EEESSVAHSCP--INYTLISNGLANLTEK-----------
BIOD2_ECO57      LPYEA----VNPIALS----EEESSVAHSCP--INYTLISNGLANLTEK-----------
BIOD2_SALTI      LPYEA----INPIALS----EEESSVAHSCP--INYTLLSNGLASLSDK-----------
BIOD2_SALTY      LPYEA----INPIALS----EEESSVAHSCP--INYTLLSNGLASLSDK-----------
BIOD2_YERPE      LNYQE----VNPYPLQ----GDVIHACTDTL--INYEKMTEGLQCLSAK-----------
BIOD_YERPS       LNYQE----VNPYPLQ----GDVIHACTDTL--INYEKMTEGLQCLSAK-----------
BIOD_AERHH       LPYDL----VNPYAYEPPIAPHIAASEARDA--ITLKGLSDGLRQIEQA-----------
BIOD_AERS4       LPYDM----VNPYAFEPPIAPHIAASEARDA--ITLKGLSDGLRQIEQA-----------
BIOD_TOLAT       LQYEQ----VVAYSFDAFSSPHIAAEESGVT--IKLDVLSEGLSRLKKST----------
BIOD_ALTMD       NGQTLPINEINPIALTPPIAPHIAANEEGVA--LTHEKIAEGLNALAAY-----------
BIOD_PSEHT       AKYDI----INPFAFAPAIAPHIAAEQAGVT--ITADKLSSAYKNVKQQ-----------
BIOD_IDILO       FDYDR----VNPYTFEAAIAPHIAAADSGVV--IDKERLLKAVDWFHER-----------
BIOD_BURCM       LPPEL----RTPFLLKAPAAPHIVAAQEGVT--LDIDTIVACHREALT------------
BIOD_BURA4       LPPEL----RTPFLLKAPAAPHIVAAQEGVT--LDIDTIVASHREALT------------
BIOD_BURVG       LPPEL----RTPFLLKAPAAPHIVAAHEGVT--LDIDTIVASHREALT------------
BIOD_BURCA       LPPEL----RTPFLLKAPAAPHIVAAQEGVT--LDLDTIVACHREALT------------
BIOD_BURCH       LPPEL----RTPFLLKAPAAPHIVAAQEGVT--LDLDTIVACHREALT------------
BIOD_BURCC       LPPEL----RTPFLLKAPAAPHIVAAQEGVT--LDLDTIVACHREALT------------
BIOD_BURCJ       LPPEL----RTPFLLKAPAAPHIVAAQEGVT--LDLDTIVACHREALT------------
BIOD_BURM1       LPPEL----RTPFLLKAPAAPHIVAAHEHVT--LDIDTIVACHRDALT------------
BIOD_BURL3       LPPEL----RTPFLLKAPAAPHIVAAQEGVT--LDIDTIVACHREALT------------
BIOD_BURMA       LPAAI----RTPFLLKAPAAPHIVAAREGVA--LDIGTIVDAHRRACE------------
BIOD_BURM9       LPAAI----RTPFLLKAPAAPHIVAAREGVA--LDIGTIVDAHRRACE------------
BIOD_BURM7       LPAAI----RTPFLLKAPAAPHIVAAREGVA--LDIGTIVDAHRRACE------------
BIOD_BURMS       LPAAI----RTPFLLKAPAAPHIVAAREGVA--LDIGTIVDAHRRACE------------
BIOD_BURPS       LPAAI----RTPFLLKAPAAPHIVAAREGVA--LDIGTIVDAHRRACE------------
BIOD_BURP0       LPAAI----RTPFLLKAPAAPHIVAAREGVA--LDIGTIVDAHRRACE------------
BIOD_BURP1       LPAAI----RTPFLLKAPAAPHIVAAREGVA--LDIGTIVDAHRRACE------------
BIOD_BURP6       LPAAI----RTPFLLKAPAAPHIVAAREGVA--LDIGTIVDAHRRACE------------
BIOD_BURTA       LPATI----RTPFLLKAAAAPHIAAAREGVA--LDIDTIVGAHRRACE------------
BIOD_PARP8       LPPDI----RTPFMLKEPAAPHIAAAHESVT--LDMARIVDAHEAALQ------------
BIOD_AROAE       PGLDR----LNPYCLKTPVAPHIAAAEEGVE--IDPARIRAAFESLRA------------
BIOD_RALPJ       LPFDT----VCPWLLDAPMSPHLAAAREGVT--ITLPPILDAFAHARS------------
BIOD_RALSO       LPMAT----LCPWLLDAPMSPHLAARRAGVT--ITLPPIVDALAQART------------
BIOD_JANMA       LPREL----ATPYLLHEACAPHVSAELQGVA--IDIAHIKNCYVQVRE------------
BIOD_XANAC       PDYAV----LNPYALPAPLAPELAAAEVGVT--LALEPIVQAFAQLRT------------
BIOD_XANC5       PDYAT----LNPYALPAPLAPELAAADVGVT--LALEPIAHAFAQLLT------------
BIOD_XANOM       PAYAT----LNPYALPAPLAPELAAADVGVT--LSLEPITQAFAQLRA------------
BIOD_XANOP       PAYAT----LNPYALPAPLAPELAAADVGVT--LSLEPITQAFAQLRA------------
BIOD_XANCP       PDYAT----LNPYALPAALAPELAAADVGVS--LSLVPLQLAFAQLRA------------
BIOD_XANCB       PDYAT----LNPYALPAALAPELAAADVGVS--LSLVPLQLAFAQLRA------------
BIOD_XANC8       PDYAT----LNPYALPAALAPELAAADVGVT--LSLVPLQQALAQLRA------------
BIOD_XYLFM       PAYDL----INPYALPAAVAPEIAAIEARVT--VALEPLSASFTQLRA------------
BIOD_XYLFT       PAYDL----INPYALPAAVAPEIAAIEAGVT--VALEPLSASFTQLRA------------
BIOD_XYLFA       PAYDL----INPYALPAAVAPEIAAIEAGVT--VALEPLSAAFTQLRA------------
BIOD_NITMU       VQREH----INPYALVPPIAPHIAADRAGIE--IDLEVIRQAHLELKK------------
BIOD_PSEAE       LAYEQ----VNPLAFAPAIAPHLAAREAGVE--LSAARLHEAVREVLAL-----------
BIOD_PSEA8       LAYEQ----VNPLAFAPAIAPHLAAREAGVE--LSAARLHEAVREVLAL-----------
BIOD_PSEAB       LAYEQ----VNPLAFAPAIAPHLAAREAGVE--LSAARLHEAVREVLAL-----------
BIOD_PSEA7       LAYEQ----VNPLAFEPAIAPHLAAREAGVE--LSAARLHDAVREVLAL-----------
BIOD_CELJU       VVYEQ----VNPVALEAAIAPHIAALQEKRS--LSADRLAGFCRSSLR------------
BIOD_CHRSD       PPYAT----LNPYAYAPAIAPHLAARRAGRI--PTLDALVAHVADPLAE-----------
BIOD_MARHV       LPYDT----INPIALEPAIAPHVAAQQAGKQ--VTAQRIVGFCRGMQIR-----------
BIOD_MANSM       VSYQD----INSYTFAHTMPMLSQE---GKH--IDINKINTDLKRLSSRY----------
BIOD1_PASMU      VSYQE----INSYTFRHSLPVFSVQ---GKH--IRIEKMDADLARLNQKY----------
BIOD1_HAEIN      VSYQD----INSYTFSHCAPMLTQD---KMR--IKLDKINCDLTRLNQTY----------
BIOD_ACTSZ       VSYRD----INSYTFLQTVPMITAE---KGR--IKLEKVDRDLARLAATY----------
BIOD1_HAEDU      VAYRD----INSYTFTHSSTPIFAALDAVHH--IQEEKLDTDLSNLQQNY----------
BIOD_BUCAI       LSDRE----VNPIAFFENAPPHILSKFQKRS--IKKEELSLGLNNITKKS----------
BIOD_BUCA5       LSDRE----VNPIAFFENAPPHILSKFQKRS--IKKEELSLGLSNITKKS----------
BIOD_BUCBP       LSYQE----VNPYLFIDPVCPFFTNEKNHMN--VCMNKLSSGLQRLKKKS----------
BIOD_WIGBR       FKYKD----INPFAFLEKTAPHIASKRKNIF--INHILLSNKLNKFLNYDI---------
BIOD_FRATF       FTAAE----INLISFNQAVAPHIIAAKTKVD--ISIENLKQFIEDKYNQ-----------
BIOD_FRATH       FTAAE----INLISFNQAVAPHIIAAKTKVD--ISIENLKQFIEDKYNQ-----------
BIOD_FRATO       FTAAE----INLISFNQAVAPHIIAAKTKVD--ISIENLKQFIEDKYNQ-----------
BIOD_FRATM       FTAAE----INLISFNQAVAPHIIAAKTKVD--ISIENLKQFIEDKYNQ-----------
BIOD_FRATT       FTAAE----INLISFNQAVAPHIIAAKTKVD--ISIENLKQFIEDKYNQ-----------
BIOD_FRAT1       FTAAE----INLISFNQAVAPHIIAAKTKVD--ISIENLKQFIEDKYNQ-----------
BIOD_FRATW       FTAAE----INLISFNQAVAPHIIAAKTKVD--ISIENLKQFIEDKYNQ-----------
BIOD_FRATN       FTAAE----INLISFNQAVAPHIIAAKTKVD--ISIGNLKQFIENKYNQ-----------
BIOD_FRAP2       FTADE----VNLISFSEAVAPHIVAAKSKVD--ISIENLKQFIEDKYTRR----------
BIOD_LEGPC       LPLEI----INPWRFRLPVSPHLSAREDGAS--IDVHKVADYCLNLQLN-----------
BIOD_LEGPA       LSLEI----INPWRFRLPVSPHLSAREDGAS--IDVHKVADYCLNLQLN-----------
BIOD_LEGPL       LPLEV----VNPWRFRLPVSPHLSARADGAS--IDVHKVADYCLNLQLN-----------
BIOD_LEGPH       LPMEI----VNPWRFRLPVSPHLSAREDGAS--IDVHKVADYCLNLQVN-----------
BIOD_BRUAB       ILPEA-------WRLNTPASPHLSARLDGVE--IRPEEMHIPATSL--------------
BIOD_BRUA2       ILPEA-------WRLNTPASPHLSARLDGVE--IRPEEMHIPATSL--------------
BIOD_BRUA1       ILPEA-------WRLNTPASPHLSARLDGVE--IRPEEMHIPATSL--------------
BIOD_BRUME       ILPEA-------WRLNTPASPHLSARLDGVE--IRPEEMHIPATSL--------------
BIOD_BRUMB       ILPEA-------WRLNTPASPHLSARLDGVE--IRPEEMHIPATSL--------------
BIOD_BRUC2       ILPEA-------WRLNTPASPHLSARLDGVE--IRPEEMHIPATSL--------------
BIOD_BRUO2       ILPEA-------WRLNTPASPHLSARLDGVE--IRPEEMHIPATSL--------------
BIOD_BRUSU       ILPEA-------WRLNTPASPHLSARLDGVE--IRPEEMHIPATSL--------------
BIOD_BRUSI       ILPEA-------WRLNTPASPHLSARLDGVE--IRPEEMHIPATSL--------------
BIOD_AGRFC       ILPEA-------YRLKTPASPHLSARLDNVS--IDPARLLPPRPDG--------------
BIOD_OCHA4       VIPES-------WRLNTPASPHLSAQIDRVE--IDTDALAVPSVDA--------------
BIOD_BRADU       IVPEL-------YRLRTPASPHHSAEIDGVR--IDTETLGLPDSGER-------------
BIOD_BRASB       LVPEA-------YRLAAPASPHLAARLDGVS--IDPLCLNPPDTGGR-------------
BIOD_NITHX       VLPEA-------YRLRTPASPHLAAELDGVT--IEHQALLVPEKDR--------------
BIOD_NITWN       VWPEA-------YRLRTPVSPHLAAELDGVT--IDHRALEAPHTDR--------------
BIOD_RHOPS       LLAEA-------YRLTTPASPHLAAEIDGVA--IDPEALVLPDTQG--------------
BIOD_RHOP2       LLPEA-------YRLNTPASPHLAAEIDGVT--IDAEALALPEIDG--------------
BIOD_RHOP5       MLPEA-------YRLNTPASPHLAAEIDGVT--IDPAKLALPQHDR--------------
BIOD_RHOPA       ILPER-------YRLQTPASPHLAAEIDGVD--IDVAALELPSVSR--------------
BIOD_RHOPT       ILPER-------YRLRTPASPHLAAEIDGVD--IDVAALELPSVSR--------------
BIOD_OLICO       ILPER-------YILNTPASPHYAARIDGIT--IDTNDLTPPPAKDR-------------
BIOD_RHOPB       ILPER-------FRLNTPASPHLAAQIDGVR--IELDALDVPQIAG--------------
BIOD_SPHWW       ILPEA-------YRLETPASPHHAAAIDNVV--IDPALLAPPPCDR--------------
BIOD_NOVAD       VLPES-------YRLNTPCSPHRAAELDGVV--LDLARIALPDV--R-------------
BIOD_SPHAL       VRPEA-------YRLVTPASPHIAAEIDGVA--IDIERLTPPP---G-------------
BIOD_MAGSA       IHPSA-------VVLPAPLSPHEAARREKTR--IDLSSLVPPVTDR--------------
BIOD_CHLAB       CHPES-------YRFSHALAAHQAAQIDNIT--MHQETITLPKTD-A-------------
BIOD_CHLFF       CHRET-------YRLTHPLAAHQAARVDNIP--IHAENFSLPVTE-A-------------
BIOD_CHLPN       CHPEA-------YRLHKPLSPHKAAQIDNVS--IEESHICAPKTT-S-------------
BIOD_CYTH3       IHPEA-------YALKQAVSPHAAARNEGVE--IVLAAIQLPDTNGN-------------
BIOD_GRAFK       FFKNA-------CALNTPMSPHAAAEIDGIK--LQIKNIKRPETE-K-------------
BIOD_CAMJE       IFKEG-------IFLQTPASPHLGKIKEKLD--YKALDIILPK-----------------
BIOD_CAMJR       IFKEG-------IFLQTPASPHLGKIKEKLD--YKALDIILPK-----------------
BIOD_CAMJJ       IFKEG-------IFLQTPASPHLGKIKEKLD--YKALDIILPK-----------------
BIOD_CAMJ8       IFKEG-------IFLQTPASPHLGKIKEKLD--YKALDIILPK-----------------
BIOD_LAWIP       IHKEA-------YCYKEPLSPHLAAKLEQDE--ININNIILPN-----------------
BIOD_NEOSM       AYDSV-------FSFPDPIAPHVAAKMSGSS--IDILKIQLPEYRKSLSNKINSIPTTEH
BIOD_LEPBJ       FLKNY-------YSLSFAGSPHYASELEGVE--IDSDELSRHLYSIR-------------
BIOD_LEPBL       FLKNY-------YSLSFAGSPHYASELEGVE--IDSDELSRHLYSIR-------------
BIOD_LEPIN       VLKNY-------YSLAFAGSPHYSSELEGTE--IDTDELSRHLYSIR-------------
BIOD_LEPIC       VLKNY-------YSLAFAGSPHYSSELEGTE--IDTDELSRHLYSIR-------------
BIOD_RUTMC       DKVCR-------YKLESCSSAQMASQDSGLK--LTLDDLVDACMSDE-------------
BIOD_VESOH       DKICR-------YKFQACSSAQIASQALGLK--LTLDDLVDACIADE-------------
BIOD_CALBD       KIEGDI-YRLTPFIFEKPASPHIAASDE-NI-DINVYQIKQTFEDLSQN-----------
BIOD_CALS8       KIKGDI-YRLTPFIFEKPASPHIAASDE-NV-DINVNQIKQTFEDLSQN-----------
BIOD_CLOB1       NIKGDP-NDAVSYIFQQAVSPHLAAKLN-NV-EISMERIKKDFYSIKNK-----------
BIOD_CLOBH       NIKGDP-NDAVSYIFQQAVSPHLAAKLN-NV-EISMERIKKDFYSIKNK-----------
BIOD_CLOBJ       NIKGDP-NDAVSYIFQQAVSPHLAAKLN-NV-EISMERIKKDFYSIKNK-----------
BIOD_CLOBK       NIKGDP-NDAVSYIFQQAVSPHLAAKLN-NV-EISMERIKKDFYSIKNK-----------
BIOD_CLOBL       NIKGDP-NDAVSYIFQQAVSPHLAAKLN-NV-EISMERIKKDFYSIKNK-----------
BIOD_CLOB6       DIKGDP-NDAVSYIFEQAVSPHLAAKLN-NV-EISMEKIKKDFSYIKNK-----------
BIOD_CLOBM       NIKGDP-NDAVSYIFQQAVSPHLAAKLN-NV-EISMDKIKKDFSCIKNK-----------
BIOD_CLOBA       NIKGNP-NKCVSYIFEQPVSPHLAAKLN-NV-HISMDKIVDDFNYICNE-----------
BIOD_CLOBB       NIKGNP-NECVSYIFKQAVSPHLAAKLN-NV-HISMDKIVADFNYRCNE-----------
BIOD_CLOTE       KIDKNP-NDYVSYIFKLSASPHLAAQFE-NT-EILMSKIVNDFEGIKNE-----------
BIOD_CLOPE       GLKESY-ENMVSYILENPYSPHLASEVE-EV-SISMEKIKKDYKSVRDK-----------
BIOD_CLOP1       GLKESY-ENMVSYILENPYSPHLASEVE-EV-SISMEKIKKDYKSVRDK-----------
BIOD_BRAHW       DLLDSY-DEMVSYTYKHAYSPHLAAQIE-GN-PPDIKVIKNAYENINKK-----------
BIOD_CLOK5       KLEEPY-ENITPYVYRTGVSPHLAARLE-NN-PMDLDIVKEKYVYLKEK-----------
BIOD_CLOK1       KLEEPY-ENITPYVYRTGVSPHLAARLE-NN-PMDLDIVKEKYVYLKEK-----------
BIOD_CLONN       GLNEEY-SFLTPYVFETAVSPHLASKIE-NI-PINLEVIKSSYLKVKEK-----------
BIOD_CLOAB       GIQEDY-EKLTPYIYKTAVSPYLASKIE-NK-PIDIQVIKDKLTKLENE-----------
BIOD_ANOFW       DVTD---EDGCTYLLQTPCSPHLAAKID-GV-TIEPDHIVAHVHQLQQT-----------
BIOD_BACHD       PEFDV--TDFNTYLLEKPCSPHLAADLA-NI-TLDRTVITKQVHQLEEA-----------
BIOD_LYSSH       LQLLDR-ENLNGYSFKEAASPHFAAQLE-GQ-QIDTQQLLKQMQLLQQT-----------
BIOD_LYSSC       LQVLNK-EHMNGYSFKEAASPHFAAQLE-GQ-QIDVENLLQRIQFLQES-----------
BIOD_FUSNN       GIDYD--DSMVTYTLKEEVSPHLASEME-GI-RIEIENVKRHYEDLKKK-----------
BIOD_GEOKA       RVAKLS-ASEGMYYMEPAMSPHLAAKLT-GT-SIEPERVAERLEWLKQR-----------
BIOD_GEOSW       KVVGLA-QSEGLYYMEPAVSPHLAATLT-NT-TIDPALIVEKIEQWKRQ-----------
BIOD_STAES       ECDLDY-DVTSLYTFKDPVSPHLAFKIERHQ-QLNHQTMIDKLESLKAQ-----------
BIOD_STAEQ       ECDLDY-DVTSLYTFKDPVSPHLAFKIERHQ-QLNHQTMIDKLESLKAQ-----------
BIOD2_HAEIN      LTEEDLQGKTCPYVFEYPCSPHLAAKRESR--KIEAKIIEKSTALLAEK-----------
BIOD2_PASMU      LTEEDKQGITCPYVFDYPCSPHLAAKLEQR--TIERKKIETCTALLCEK-----------
BIOD2_HAEDU      LTAEDLNGITCPYLFRYPCSPHLAAEMENN--PILPSKIAQASALLAQK-----------
BIOD_NEIG1       MQEADEQRLTMPEIFSHPASPHLAARLDGR--GLDLDKIRTATQELAAQ-----------
BIOD_NEIG2       MQEADEQRLTMPEIFSHPASPHLAARLDGR--GLDLDKIRTATQELAAQ-----------
BIOD_NEIMF       MQEADKRRLTMPEIFSYPASPHLAARLDGR--ALDLDKIRTATQELAAQ-----------
BIOD_NEIMB       MQEADKRRLTMPEIFSYPASPHLAARLDGR--ALDLDKIRTATQELAAQ-----------
BIOD_NEIM0       MQEADKQGLTMPEIFSYPASPHLAARLDGR--ALDLDKIRTATQQLAAQ-----------
BIOD_NEIMA       MQEADKQGLTMPEIFSYPASPHLAARLDGR--ALDLDKIRTATQQLAAQ-----------
BIOD_CHLTE       LQEADLDGTTCPYLFRFPASPHLAATVEGR--EIDFMTIRRSTFRLQKL-----------
BIOD_HELPY       LDRSLTLKDISFYRYHKVSAPLIAQQEEDPNAPIDTDNLTQRLHNFTKT-----------
BIOD_HELPJ       LDRSLTLKDISFYRYHKASAPLIAQQEEDPNAPIDTDNLTQRLHNFTKT-----------
BIOD_HELPS       LDRSLTLKDISFYRYAKASAPLIAQQEENQNAPIDTNDLIQRLQNFTKT-----------
BIOD_WOLSU       LDQGLSLEEICLERYKLPASPWVSAKKEGR--CVDVDHLLRRLLEFQKR-----------
BIOD_SULNB       NFEGLKTEDITAYTFPLPAAPFCA----DTNHKIRIDRILEKYHQLSQL-----------
BIOD_ANAD2       EPLEA----ICPYTFGAPLAPAAAARLEGRE--VSLARVVE----AARALAA--------
BIOD_ANASK       EPLEA----ICPYTFAAPLAPAAAARLEGRE--VSLARVVE----VARALAA--------
BIOD_ANADE       EPLEA----ICPYTFAAPLAPAAAARAEGRE--VSLARVVE----AARALAA--------
BIOD_ANADF       EPLEV----LCPYSFAAPLAPAVAARLEGRQ--VSFGAIVD----GVRALAA--------
BIOD_AKKM8       LTLDE----LNPVFLRNATCPYVAARLENTK--VDEKVILR----AYDALSA--------
BIOD_BACVZ       LSHEE----ITPFEWKEPLAPYTAAMLEGKS--VSMADVMA----HWSKIKN--------
BIOD_BACLD       LTDEE----VTPFIFKEPLAPYTAAKLEGRT--VGLEDAVN----HWKKIKD--------
BIOD_BACSU       LSHED----ITPFAFKAPLAPYVAGKLEGKT--VTMEEVLS----HWGRIRE--------
BIOD_BACNA       LSHED----ITPFAFKAPLAPYVAGKLEGKT--VTMEEVLS----HWGRIRE--------
BIOD_BACAN       IKEDE----ICPYSIEEPLAPRLAMKRAGRA--VTLKDIIH----HYNERLK--------
BIOD_BACAA       IKEDE----ICPYSIEEPLAPRLAMKRAGRA--VTLKDIIH----HYNERLK--------
BIOD_BACAC       IKEDE----ICPYSIEEPLAPRLAMKRAGRA--VTLKDIIH----HYNERLK--------
BIOD_BACC0       TKEDE----ICPYSIEEPLAPRLAMKRAGRA--VTLKDIIH----HYNERLK--------
BIOD_BACHK       TKEDE----ICPYSIEEPLAPRLAMKRAGRA--VTLKDIIH----HYNERLK--------
BIOD_BACC3       TKEDE----ICPYSIEEPLAPRLAMKRAGRA--VTLKDIIH----HYNERLK--------
BIOD_BACAH       TKEDE----ICPYSIEEPLAPRLAMKRAGRA--VTLKDIIH----HYNERLK--------
BIOD_BACCZ       TKEDE----ICPYSIEEPLAPRLAMKRAGRT--VTLKDIIH----HYNERLK--------
BIOD_BACCR       TQENE----ICPYSIEEPLAPRLAMKRAGRV--VKLKEITD----YYNGLLK--------
BIOD_BACC4       TQENE----ICPYSIEEPLAPRLAMKRAGRV--VKLKEITD----YYNGLLK--------
BIOD_BACC2       TQENE----ICPYSIEEPLAPRLAMKRAGRV--VKLKEITD----YYNELLK--------
BIOD_AQUAE       QSVNE----IVPVRFSLPLAPYAATLEEGRD--FALEELGK----HYEELSK--------
BIOD_HYDS0       KPWQE----SVIYIFKKPMSPYACSLDEEVD--IDVDRIIK----TIKEREQ--------
BIOD_METJA       DDLDL----MNPINLKLPLSPNIAFDVENSP--LTLDEIKEKIKNAYETLKE--------
BIOD_META3       ENLNI----LNPVNLKNPLSPNIAAEIENKP--IDLVEIKK----SFDLLKN--------
BIOD_METVS       NSFEE----LNPVNLKKPLSPNISAKIEEKE--IDILKIKA----AFEKLKE--------
BIOD_UNCTG       ENTET----VTPVFFKNPMSPYGASLLERRA--SDKIFDLKKINNAFKYFLN--------
BIOD_THEYD       DSLDL----ITPIKLENPLSPLVASRIEEIE--VDIERIFR----AFETLQK--------
BIOD_ACICJ       VNDEA-VATICPWRFPDPISPDMAAARSGRR--IPFDDLVAFCQAEIVGAA---------
BIOD_METNO       VTPET-VAAMTPWRFAAPLAPDLAAAREGRS--LALADLVAWCETAIAAPAP--------
BIOD_CAUVC       ---EA-WTDVSPRRYRAPLAPNIAARLEGDT--LQMDDLITDCREWLIGRDV--------
BIOD_CAUVN       ---EA-WTDVSPRRYRAPLAPNIAARLEGDT--LQMDDLITDCREWLIGRDV--------
BIOD_CAUSK       ---SA-VFRIAPRRYRAPLSPNIAAQLEGET--LVLDDMVIDAVARAAELRD--------
BIOD_PHEZH       -TSTR-LDRISPLRFIAPLAPPSAARLEGVV--LTRDRLLTLSNAWLSRTDA--------
BIOD_CORGL       ------AGEE-FARFKDPLAPNLAARREG----VEPIQFDQIISWLRGFDDP--------
BIOD_CORGB       ------AGEE-FARFKDPLAPNLAARREG----IEPIQFDQIISWLRGFDDP--------
BIOD_CORDI       ------VGKC-FARFPEPLAPNLSAQRAG----MQQLNLEEIVNKIRELDGP--------
BIOD_COREF       ------RGVE-FTRYPDPLAPNLAARRAG----LPQVTLPDLAREIRDLDAP--------
BIOD_CORK4       ------DNAETLYRFPEPLAPATSARRAN----MPYPELTTVAEEIKSFDKP--------
BIOD_FRACC       ------TDVHELARYPDPLAPATAARRSG----HRAVDLDELAARIGTLADS--------
BIOD_FRASN       ------DDVHELSRYADPLAPVSAARRAG----LPTPDLGTVAVAVRRLQAD--------
BIOD_STRAW       ------VTTLELARYPEPLAPATAARRAG----LPPVGPHEVAEAAAKLAVE--------
BIOD_STRCO       ------ATVAEVARFPDPLAPGTAARRAG----RTPVRPEEVAEAATKLATE--------
BIOD_SACEN       ------VTAVELARYPEPLAPATAARRAG----APPVRPAQVAEAARELDRE--------
BIOD_NOCFA       ------VPTLELARYPEPLAPDTAARRCG----APLLTLDETATAVRGLDA---------
BIOD_RHOJR       ------TAVVELARYPEPLAPDTAARRSG----LPMLRCADVVETVRALDDG--------
BIOD_RHOE4       ------VTLVELARYPEPLAPDTAARRSG----LPLLALDDVVRVARDLDTT--------
BIOD_MYCBO       ------TQLAGLARYPQPMAPAAAAEHAG----MALPARDQIVRLIADLDRP--------
BIOD_MYCTU       ------TQLAGLARYPQPMAPAAAAEHAG----MALPARDQIVRLIADLDRP--------
BIOD_MYCTA       ------TQLAGLARYPQPMAPAAAAEHAG----MALPARDQIVRLIADLDRP--------
BIOD_MYCBP       ------TQLAGLARYPQPMAPAAAAEHAG----MALPARDQIVRLIADLDRP--------
BIOD_MYCBT       ------TQLAGLARYPQPMAPAAAAEHAG----MALPARDQIVRLIADLDRP--------
BIOD_MYCMM       ------TELVGLARYPLPMAPVAAAEQAG----QPLPSRDQLVQHIRGLDRP--------
BIOD_MYCUA       ------TELVGLARYPLPMAPVAAAEQAG----QPLPSRDQLVQHIRGLDRP--------
BIOD_MYCLE       ------TELTGLVRYPQPLAPAAAAEHAG----MALPTREQLLELIAGLDRP--------
BIOD_MYCLB       ------TELTGLVRYPQPLAPAAAAEHAG----MALPTREQLLELIAGLDRP--------
BIOD_MYCA1       ------TELAGLARYPRPLAPVAAAAAAG----MALPSREQLLRFIGELDRP--------
BIOD_MYCGI       ------EDLHSLAKFPEPLAPLAAAHRAG----ADLPSRAALDDLIAAVDRP--------
BIOD_MYCVP       ------TELHSLARFPEPLAPLAAARRSG----AELPTRAQILDLITAADRP--------
BIOD_MYCSK       ------DALHPGWRYPDPLAPVAAAERAG----AALPTRDELIGMVRAADAP--------
BIOD_MYCSS       ------DALHPGWRYPDPLAPVAAAERAG----AALPTRDELIGMVRAADAP--------
BIOD_MYCSJ       ------DALHPGWRYPDPLAPVAAAERAG----AALPTRDELIGMIRAADAP--------
BIOD_MYCS2       ------TALHGGWRYPEPLAPVAAAGRAG----APLPTRTELVGSVRAVDAA--------
BIOD_MYCA9       ------TRVQTLVRYPEPLAPVASASRAG----LELLDHTQMATAIVALDRP--------
BIOD_CROS5       ----H-VEVVNPLRYETPVAPPVAAEKEN-----RSIPLDQVWQGLNDLQQR--------
BIOD_RIPO1       ---ES-VEVVCPLRFTTPVAPPIAAEREN-----QPIPLEIVWKSLVSLQKS--------
BIOD_GLOC7       ---SS-IEIKVPLWFKTPVAPPVAAAAEG-----KTIDLKRVWQEFCALQQR--------
BIOD_MICAN       ----Q-LEMITPLQYQAPLAPPVAADLEG-----RDIPLGTVWQALLNLQKS--------
BIOD_CYAP4       ---QP-PEEINPLYFQAPLAPPLAAELEQ-----RSIDLSLPWQTLVKLRQS--------
BIOD_SYNY3       ---TR-WDVVTPLKFATPLAPPLAADQEG-----KTIDLGVVWQTLQTMQQN--------
BIOD_GLOVI       ----A-LSVLNPLYFEAPLAPPLAAAREG-----QTVDIGLLWKSYCEAAAG--------
BIOD_NITMS       DPENL----INPQFFPIPASPYTAWKNLKTK--PKVSTILSSFKKLSKL-----------
BIOD_RHOBA       KNIDA----VCPQRFLAALSPPQSAAREGVK--VDTRQLRDGLAIWCDGD----------
                                                                             

BIOD1_ECOLI      ------------------ADWVLVEGAGGWFTPLSD-------TFTFADWVTQE--QLPV
BIOD1_ECO57      ------------------ADWVLVEGAGGWFTPLSD-------TFTFADWVTQE--QLPV
BIOD_PSEVU       ------------------AEWVLVEGAGGWFTPLSE-------TLTFADWATQE--QLPV
BIOD1_SALTI      ------------------ADWVLTEGAGGWFTPLSA-------TLTFADWVQTE--QLPV
BIOD1_SALTY      ------------------ADWVLTEGAGGWFTPLSA-------TLTFADWVQTE--QLPV
BIOD_SERMA       ------------------ADWVLVEGAGGWFTPLSA-------EYTFADWVRQE--QLPV
BIOD1_YERPE      ------------------ADWILIEGAGGWFTPLSP-------QATFADWVQQE--QLPV
BIOD_YERPG       ------------------ADWILIEGAGGWFTPLSP-------QATFADWVQQE--QLPV
BIOD_BAUCH       ------------------SDWIVVEGAGGWFTPLGE-------GILYSDWVNYE--KLPV
BIOD_ALIF1       ------------------SDVVLVEGAGGWRVPVSK-------DDCLSTWVQQE--KLPV
BIOD_ALIFM       ------------------SDVVLVEGAGGWRVPVSK-------DDCLSTWVQQE--KLPV
BIOD_ALISL       ------------------SDIVLVEGAGGWRVPVSK-------SDCLSTWVQQE--KLPV
BIOD_VIBCB       ------------------SDIVLVEGAGGWRVPVSD-------TDSLSTWVQQE--QLPV
BIOD_VIBPA       ------------------ADVVLVEGAGGWRVPVSD-------TDSLSTWVQQE--QLPV
BIOD_VIBVU       ------------------ADVVLVEGAGGWRVPVSD-------TDSLSTWVKQE--DLPV
BIOD_VIBVY       ------------------ADVVLVEGAGGWRVPVSD-------TDSLSTWVKQE--DLPV
BIOD_VIBCH       ------------------AELVVVEGAGGWRVPTSD-------SDCLSTWVKQE--RLPV
BIOD_PHOPR       ------------------SEAVLIEGAGGWRVPISH-------TDFLSSWVKRE--KLPV
BIOD2_ECOLI      ------------------VDHVVVEGTGGWRSLMND-------LRPLSEWVVQE--QLPV
BIOD2_ECO57      ------------------VDHVVVEGTGGWRSLMND-------LRPLSEWVVQE--QLPV
BIOD2_SALTI      ------------------VDHVVVEGTGGWRSLMND-------LRPLSEWVVQE--QLPV
BIOD2_SALTY      ------------------VDHVVVEGTGGWRSLMND-------LRPLSEWVVQE--QLPV
BIOD2_YERPE      ------------------ADTVIVEGCGGWKVMMND-------QRFYSDWVVQE--QLPV
BIOD_YERPS       ------------------ADTVIVEGCGGWKVMMND-------QRFYSDWVVQE--QLPV
BIOD_AERHH       -----------------GAELVVVEGAGGWFLPLDR-------KHLLSDWVKQE--NMPV
BIOD_AERS4       -----------------GAELVVVEGAGGWFLPLDR-------KHLLSDWVKQE--NIPV
BIOD_TOLAT       -----------------GADIIFVEGAGGWRVPIGN-------GHFLSDWVKYE--NMPV
BIOD_ALTMD       -----------------RPDILLMEGAGGWRLPLTIGSDNT-PTHYLSDVVKAL--KMDV
BIOD_PSEHT       -----------------GADYILTEGAGGWALPISN-------TDYLYNWVKAE--QLPV
BIOD_IDILO       -----------------PIDSLVIEGAGGWQLPLAS-------GLRMPQVVKEV--NAKV
BIOD_BURCM       -----------------RADVVVVEGVGGFRVPLTD-------TQDTADLAVAL--GLPV
BIOD_BURA4       -----------------RADVVVVEGVGGFRVPLTD-------TQDTADLAVAL--GLPV
BIOD_BURVG       -----------------RANVVVVEGVGGFRVPLND-------TQDTADLAVAL--GLPV
BIOD_BURCA       -----------------RADVVVVEGVGGFRVPLND-------TQDTADLAVAL--GLPV
BIOD_BURCH       -----------------RADVVVVEGVGGFRVPLND-------TQDTADLAVAL--GLPV
BIOD_BURCC       -----------------RADVVVVEGVGGFRVPLND-------TQDTADLAVAL--GLPV
BIOD_BURCJ       -----------------RADVVVVEGVGGFRVPLND-------TQDTADLAVAL--GLPV
BIOD_BURM1       -----------------RADIVVVEGVGGFRVPLND-------TQDTADLAVAL--GLPV
BIOD_BURL3       -----------------RADVVVVEGAGGFRVPMND-------TQDLADLAVAL--GVPV
BIOD_BURMA       -----------------MADVIVVEGVGGVRVPLAD-------TRDTADLAVAL--GLPV
BIOD_BURM9       -----------------MADVIVVEGVGGVRVPLAD-------TRDTADLAVAL--GLPV
BIOD_BURM7       -----------------MADVIVVEGVGGVRVPLAD-------TRDTADLAVAL--GLPV
BIOD_BURMS       -----------------MADVIVVEGVGGVRVPLAD-------TRDTADLAVAL--GLPV
BIOD_BURPS       -----------------MADVIVVEGVGGFRVPLAD-------TRDTADLAVAL--GLPV
BIOD_BURP0       -----------------MADVIVVEGVGGFRVPLAD-------TRDTADLAVAL--GLPV
BIOD_BURP1       -----------------MADVIVVEGVGGFRVPLAD-------TRDTADLAVAL--GLPV
BIOD_BURP6       -----------------MADVIVVEGVGGFRVPLAD-------TRDTADLAVAL--GLPV
BIOD_BURTA       -----------------RADVVVVEGVGGFRVPLAG-------TRDTADLAVAL--GLPV
BIOD_PARP8       -----------------MADVVVVEGVGGFRVPLTD-------SHDTADLAFAL--NLPV
BIOD_AROAE       -----------------QADVVIVEGVGGFRVPLGD-------RYDTADLAREL--GLPV
BIOD_RALPJ       -----------------LADAVVVEGVGGFRVPLSD-------DFDTAEMAVAL--GLPV
BIOD_RALSO       -----------------QADAVVVEGVGGFRVPLSD-------TFDTAQLAVAL--GLPV
BIOD_JANMA       -----------------MAEAVVVEGVGGFRVPLSD-------HADTADLAREL--ALPV
BIOD_XANAC       -----------------QAEVVVVEGVGGWAAPLSA-------TLDQADLVCAL--QLPV
BIOD_XANC5       -----------------QAEVVVVEGVGGWAAPLSA-------TLDQADLVRAL--QLPV
BIOD_XANOM       -----------------QAEVVVVEGVGGWAAPLSA-------TLDQADLVRAL--QLPV
BIOD_XANOP       -----------------QAEVVVVEGVGGWAAPLSA-------TLDQADLVRAL--QLPV
BIOD_XANCP       -----------------QAEVVVVEGVGGWAAPLSA-------QLDQADLVRAL--QLPV
BIOD_XANCB       -----------------QAEVVVVEGVGGWAAPLSA-------QLDQADLVRTL--QLPV
BIOD_XANC8       -----------------QAEVVVVEGVGGWAAPLSA-------QLDQADLVRAL--QLPV
BIOD_XYLFM       -----------------QADVVVVEGVGGWATPLNA-------TIDQATLVRAL--EIPV
BIOD_XYLFT       -----------------QADVVVVEGVGGWATPLNA-------TFDQATLVRAL--EIPV
BIOD_XYLFA       -----------------QADVVVVEGVGGWATPLNA-------TIDQATLVRAL--EIPV
BIOD_NITMU       -----------------KADIVIVEGAGGFLVPLND-------HEDSVALVQAL--GLAV
BIOD_PSEAE       -----------------QADFTLVEGAGGWRVPLLG-------RENLSDLARLL--ALPV
BIOD_PSEA8       -----------------QADFTLVEGAGGWRVPLLG-------RENLSDLARLL--ALPV
BIOD_PSEAB       -----------------QADLTLVEGAGGWRVPLQG-------RENLSDLARLL--ALPV
BIOD_PSEA7       -----------------RADFTLVEGAGGWRVPLQG-------RENLSDLARLL--GLPV
BIOD_CELJU       -----------------QADFTLVEGAGGWRVPLNP-------SETLANLAQLL--RLPV
BIOD_CHRSD       -----------------KRDLTLIEGAGGWRVPLND-------DEDLAGLAVRL--ELPV
BIOD_MARHV       -----------------PADLLLIEGAGGWRVPLND-------RETYAAVPGEL--KLPV
BIOD_MANSM       -------------------QSVLVEGSFGWLTPINQ-------DYTFASWAAEH--KMPV
BIOD1_PASMU      -------------------QSVLVEGSYGWLTPINK-------TYCFADWAKSH--QMPV
BIOD1_HAEIN      -------------------QSVVVEGSFGLMTPMAE-------GKSFADWIAQQ--KMPV
BIOD_ACTSZ       -------------------DVVAVEGSFGWLSPMNE-------RFTFADWVVKH--NMPV
BIOD1_HAEDU      -------------------PNVVVEGTYGWLTPINK-------DLSFAEWVHKN--NMPA
BIOD_BUCAI       -------------------NWILVEGAGGWYTPLSC-------KDTFSSWVKQE--KLTV
BIOD_BUCA5       -------------------NWILVEGAGGWYTPLSC-------KDTFSSWVKQE--KLTV
BIOD_BUCBP       -------------------NWILIEGIGGLHTPFSN-------EFVMSDWIKKE--NLKT
BIOD_WIGBR       -------------------DYLIIEGFGGWKVPINS-------NSMYSEWVSNE--KLPI
BIOD_FRATF       -----------------DLDILFIEGAGGLLTPYSD-------HTTQLDLIKAL--QIPV
BIOD_FRATH       -----------------DLDILFIEGAGGLLTPYSD-------HTTQLDLIKAL--QIPV
BIOD_FRATO       -----------------DLDILFIEGAGGLLTPYSD-------HTTQLDLIKAL--QIPV
BIOD_FRATM       -----------------DLDILFIEGAGGLLTPYSD-------HTTQLDLIKAL--QIPV
BIOD_FRATT       -----------------DLDILFIEGAGGLLTPYSD-------HTTQLDLIKAL--QIPV
BIOD_FRAT1       -----------------DLDILFIEGAGGLLTPYSD-------HTTQLDLIKAL--QIPV
BIOD_FRATW       -----------------DLDILFIEGAGGLLTPYSD-------HTTQLDLIKAL--QIPV
BIOD_FRATN       -----------------DLDILFIEGAGGLLTPYSD-------HTTQLDLIKAL--EIPV
BIOD_FRAP2       -----------------DLDILFIEGAGGLLTPYSN-------HATQFDLIKAL--RIPV
BIOD_LEGPC       -----------------DIKKLFIEGAGGLMVPLNE-------QDTWLDFLKLT--RIPV
BIOD_LEGPA       -----------------DIKKLFIEGAGGLMVPLNE-------QDTWLDFLKLT--RIPV
BIOD_LEGPL       -----------------DIKKLFIEGAGGLMVPLNE-------QDTWLDFLKLT--RIPV
BIOD_LEGPH       -----------------DIKKLFIEGAGGLMVPLNE-------QDTWLDFLKLT--RIPV
BIOD_BRUAB       --------------------PLVIEGAGGLLVPLNDK-------TLFADLFAIW--RIPA
BIOD_BRUA2       --------------------PLVIEGAGGLLVPLNDK-------TLFADLFAIW--RIPA
BIOD_BRUA1       --------------------PLVIEGAGGLLVPLNDK-------TLFADLFAIW--RIPA
BIOD_BRUME       --------------------PLVIEGAGGLLVPLNDK-------TLFADLFAIW--RIPA
BIOD_BRUMB       --------------------PLVIEGAGGLLVPLNDK-------TLFADLFAIW--RIPA
BIOD_BRUC2       --------------------PLVIEGAGGLLVPLNDK-------TLFADLFAIW--RIPA
BIOD_BRUO2       --------------------PLVIEGAGGLLVPLNDK-------TLFADLFAIW--RIPA
BIOD_BRUSU       --------------------PLVIEGAGGLLVPLNDK-------TLFADLFAIW--RIPA
BIOD_BRUSI       --------------------PLVIEGAGGLLVPLNDK-------TLFADLFAIW--RIPA
BIOD_AGRFC       --------------------PLVIEGAGGLLVPLTDR-------LLFADIFALW--QIPL
BIOD_OCHA4       --------------------PLVIEGAGGLHVPLTRR-------TTFIDVFARW--RKPV
BIOD_BRADU       --------------------RLVIEGAGGLMVPLTAR-------TLYIDIFERW--QLPV
BIOD_BRASB       --------------------PLVIEGAGGVMVPLTAD-------TLYLDVFARW--QWPV
BIOD_NITHX       --------------------PLVVEGAGGLLVPLTRT-------ITYLDLMARW--RIPV
BIOD_NITWN       --------------------PLVIEGAGGLLVPLTRD-------VTYLDLMARW--RLPV
BIOD_RHOPS       --------------------PLVVEGAGGLLVPLTRH-------VTYIDVFATW--RAPV
BIOD_RHOP2       --------------------PLVVEGAGGLLVPLTRA-------ITYIDIFARW--RAPV
BIOD_RHOP5       --------------------PLVVEGAGGLLTPLTRS-------VSYIDVIASW--HAPV
BIOD_RHOPA       --------------------PLVVEGAGGLMVPLTRE-------TTYIDVFARW--AAPL
BIOD_RHOPT       --------------------PLVVEGAGGLMVPLTRE-------TTYIDVFARW--AAPL
BIOD_OLICO       --------------------PLVIEGAGGLMVPINED-------TLFIDVFARW--KLPL
BIOD_RHOPB       --------------------SLVIEGAGGLMVPLNSD-------TLYIDVFARW--NLPV
BIOD_SPHWW       --------------------RLVIEGAGGLLVPLAGG-------LLFADIFAGW--RFET
BIOD_NOVAD       --------------------PLVVEGAGGALVPVTRN-------TTYADVFAWW--NLPV
BIOD_SPHAL       --------------------ELIVEGAGGALVPVTRR-------TLYAELFARW--QVPV
BIOD_MAGSA       --------------------PLVVEGAGGIMVPINEV-------ALMIDLMERL--SLPA
BIOD_CHLAB       --------------------SLIIETSGGFLSPCTHD-------SLQGDVFAQW--PCHW
BIOD_CHLFF       --------------------PLIIETSGGFLSPCSQD-------SLQGDVFSKW--PCQW
BIOD_CHLPN       --------------------NLIIETSGGFLSPCTSK-------RLQGDVFSSW--SCSW
BIOD_CYTH3       --------------------DLIIEGAGGVLVPLNDT-------DVVADLITQF--DAEV
BIOD_GRAFK       --------------------DLVIEGAGGLMVPLNAK-------EVIADLISK---EDLV
BIOD_CAMJE       ------------------SKNLLIELAGGLFSPMDEN-------YTMIDFVNIF--KHPT
BIOD_CAMJR       ------------------SKNLLIELAGGLFSPMDEN-------YTMIDFVNIF--KHPT
BIOD_CAMJJ       ------------------SKNLLIELAGGLFSPMDEN-------YTMIDFVNIF--KHPT
BIOD_CAMJ8       ------------------SKNLLIELAGGLFSPMDEN-------YTMIDFVNIF--KHPT
BIOD_LAWIP       ------------------ASNLVIEGAGGLLVPINQQ-------YLLLDIISYL--MLPV
BIOD_NEOSM       GRSKFISATTQTKYWEKENNKIVIEGAGGVLVPLQENG------TKMVDLIQHL--NVPV
BIOD_LEPBJ       ------------------DEKIIVEGAGGLLVPLTRK-------ILTLELVRQS--EIPL
BIOD_LEPBL       ------------------DEKIIVEGAGGLLVPLTRK-------ILTLELVRQS--EIPL
BIOD_LEPIN       ------------------DEKIIIEGAGGLLVPLNRR-------MLTLEVIRQA--EIPL
BIOD_LEPIC       ------------------DEKIIIEGAGGLLVPLNRR-------MLTLEVIRQA--EIPL
BIOD_RUTMC       --------------------FVIVEGTGGLLSPIARQ-------ALNSDLIQAL--DMPV
BIOD_VESOH       --------------------FVVVEGAGGLLSPIATK-------TLNSDLVQAI--NVPV
BIOD_CALBD       ------------------YEFVVIEGCGGLAVPLKEEKN---QFYMQYQLIKEI--CNNV
BIOD_CALS8       ------------------YEFVIIEGCGGLAVPLKEERN---QFYMQYQLIKEI--CNNV
BIOD_CLOB1       ------------------YDYITVEGSGGIVCPISTGK----ERIMLHNIIKIF--KLPA
BIOD_CLOBH       ------------------YDYITVEGSGGIVCPISTGK----ERIMLHNIIKIF--KLPA
BIOD_CLOBJ       ------------------YDYITVEGSGGIVCPISTGK----EKIMLDNIIKIF--KLPA
BIOD_CLOBK       ------------------YDYITVEGSGGIVCPISTGK----KKIMLDNIIKIF--KLPA
BIOD_CLOBL       ------------------YDYITVEGSGGIVCPISTGK----EKIMLDNIIKIF--KLPA
BIOD_CLOB6       ------------------HDYITVEGSGGIICPISMGK----EKIMLENIIKSF--KLPA
BIOD_CLOBM       ------------------YDYITVEGSGGIICPISMGK----EKIMLENIVKSL--KLPA
BIOD_CLOBA       ------------------HDYITVEGSGGIVCPIYYDK----EKIMLTDIIKKL--KIPI
BIOD_CLOBB       ------------------HDYITVEGSGGIICPIYYDK----EKIMLTDIIKKL--KIPI
BIOD_CLOTE       ------------------FDYVTIEGSGGIICPIFIGE----KPIMLIDIIKQL--NLDI
BIOD_CLOPE       ------------------YDFILCEGSGGIVCPISFSE----KKLMLEDIIKEF--NLQI
BIOD_CLOP1       ------------------YDFILCEGSGGIVCPISFSE----KKLMLEDIIKEF--NLPI
BIOD_BRAHW       ------------------HDYMIVEGSGGIICPIRYDNN---QKIFLEDIIKEL--NIPS
BIOD_CLOK5       ------------------YDFIIAEGSGGIVCPLIDDGR---GVYTIGNLIKDL--NMSV
BIOD_CLOK1       ------------------YDFIIAEGSGGIVCPLIDDGR---GVYTIGNLIKDL--NMSV
BIOD_CLONN       ------------------YDYIVAEGSGGIVCPMVHNEK---STILLEDIIKLL--DLDT
BIOD_CLOAB       ------------------YGYVLCEGSGGVICPITDVDN---KIYTLGNLIKDM--KMDV
BIOD_ANOFW       ------------------YDFVLVEGAGGIAVPLVDDS------FLIAHLAQLL--HFPL
BIOD_BACHD       ------------------HDAVLIEGAGGLYVPLTNDG------YCYIDFMEEL--NVPT
BIOD_LYSSH       ------------------WDVVICEGAGGLFVPLD--AC---GETTLLDVIVES--KLPV
BIOD_LYSSC       ------------------YDVVIAEGAGGLFVPLD--VQ---QSITLLDVIVSS--KLPV
BIOD_FUSNN       ------------------HSNILVEGAGGLYVPL---IR---DIFYIYDLIKLF--NLPV
BIOD_GEOKA       ------------------YDVVLVEGAGGLAVPWCERDG---RFYMTSDFLRDY--QLPA
BIOD_GEOSW       ------------------YDIVLVEGAGGLAVPLIEKEQ---GFYMTNDLIREY--NIPI
BIOD_STAES       ------------------FDMILIEGAGGIAVPIYEYSD---HFYMTTDLIKDT--SDFI
BIOD_STAEQ       ------------------FDMILIEGAGGIAVPIYEYSD---HFYMTTDLIKDT--SDFI
BIOD2_HAEIN      ------------------YDYVLLEGAGGLMVPYCEEA-------TTLDYIQLN--NYPL
BIOD2_PASMU      ------------------YDYVLLEGAGGLCVPYNEEE-------TTLDYLCQH--QYPV
BIOD2_HAEDU      ------------------YDYVLLEGAGGLAVPYNSQQ-------TTLDYIVEQ--QLPL
BIOD_NEIG1       ------------------YEVVLVEGAGGLMVPLTEKL-------LTIDHIQQQ--AYPV
BIOD_NEIG2       ------------------YEVVLVEGAGGLMVPLTEKL-------LTIDHIQQQ--AYPV
BIOD_NEIMF       ------------------YEIVLVEGAGGLMVPLTEKL-------LTIDYIQQQ--AYPV
BIOD_NEIMB       ------------------YEVVLVEGAGGLMVPLTENL-------LTIDYIRQQ--GYPV
BIOD_NEIM0       ------------------YEIVLVEGAGGLMVPLTENL-------LTIDYIRQQ--GYPV
BIOD_NEIMA       ------------------YEIVLVEGAGGLMVPLTENL-------LTIDYIRQQ--GYPV
BIOD_CHLTE       ------------------YDLVLLEGVGGLLVPLTPEL-------LFADYVRDA--GYGL
BIOD_HELPY       ------------------YDLVIVEGAGGLCVPITLEE-------NMLDFALKL--KAKM
BIOD_HELPJ       ------------------YDLVIVEGAGGLCVPITLEE-------NMLDFALKL--KAKM
BIOD_HELPS       ------------------YDLVIVEGAGGLCVPITLEE-------NMLDLALKL--KAKI
BIOD_WOLSU       ------------------SDPLLIEGAGGLLVPLLKEY-------FMIDLAEAL--EAHM
BIOD_SULNB       ------------------CDILLVEGAGGLMVPVTRDF-------FMIDLIKEL--QTRV
BIOD_ANAD2       -----------------RHAAVVVEGAGGLLVPLTAR-------ETHADLAAAL--GLPV
BIOD_ANASK       -----------------RHAAVVVEGAGGLLVPLTAR-------ETHADLAAAL--GLPV
BIOD_ANADE       -----------------RHAAVVVEGAGGLLVPLTAR-------ETHADLAAAL--GLPV
BIOD_ANADF       -----------------RHEAVLVEGAGGLLVPLTEE-------ETYADLAVAL--GLSV
BIOD_AKKM8       -----------------AHECVVVEGVGGWEVPIGPG-------RNFSDMAADF--KLPV
BIOD_BACVZ       -----------------RHECFIVEGAGGISVPLGEN-------YLVSDLIKAM--ELPA
BIOD_BACLD       -----------------RHECFIVEGAGGIAVPLGED-------YFVSDLIKAL--DLPA
BIOD_BACSU       -----------------KHECFIVEGAGGISVPLGED-------YLVSHVIKAL--QLPM
BIOD_BACNA       -----------------KHECFIVEGAGGISVPLGED-------YLVSHVIKAL--QLPM
BIOD_BACAN       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACAA       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACAC       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACC0       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACHK       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACC3       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACAH       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACCZ       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACCR       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACC4       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_BACC2       -----------------EFNSLFVEGAGGLAVPYTED-------ALVIDFAKEL--QLPL
BIOD_AQUAE       -----------------KYKFLLVEGAGGIAVPIKKN-------YTYANLARDW--KLKV
BIOD_HYDS0       -----------------KASVLIVEGAGGIAVPIKVKP-----LIDYAYLIKSL--HALP
BIOD_METJA       -----------------KYDFLIVEGAGGVCVPIK-------EDFLMSDLIKFL--GLDA
BIOD_META3       -----------------KYDFLIIEGAGGVAVPIKY------NSFLMSDLIVYL--GAPA
BIOD_METVS       -----------------EYEFLIVEGAGGVAVPIK-------KDFLIADLIKYL--DLTC
BIOD_UNCTG       -----------------KYEFTVVEGVGGILVPLK-------QNFFVSDLIKKF--NLPV
BIOD_THEYD       -----------------KYDYLLVEGVGGLMVPLNKEEKKKSMFYFVRDLIKDM--GLPV
BIOD_ACICJ       -------------------GPMLVEGVGGAMVPLDET-------HTVRDWIAAL--GIEV
BIOD_METNO       ------------------GTAVLIEGVGGLMSPLTAE-------ATGLAWLKAL--RLPV
BIOD_CAUVC       -------------------GLALIEGAGGVMSPMTDE-------ATNLDLMVAL--GLPV
BIOD_CAUVN       -------------------GLALIEGAGGVMSPMTDE-------ATNLDLMVAL--GLPV
BIOD_CAUSK       -------------------GLLLVEGAGGVMSPLTDT-------QTNLDMIVAL--GAPV
BIOD_PHEZH       -------------------DLNLLEGAGGVMSPIAED-------ATNLDLMTGL--GLPV
BIOD_CORGL       ------------------DRIIVVEGAGGLLVRLGED-------FTLADVASAL--NAPL
BIOD_CORGB       ------------------DRIIVVEGAGGLLVRLGED-------FTLADVASAL--NAPL
BIOD_CORDI       ------------------QTVVVVEGAGGLLVRLADS-------FTIADVAAQL--DAPL
BIOD_COREF       ------------------DRIVLVEGAGGVLVRLADD-------LTLLDVAAEL--DAPL
BIOD_CORK4       ------------------GRVVLVEGAGGLLVRIGQD-------WTIADLAREL--GAPI
BIOD_FRACC       ------------------RDLVLVEGAGGLLVRYDAGG------ATLADLARVL--RAPV
BIOD_FRASN       ------------------RGLVLVEGAGGLLVRYDHDG------STLADLARTL--AAPV
BIOD_STRAW       ------------------HDLVLVEGAGGLLVRFDDAD------GTLADAARLL--DAPV
BIOD_STRCO       ------------------HDLVLVEGAGGLLVRFDAEG------GTLADVAGLL--DAPV
BIOD_SACEN       ------------------HDLVLVEGAGGLLVRYDD-G------GTLADVAVAL--SAPV
BIOD_NOCFA       -------------------ELTVVEGAGGLLVRIGE--------FTLLDLAREL--DAPV
BIOD_RHOJR       ------------------HDLVLVEGAGGLLVRLGAEG------FTLVDLARAL--DAPA
BIOD_RHOE4       ------------------HDLTLIEGAGGLLVRLGVDG------FTARDLAAAL--AAPV
BIOD_MYCBO       ------------------GRLTLVEGAGGLLVELAEPG------VTLRDVAVDV--AAAA
BIOD_MYCTU       ------------------GRLTLVEGAGGLLVELAEPG------VTLRDVAVDV--AAAA
BIOD_MYCTA       ------------------GRLTLVEGAGGLLVELAEPG------VTLRDVAVDV--AAAA
BIOD_MYCBP       ------------------GRLTLVEGAGGLLVELAEPG------VTLRDVAVDV--AAVA
BIOD_MYCBT       ------------------GRLTLVEGAGGLLVELAEPG------VTLRDVAVDV--AAVA
BIOD_MYCMM       ------------------GRLTLVEGAGGLLVELADSG------GTLRDLAVDL--GAAM
BIOD_MYCUA       ------------------GRLTLVEGAGGLLVELADSG------GTLRDLAVDL--GAAM
BIOD_MYCLE       ------------------GRLILVEGAGGLLVELADAS------ATLRDLAVEL--GALA
BIOD_MYCLB       ------------------GRLILVEGAGGLLVELADAS------ATLRDLAVEL--GALA
BIOD_MYCA1       ------------------GRLTLVEGAGGLLVELGENG------VTARDLAVAL--GAAV
BIOD_MYCGI       ------------------GRLTLVEGAGGLLVEIGRGG------VTLRDLAEDL--RAPV
BIOD_MYCVP       ------------------GRLTLVEGAGGLLVEIASDG------STLRDVAADL--GAPV
BIOD_MYCSK       ------------------GRLTLVEGAGGLLVELGQDA------VTLRDVATEL--DAPV
BIOD_MYCSS       ------------------GRLTLVEGAGGLLVELGQDA------VTLRDVATEL--DAPV
BIOD_MYCSJ       ------------------GRLTLVEGAGGLLVELGQDA------VTLRDVATEL--AAPV
BIOD_MYCS2       ------------------GRLTIVEGAGGLLVALGADG------VTLRDLAHDL--GAQV
BIOD_MYCA9       ------------------GALTLVEGAGGLLVELAADG------KTLRDLAMVL--DAPV
BIOD_CROS5       ------------------KNLVLAEGLGGLGSPVTWE-------LTVADLAGEW--GLPT
BIOD_RIPO1       ------------------CDFVLAEGLGGLGSPVTWE-------LTVADLAGEW--RLPT
BIOD_GLOC7       ------------------QSFVLLEALGGLGSPVTEE-------LTVADIAGQW--RLET
BIOD_MICAN       ------------------QDLVLIEGLGGLGCPVTHE-------LTLADLAAQW--RLKT
BIOD_CYAP4       ------------------YDRVLVEGVGGLGSPITWE-------LTVADLARDW--GLAT
BIOD_SYNY3       ------------------HDHVLVEALGSLGSPVTHE-------LTVADIAALW--RLET
BIOD_GLOVI       ------------------HALVLVEGVGGLGCPLGWD-------YTVADLARDW--RLPV
BIOD_NITMS       ------------------HEMILVEGMGGIMTPILKD-------YYITNLIKEM--KIPS
BIOD_RHOBA       ------------------FDVVMIEGAGGLFSPISDDWLNVDLAIEMKRWSDQNGHSFEL
                                         *   .                               

BIOD1_ECOLI      ILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVT-PPGKRHA--------EYMTTLT
BIOD1_ECO57      ILVVGVKLGCINHAMLTAQAIQHAGLTLAGWVANDVT-PPGKRHA--------EYMTTLT
BIOD_PSEVU       ILVVGVKLGCINHAVLTAQAVQQAGLRLAGWVANDVV-PPGQRHT--------EYLATLK
BIOD1_SALTI      ILVVGVKLGCINHAMLTALAVEQAGLPLVGWIANDMQ-PPGARHG--------EYLATLR
BIOD1_SALTY      ILVVGVKLGCINHAMLTALAVEQAGLPLVGWIANDIQ-PPGARHG--------EYLATLR
BIOD_SERMA       ILVVGIKLGCINHAVLTAQAVQQAGLTLAGWIANDVGGAPGRRHQ--------EYLATLR
BIOD1_YERPE      IMVVGVKLGCINHALLTAQAIQHAGLTLAGWVANEVT-PAGRRQA--------EYQATLT
BIOD_YERPG       IMVVGVKLGCINHALLTAQAIQHAGLTLAGWVANEVT-PAGRRQA--------EYQATLT
BIOD_BAUCH       ILVIGMKLGCINHALLTALAIRQFGLQLVGWIANHIQ-PTTTWSQ--------HYLAELR
BIOD_ALIF1       VLVVGIKLGCLSHAMLTAEAIQHDGLEIIGWVANRVN-PGTENYA--------EIIKMLE
BIOD_ALIFM       VLVVGIKLGCLSHAMLTAEAIQHDGLEIIGWVANRVN-PGTENYA--------EIIKMLE
BIOD_ALISL       VLVVGIKLGCLSHAMLTEEAIKHDGLDIVGWVANRVN-PGTEHYA--------DIIEMLE
BIOD_VIBCB       VLVVGIKLGCLSHALLTAEIIKADGLNLVGWVANRVN-PGTEHYA--------EIIDMLE
BIOD_VIBPA       VLVVGIKLGCLSHALLTAEIIKADGLNLVGWIANRVN-PGTEHYA--------DIIEMLE
BIOD_VIBVU       VLVVGIKLGCLSHALLTAEVIKADGLNLVGWVANRVN-PGTEHYA--------EIIDMLE
BIOD_VIBVY       VLVVGIKLGCLSHALLTAEVIKADGLNLVGWVANRVN-PGTEHYA--------EIIDMLE
BIOD_VIBCH       ILVVGIKLGCLSHAILTAEAIRADGLELVGWIANRIN-PGTEHYA--------EIIEHLE
BIOD_PHOPR       ILVVGVKLGCLSHAILTAEAIKNDGLELVGWVANRIN-PGTENYA--------DIIKMLE
BIOD2_ECOLI      LMVVGIQEGCINHALLTAQAIANDGLPLIGWVANRIN-PGLAHYA--------EIIDVLG
BIOD2_ECO57      LMVVGIQEGCINHALLTAQAIANDGLPLIGWVANRIN-PGLAHYA--------EIIDVLG
BIOD2_SALTI      LMVVGIQEGCINHALLTAQAVANDGLPLIGWVANRIN-PGLAHYA--------EIIDVLG
BIOD2_SALTY      LMVVGIQEGCINHALLTAQAVANDGLPLIGWVANRIN-PGLAHYA--------EIIDVLG
BIOD2_YERPE      ILVVGIKLGCINHALLTAQAIINDGLPLLGWVANRIN-PGLAHYA--------ETIAMLR
BIOD_YERPS       ILVVGIKLGCINHALLTAQAIINDGLPLLGWVANRIN-PGLAHYA--------ETIAMLR
BIOD_AERHH       IMVVGAKLGCLNHALLTFAAIRNNNLPVAGWVINRLH-GSMSHYQ--------ENLDTLR
BIOD_AERS4       IMVVGAKLGCLNHALLTFAAIRNDNLPVAGWVMNRLY-GSMSHYQ--------ENLDTLR
BIOD_TOLAT       IMVVGARLGCINHSVLTYEAIHHDMLPLVGWCMNRIT-PSMNHYQ--------QNLETLK
BIOD_ALTMD       ILVVGMRLGCLNHALLTAEAIRADGLIIKGWVANDITGN-MTRYQ--------ENLRSLK
BIOD_PSEHT       ILVVGMKLGCLNHALLTAAHMQSMGINCIGWIANQVDPN-MDEYQ--------ANLDSLK
BIOD_IDILO       VLVVGLKLGCLNHALLSLQSIKQEGCDVAGWIAVQTGPEPMPRQA--------ENLASLR
BIOD_BURCM       VLVVGVRLGCISHALLTADAIRQRGLTLAGWVANHVD-PAMSYAD--------ENVATIR
BIOD_BURA4       VLVVGVRLGCISHALLTADAITARGLRIAGWVANHVD-PAMSYAD--------ENVATIR
BIOD_BURVG       VLVVGIRLGCISHALLTADAIRQRGLTLAGWVANHVD-PAMSYAD--------ENVATIR
BIOD_BURCA       VLVVGVRLGCISHALLTADAIRQRGLTLAGWVANHVD-PAMSFAD--------ENVATIR
BIOD_BURCH       VLVVGVRLGCISHALLTADAIRQRGLTLAGWVANHVD-PAMSFAD--------ENVATIR
BIOD_BURCC       VLVVGVRLGCISHALLTADAIRQRGLTLAGWVANHVD-PAMSFAD--------ENVATIR
BIOD_BURCJ       VLVVGIRLGCISHALLTADAIRQRGLALAGWVANHVD-PAMSFAD--------ENVATIR
BIOD_BURM1       VLVVGMRLGCISHALLTADAIAARGLTLAGWVANHVD-PAMTYAD--------ENVATIR
BIOD_BURL3       VLVVGVRLGCINHALLTADAIAARGLKLAGWVANHVD-PAMSFPD--------ENIATMR
BIOD_BURMA       VLVVGVRLGCISHALLTAEAIAARGLPLAGWVANRID-PAMPFAD--------DNIDTLR
BIOD_BURM9       VLVVGVRLGCISHALLTAEAIAARGLPLAGWVANRID-PAMPFAD--------DNIDTLR
BIOD_BURM7       VLVVGVRLGCISHALLTAEAIAARGLPLAGWVANRID-PAMPFAD--------DNIDTLR
BIOD_BURMS       VLVVGVRLGCISHALLTAEAIAARGLPLAGWVANRID-PAMPFAD--------DNIDTLR
BIOD_BURPS       VLVVGVRLGCISHALLTAEAIAARGLPLAGWVANRID-PAMPFAD--------DNIDTLR
BIOD_BURP0       VLVVGVRLGCISHALLTAEAIAARGLPLAGWVANRID-PAMPFAD--------DNVDTLR
BIOD_BURP1       VLVVGVRLGCISHALLTAEAIAARGLPLAGWVANRID-PAMPFAD--------DNVDTLR
BIOD_BURP6       VLVVGVRLGCISHALLTAEAIAARGLPLAGWVANRID-PAMPFAD--------DNVDTLR
BIOD_BURTA       VLVVGVRLGCISHALLTADAIAARGLAIAGWVANRVD-AAMRFAD--------DNVDTLR
BIOD_PARP8       VLVVGMRLGCISHALLTAEAIAARGLRVVGWVANRVD-PAMLFPD--------ENIDTLR
BIOD_AROAE       ILVVGMRLGCISHALLTVEAIAARGLTLAGWIANRID-PAMLRAD--------ENLEALR
BIOD_RALPJ       VLVVGLRLGCLNHAALTAEAIAARGLHLAGWVGNVVD-PSMAGLD--------DNVATLR
BIOD_RALSO       VLVVGLRLGCLNHAALTAEAIAARGLRLAGWIGNVVD-ATMAGLD--------DNVATLR
BIOD_JANMA       IMVVGLRLGCLNHALLTADAIAARGLKLVGWVANTVD-AGMPFAE--------DNVAALA
BIOD_XANAC       VLVVGVRLGCINHARLTAAAIAADGLQCIGWIANEVD-PQMERIE--------ENIGMLR
BIOD_XANC5       VLVVGVRLGCINHARLTAAAIAADGLQCIGWIANEID-PQMERIE--------ENIGMLR
BIOD_XANOM       VLVVGVRLGCINHARLTAAAIAADGLQCIGWIANEVD-PQMERVE--------ENIGMLR
BIOD_XANOP       VLVVGVRLGCINHARLTAAAIAADGLQCIGWIANEVD-PQMERVE--------ENIGMLR
BIOD_XANCP       VLVVGVRLGCINHARLTAAAIAADGLRCIGWIANEID-PQMERIE--------DNIRMLG
BIOD_XANCB       VLVVGVRLGCINHARLTAAAIAADGLRCIGWIANEID-PQMERIE--------DNIRMLG
BIOD_XANC8       VLVVGVRLGCINHARLTAAAIAADGLRCIGWIANEID-PQMERIE--------DNIRMLG
BIOD_XYLFM       VLVVGLRLGCMNHARLSTAAIMADGLRCIGWIANTID-PHMARIE--------ENLALLR
BIOD_XYLFT       VLVVGLRLGCMNHARLSTAAIMADGLRCIGWIANTID-PHMARIE--------ENLALLR
BIOD_XYLFA       VLVVGLRLGCLNHARLSTTAIMADGLRCIGWIANTID-PHMARIE--------ENLALLR
BIOD_NITMU       LLVVGMRLGCINHALLTAHAVRAAQIPLAGWVANRID-PEMAVFK--------ENVLALE
BIOD_PSEAE       VLVVGVRLGCINHALLSAEAILGDGLALAGWVANVVD-PATSRLE--------ENLATLA
BIOD_PSEA8       VLVVGVRLGCINHALLSAEAILGDGLALVGWVANVVD-PATSRLE--------ENLATLA
BIOD_PSEAB       VLVVGVRLGCINHALLSAEAILGDGLALAGWVANVVD-PATSRLE--------ENLATLA
BIOD_PSEA7       VLVVGVRLGCINHALLSAEAILGDGLALAGWVANIVD-PATSRLE--------ENLATLA
BIOD_CELJU       VLVVGMRLGCINHALLTVEAIRNDGLPLVGWVANVLD-ADMPVLE--------ENIASLA
BIOD_CHRSD       ILVVGLELGCLNHARLSAEAIRADGLPLAGWVGNLID-PGLSFDEVADEACYRDNLATLE
BIOD_MARHV       ILVVPLQLGCINHAMLSAEAIRADGLVVAGWVGNHPE-EQVMSCE-------QDTLNYLS
BIOD_MANSM       VLVVGIKEGCMNHALLTVQSIEQMGLPLLGWVANRIN-PMLGHYA--------EIIEDLS
BIOD1_PASMU      VLVVGIKEGCLNHALLTVESIQQKGLPLLGWIANRIN-PCLGHYA--------EIIDLLS
BIOD1_HAEIN      VLVVGIKDGCVNHALLTVKVIQQLGVPLLGWIANRIN-PLLSHYA--------EIVDLLV
BIOD_ACTSZ       IVAVGIKEGCINHALLTVQSVEKMGLPVLGWIANRIN-PGLSHYA--------EIIDVLS
BIOD1_HAEDU      VLVVGIKEGCVNHALLTAQAIQQQGVNLIGWVANRIN-PCLRHYA--------ELIELLS
BIOD_BUCAI       IIIIAIKLGCINHAILTEKAIISDQIKCGGWIANNIF-PKDKYNM--------HYIQTLL
BIOD_BUCA5       IIIIAIKLGCINHAILTEKAIISDQIKCGGWIANNIF-PKDKYNM--------HYIQTLL
BIOD_BUCBP       ILVIGIKLGCINHAILTQKAILSSGLEFFGWIANYLL-PTDTYNL--------THIDILK
BIOD_WIGBR       ILVVGIKLGCINHALLTIESIKNSNAIILGWIANHLE-KDLINKN--------DYFKYLK
BIOD_FRATF       LLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCND-SNIKYID--------EQINTIE
BIOD_FRATH       LLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCND-SNIKYID--------EQINTIE
BIOD_FRATO       LLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCND-SNIKYID--------EQINTIE
BIOD_FRATM       LLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCND-SNIKYID--------EQINTIE
BIOD_FRATT       LLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCND-SNIKYID--------EQINTIE
BIOD_FRAT1       LLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCND-SNIKYID--------EQINTIE
BIOD_FRATW       LLVSAIKVGCINHTLLTINELNRHNIKLAGWIANCND-SNIKYID--------EQINTIE
BIOD_FRATN       ILVSAIKVGCINHTLLTINELGRHNIKLAGWIANCND-SNIKYTD--------EQISTIE
BIOD_FRAP2       ILVSAIKVGCINHTLLTINELNRHNIKLAGWIANCND-SNIKYIN--------EQINTIE
BIOD_LEGPC       ILVVGMKLGCINHTLLTQEVLEINKIKCQGWIANCLD-QDMLMLD--------ENISTLE
BIOD_LEGPA       ILVVGMKLGCINHTLLTQEVLEINKIKCQGWIANCLD-QDMLMLD--------ENINTLE
BIOD_LEGPL       ILVVGMKLGCINHTLLTQEVFEINKIKCQGWIANCLD-QDMLMLD--------ENISTLE
BIOD_LEGPH       ILVVGMKLGCINHTLLSQEVLEINKIKCQGWIANCLD-QDMLMLD--------ENISTLE
BIOD_BRUAB       ILCARAALGTINHTLLSLEAMRSRDIPVLGVAFISEA---------------NEDT---E
BIOD_BRUA2       ILCARAALGTINHTLLSLEAMRSRDIPVLGVAFISEA---------------NEDT---E
BIOD_BRUA1       ILCARAALGTINHTLLSLEAMRSRDIPVLGVAFISEA---------------NEDT---E
BIOD_BRUME       ILCARAALGTINHTLLSLEAMRSRDIPVLGVAFIGEA---------------NEDT---E
BIOD_BRUMB       ILCARAALGTINHTLLSLEAMRSRDIPVLGVAFIGEA---------------NEDT---E
BIOD_BRUC2       ILCARAALGTINHTLLSLEAMRSRDIPVLGVAFIGEA---------------NEDT---E
BIOD_BRUO2       ILCARAALGTINHTLLSLEAMRSRDIPVLGVAFIGEA---------------NEDT---E
BIOD_BRUSU       ILCARAALGTINHTLLSLEAMRSRDIPVLGVAFIGEA---------------NEDT---E
BIOD_BRUSI       ILCARAALGTINHTLLSLEAMRSRDIPVLGVAFIGEA---------------NEDT---E
BIOD_AGRFC       ILCARTALGTINHTLLSLEALRHRAIPVQGVVFIGDE---------------DREN---E
BIOD_OCHA4       ILCARTGLGTINHTLLSLEALNRRNIPVLGIAFVGDH---------------QPDT---E
BIOD_BRADU       VLCARTGLGTINHSLLSIEALRKRQIRILGIAFIGER---------------NAET---E
BIOD_BRASB       VLCARTSLGTINHSLLSLAALRSRGIAVLGVAFIGDA---------------NADS---E
BIOD_NITHX       VLCARTALGTINHSLLSVEALRARGVAMLGIAFIGEE---------------NVES---E
BIOD_NITWN       VLCARTALGTINHSLLSIEALRARDVAILGVSFIGEE---------------NVET---E
BIOD_RHOPS       VLCARTTLGTINHTLLSIEALRARAIPLLGIAFIGDE---------------NAES---E
BIOD_RHOP2       VLCARTTLGTINHTLLSIEALRARAIPLLGVAFIGDE---------------NVES---E
BIOD_RHOP5       VLCARTTLGTINHSLLSIEALRARDIELLGIAFIGEA---------------HAES---E
BIOD_RHOPA       VLCARTSLGTINHTLLSIEAIRARDIPLLGVAFLGDE---------------NLDS---E
BIOD_RHOPT       VLCARTSLGTINHTLLSIEAIRARDIPLLGVAFLGDE---------------NLDS---E
BIOD_OLICO       VLCARTTLGTINHSLLSIEAVKRRDIPLVGIAFIGED---------------YAES---E
BIOD_RHOPB       VLCARTALGTINHALLSVEALRRRGIPICGIAFIGDD---------------HRDS---E
BIOD_SPHWW       VVVARTALGTINHSLLTIEALRARDIPILGIAFIGDP---------------QEES---E
BIOD_NOVAD       VIVARTGLGTINHSLLTIEALRARGVPIHGVAFVGDA---------------VEDS---E
BIOD_SPHAL       IVCARTSLGTINHSLLTIEALKRRDVPIHGVVFIGDA---------------VEDS---E
BIOD_MAGSA       VVVARSGLGTINHTLMTLEMLRRRRVPLLGVVMNGQK---------------NPAN---R
BIOD_CHLAB       VLVSKAYLGSINHTCLTLEAMRARNLSILGIILNQYP---------------KEE----E
BIOD_CHLFF       VLVSKAYLGSINHTCLTVEAMRTRNLNILGMVLNQYP---------------KEE----E
BIOD_CHLPN       ILVSQAYLGSINHTCLTVEAMRSRNLNILGMVVNGYP---------------EDE----E
BIOD_CYTH3       ILVSNLYLGSINHTLLTAQELKRRNIRVKGIVFNGPR---------------NEES---E
BIOD_GRAFK       ILVSRHYLGSINHTLLSIEALKSRGIDKIGIIFSGDE---------------HPTT---E
BIOD_CAMJE       ILVAKYYLGSINHILLSIEALKQRNINLLALVMMGKK---------------DIL---QD
BIOD_CAMJR       ILVAKYYLGSINHILLSIEALKQRNINLLALVMMGKK---------------DIL---QD
BIOD_CAMJJ       ILVAKYYLGSINHILLSIEALKQRNINLLALVMMGKK---------------DIL---QD
BIOD_CAMJ8       ILVAKYYLGSINHILLSIEALKQRNINLLALVMMGKK---------------DIL---QD
BIOD_LAWIP       ILVTHSRLGTINHTLLTLQALKSKGIEVVGVIVNGKP---------------NQ---DNC
BIOD_NEOSM       IIVSRSTLGAINHTLLTLEALQAREIKVLGIVINSMC---------------EDFLDYNS
BIOD_LEPBJ       ILVAPVSLGAINQTLLAIEAVQNRKIDLKGIYFIGIP---------------DKTTEDNI
BIOD_LEPBL       ILVAPVSLGAINQTLLAIEAVQNRKIDLKGIYFIGIP---------------DKTTEDNI
BIOD_LEPIN       ILVAPTSLGAINQTLLSIEAIQNRNIDLKGIYFLGIP---------------DKTTEDNI
BIOD_LEPIC       ILVAPTSLGAINQTLLSIEAIQNRNIDLKGIYFLGIP---------------DKTTEDNI
BIOD_RUTMC       VLVIKDELGAVNQALLSINSAQSCGLSISMLVLNQIQ---------------PNFLK-NA
BIOD_VESOH       VLVIKDELGAVNQALLSINAAQHYKLNISMVVLNQIY---------------PNLLG-NE
BIOD_CALBD       ILVTTTKLGTINHTLLTVEFAKAYGLCLKGIIVNMYKNEP-------------DE-DKVI
BIOD_CALS8       ILVTTTKLGTINHTLLTVEFAKAYGLCLKGIIVNMYKNEP-------------DE-DKVI
BIOD_CLOB1       IVVADAGLGTINSTILTLQYMKEKNISVKMILLNNYNHKD-------------IIHIENK
BIOD_CLOBH       IVVADAGLGTINSTILTLQYMKEKNISVKMILLNNYNHKD-------------IIHIENK
BIOD_CLOBJ       IVVADAGLGTINSTILTLQYMKEKNISVKMILLNNYNHED-------------IIHIENK
BIOD_CLOBK       IVVADAGLGTINSTILTLQYMKEKNISVKMILLNNYNHED-------------IIHIENK
BIOD_CLOBL       IVVADAGLGTINSTILTLQYMKEKNISVKMILLNNYNHED-------------IIHIENK
BIOD_CLOB6       IVVADAGLGTINSTILTLQYIKEKNISVKMILLNNYNHED-------------IIHIENK
BIOD_CLOBM       IVIADAGLGTINNTILTLQYMKKKNIPIKMILLNNYNHEN-------------IIHIENK
BIOD_CLOBA       ILVSSSGLGSINGTILTLEYIKKHNITVNSIILNNYDKNN-------------IIHIDNR
BIOD_CLOBB       ILVSPSGLGSINGTILTLEYIKKHNLVVNSIILNNYDKSN-------------IIHIDNK
BIOD_CLOTE       IIVSNSELGTINSTMLTVEYAKQNHINIKAIILNNFDSNN-------------IIHIDNK
BIOD_CLOPE       ILVSNSGLGTINYTVLTVSYLRNLGLKVKGIILNKFNKSD-------------IIHRDNK
BIOD_CLOP1       ILVSNSGLGAINHTVLTVSYLRNLGLKVKGIILNKFNKSD-------------IIHRDNK
BIOD_BRAHW       LIIADAGLGTINSAVLTIEYMRSKNLKVNGVILNRFEMAN-------------EMHDDNK
BIOD_CLOK5       IIVASAGLGTINHTVLTAKYIENLGIKIEGIIINKY-EKD-------------LFYDDNI
BIOD_CLOK1       IIVASAGLGTINHTVLTAKYIENLGIKIEGIIINKY-EKD-------------LFYDDNI
BIOD_CLONN       LLVASAGLGSINHTVLTVKYIENAGLNIKGIIVNGYDENN-------------ICHRDNV
BIOD_CLOAB       ILVCRAGLGTINHTVLTVSYLKNNGIEVKGIIVNQYEENR-------------LC-KDNI
BIOD_ANOFW       IIVARASVGTINHTVLTVEYAKAFGLQIAGIIMNGFSTPKN------------EIEQENI
BIOD_BACHD       ILVSALRVGTINHTVLSIEAMKARNLPIAGIIFNQLQIGNP------------VIEQSNV
BIOD_LYSSH       VVVTRTALGTINHTLLTLEALTTRKIEVLGLVFNGDMGSR--------------MEQDNI
BIOD_LYSSC       VLVTRTTLGTINHTLLTMEALQSRQIDVLGIVFNGDTGSM--------------MEQDNI
BIOD_FUSNN       VLVCGTKVGAINHTMLTLNALDTMGIKLHGLVFNNYRGQF--------------FEDDNI
BIOD_GEOKA       ILVSLSSLGAIHHAVTTAAYADAQGIRLLGLMFNQFQEQE-------------IIHQNNV
BIOD_GEOSW       IIVSLAGLGAIHHTVTTVSYAQQQGIRILGLIFNQFNAES-------------IIHVNNI
BIOD_STAES       VSVLPSKLGAINDAIVHQKYIDHQELPPNVLIMNNYT-DS-------------AIEQDNL
BIOD_STAEQ       VSVLPSKLGAINDAIVHQKYIDHQELPPNVLIMNNYT-DS-------------AIEQDNL
BIOD2_HAEIN      ILVTSGKLGSINHTLLSLEACRTRGISVLSVMYNGYPEY-D------------LLLVKK-
BIOD2_PASMU      ILVTSGKLGSINHTLLSLQVLNSKRVSVHAVIYNLYPET-D------------QVISQET
BIOD2_HAEDU      ILVTSAKLGSINHTLLSLIVCQQHKIEMEAVIYNTYPLE-D------------EKIAKST
BIOD_NEIG1       ILVTSGRLGSINHTLLSFVVLKQYGIRLHSLVFNHIHDSRD------------AHVAQDS
BIOD_NEIG2       ILVTSGRLGSINHTLLSFVVLKQYGIRLHSLVFNHIHDSRD------------AHVAQDS
BIOD_NEIMF       ILVTSGRLGSINHTLLSFAALKQYGIRLHSLVFNHIHDSRD------------AHIAQYS
BIOD_NEIMB       ILVTSGRLGSINHTLLSFAALKQYGIRLHSLVFNHIHDSRD------------AHIAQDS
BIOD_NEIM0       ILVTSGRLGSINHTLLSFAALKQYGIRLHSLVFNHIHDSRD------------AHIAQDS
BIOD_NEIMA       ILITSGRLGSINHTLLSFAALKQYGIRLHSLVFNHIHDSRD------------AHVAQDS
BIOD_CHLTE       VLVSASRLGSINHTLLSLEACARRGIPVRAIVYNRYFEADE------------RIAANTR
BIOD_HELPY       LLISHDNLGLINDCLLNDFLLKSH-QLDYKIAINLKGN-NT------------AFHSISL
BIOD_HELPJ       LLISHDNLGLINDCLLNDFLLKSY-QLDYKIAINLRGN-NT------------AFYSVSL
BIOD_HELPS       LVISHDNLGLINDCLLNDFLLKSH-QLDYKIAINLREN-NA------------AFHSVSL
BIOD_WOLSU       VLVISGKLGGINEALLSLEALQHR-QMSYTLVLNLWEEEKR------------SFEEISA
BIOD_SULNB       LLVTPGRLGCINDTLLSMEALKSR-NIAFDWCINLYED-AE------------SFTEVTQ
BIOD_ANAD2       LVVARAGLGTVNHTALTVEALERRGLAVAGIVLNRTGPEDD------------PSVPLNA
BIOD_ANASK       LVVARAGLGTVNHTALTVEALERRGLAVAGIVLNRTGPEDD------------PSVPLNP
BIOD_ANADE       LVVARAGLGTVNHTALTVEALERRGLPIAGIVLNRTGPEDD------------PSVPLNA
BIOD_ANADF       LVVARAGLGTVNHTALTVEALRARGLVLTAIVLNQACETDD------------PSVPYNP
BIOD_AKKM8       LLVIGNKLGAINHALLTLNAIKERGLECLGIVFNNVKDEWD------------TACVTNR
BIOD_BACVZ       VIVTRPDLGTINHTYLTVEYAKNMGIEVLGIIINGVRSRPG------------LDEKTNP
BIOD_BACLD       VIVARPNLGTINHTYLTAQYAKQMGIRVIGIVINGISSRPG------------LDEQTNP
BIOD_BACSU       IIVARPRLGTINHTFLTVKYAESMGLPIAGIIINGISDSPD------------EDEKTNP
BIOD_BACNA       IIVARPHLGTINHTFLTVKYAESMGLPIAGIIINGISDSPD------------EDEKTNP
BIOD_BACAN       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVQENK
BIOD_BACAA       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVQENK
BIOD_BACAC       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVQENK
BIOD_BACC0       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVQENK
BIOD_BACHK       IVVARPTLGTVNHTVLTIAYAKANGLTVAGVILSGCKECEM------------ERVQENK
BIOD_BACC3       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVQENK
BIOD_BACAH       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVQENK
BIOD_BACCZ       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVQENK
BIOD_BACCR       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVQENK
BIOD_BACC4       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVKENK
BIOD_BACC2       IVVARPTLGTVNHTVLTIAYAKAHGLTVAGVILSGCKECEM------------ERVQENK
BIOD_AQUAE       LIVGRAGLGTINHTFLTWYYAKATGLEVIGIILNGFTGED-------------VSERTNP
BIOD_HYDS0       LVVARAYLGTLNHSFLTYFYLKSKDIKPLGFVLNGFDYEE-------------PSQYSNA
BIOD_METJA       VVVSRPNLGTINHTLLTVEHLRNKGINVRGVIINCITDLSEV-----------LYYEKTF
BIOD_META3       IIVSRPDLGTINHTLLTIEHLRNKGILVKGVIINCINELDTV-----------LHYEKTF
BIOD_METVS       IVVSRPNLGTINHTILTVDFLRKKGITVLGVIINCITDVSKV-----------PYYEETF
BIOD_UNCTG       IVVARFGLGTLNHTLLTVEKLKRDRQKILGVILSGKKNNNDV-----------SVKSNAL
BIOD_THEYD       ILVTRPTLGTINHTLLTLEALKNKKISVKGYIINFSEPAKND-----------IAEKTNP
BIOD_ACICJ       VLVAGGYLGTISHTLCAVEALRARGIAIAAVVINPMEP--------------LPVPVERT
BIOD_METNO       LLVSGSYLGAISHALTAIETLHHHAVDLRAVVVSETPG--------------APTPPETV
BIOD_CAUVC       LLVAGSYLGTASHLLTALEVLRARGLSIAAIVVSESLD--------------APDLDQTL
BIOD_CAUVN       LLVAGSYLGTASHLLTALEVLRARGLSIAAIVVSESLD--------------APDLDQTL
BIOD_CAUSK       LLVAGSYLGTISHVLTALVALRAAKVRVAAVVISESLD--------------APDLDQTA
BIOD_PHEZH       ILVGGSYLGAISHTLTALEVLRTRSLTIAAVVVSQSADPE------------APDFAETV
BIOD_CORGL       VIVTSTGLGSLNAAELSVEAANRRGLTVLGVLGGSIPQNP------------DLATMLNL
BIOD_CORGB       VIVTSTGLGSLNAAELSVEAANRRGLTVLGVLGGSIPQNP------------DLATMLNL
BIOD_CORDI       IVVTNMALGSLNAAELTVEAAQRRGLKVLGLIGGSMPKNP------------DLATSLNV
BIOD_COREF       VLVTSLGLGSLNAAELSVQAARTAGVEVLGLIGGSASPDP------------GLAEQLNH
BIOD_CORK4       IVVCSTGLGSLNEAELTVEAATRRGLTVLGLIGGSIPDSP------------DLATRCNK
BIOD_FRACC       LVVTAAGLGALNDTALTLEALAHRGLDLAGVVVGSWPAEP------------DLACRCNL
BIOD_FRASN       LVVTTAGLGTLNATALTLEVMANRGLDLAGIVVGSWPVEP------------DLAARSNI
BIOD_STRAW       LVVASAGLGTLNTTELTARELRRREIGFAGVVIGSWPESP------------DLASRCNL
BIOD_STRCO       LLVTSAGLGTLNTTELTARELRSRGLELPGLVIGSWPGAP------------DLAARCNL
BIOD_SACEN       LVVAHGGLGTLNAAALTAEALRARGVECAGVVVGSWPSAP------------DLACRCNL
BIOD_NOCFA       LVVAAAGLGTLNHTELTIRALDAAGVRCAGVVIGAWPAEP------------DLASVCNR
BIOD_RHOJR       VVVAAAGLGTLNHTELTIRALSAAGLACAGTVIGSWPDEP------------GLAERCNL
BIOD_RHOE4       VLVVASGLGTLNHTALTVEALGASGVECAGLVIGSWPQEP------------DLAERCNR
BIOD_MYCBO       LVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPP------------GLVAASNR
BIOD_MYCTU       LVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPP------------GLVAASNR
BIOD_MYCTA       LVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPP------------GLVAASNR
BIOD_MYCBP       LVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPP------------GLVAASNR
BIOD_MYCBT       LVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPP------------GLVAASNR
BIOD_MYCMM       LVVVAAGLGTLNHTALTLEALAAQKVSCAGLVLGSWPAHP------------GLVESSNR
BIOD_MYCUA       LVVVAAGLGTLNHTALTLEALAAQKVSCAGLVLGSWPAHP------------GLVESSNR
BIOD_MYCLE       LVTVSVELGTLNHTALTLEALTTRGVACAGLVIGSWTGRP------------GAVQISNR
BIOD_MYCLB       LVTVSVELGTLNHTALTLEALTTRGVACAGLVIGSWTGRP------------GAVQISNR
BIOD_MYCA1       LVVVRPALGTLNHTALTLEALAAQGLSCAGLVIGAWPEHP------------GPVETSNR
BIOD_MYCGI       LTVVAPGLGTLNHTVLTLEALAHRDVRSEGLVIGSWPAQP------------GVAEIDNR
BIOD_MYCVP       LTVVAPGLGTLNHTVLTLEALAHRQISSAGLVIGAWPAQP------------GVAEIDNR
BIOD_MYCSK       LVVVAPGLGTLNHTALTLESLAAQHVPCAGLVIGAWPAQP------------GAAEIDNR
BIOD_MYCSS       LVVVAPGLGTLNHTALTLESLAAQHVPCAGLVIGAWPAQP------------GAAEIDNR
BIOD_MYCSJ       LVVVAPGLGTLNHTALTLESLAAQQVPCAGLVIGAWPAQP------------GAAEIDNR
BIOD_MYCS2       LIVVSPGLGTLNHTALTLEALAAHGLSCAGLVIGAWPAEP------------GVAELDNR
BIOD_MYCA9       LVVTTADLGTLNHTALTLEALAVQSVPCAGLVVGSFPAEP------------DLAQRLNR
BIOD_CROS5       VLVVPVKLGAIAQTVANVALARQYKVNLKGIIFSCPRPLSHE----------EIVNFAPI
BIOD_RIPO1       VLVVPVKLGAIAQAVANVALARQTQVNLKGIILSCSHPLSPQ----------ELSDWAPM
BIOD_GLOC7       VLVVPVKLGAIAQAVANVALARQHQIKLKGIILNCSQPISEE----------QLKDWTPI
BIOD_MICAN       LLVVPVKLGAISQTVANIALAEQKKVNLGGIILNCLEPRTET----------EIEQLTPI
BIOD_CYAP4       LLVVPVKLGAIGQAVANVALARQAGVNLKGIVLNCVQPRSET----------EIAQWAPA
BIOD_SYNY3       ILVVPVQLGAMGQAIAQVALARQTKVKLKGLVLSCASPEAEG----------KVEDWATP
BIOD_GLOVI       LLVAPLRLGVVGQLVAHTGFARAQNLDLSALVLSEIEPVSAE----------QRAQWADV
BIOD_NITMS       VIVTRSKVGTVNHTIMTIQMCQKYKIPIKGIIINDFDDDG-------------YPIKNLK
BIOD_RHOBA       LLVAPDRLGVLHHVISTSRAAESAGIPIAGLILNRMDDHAD------------ESTQTNA
                 :       *                                                   

BIOD1_ECOLI      RMIP----APLLGEIPWLAENPENA-----ATGKYINLALL-------------------
BIOD1_ECO57      RMIP----APLLGESPWLAENPENA-----ATGKYINLALL-------------------
BIOD_PSEVU       RMLP----APFLGEIPWLENVAPES-----DIGHWLDLSALGSASSTGKAADRPAV----
BIOD1_SALTI      RVIP----APLLGEIPWLGVSPSQA-----ATGQYLDLSPLERA----------------
BIOD1_SALTY      RVIP----APLLGEIPWLGVSPSQA-----ATGQYLDLSPLERA----------------
BIOD_SERMA       RMLP----RRCWAKSRTCR-RPERA-----PLGQYLDISLLAQ-----------------
BIOD1_YERPE      RMIT----APLLGIIPYLSDIEENPVTTRRDLGHYLDLTVLRAAEREAVNM---------
BIOD_YERPG       RMIT----APLLGIIPYLSDIEENPVTTRRDLGHYLDLTVLRAAEREAVNM---------
BIOD_BAUCH       NRLD----APLIGDIPWLSNIPVAL------LAKYINLAELS------------------
BIOD_ALIF1       DKMP----APKLGEIPYMPSVKRKN------MGKYIHLEALDN-----------------
BIOD_ALIFM       DKMP----APKLGEIPYMPSVKRKN------MGKYIHLEALDN-----------------
BIOD_ALISL       DKMP----APKLGEIPYMPSIKRKS------MGKYINLDSLMEI----------------
BIOD_VIBCB       DRLD----APKLGEIPYIPSAKRKD------LGKFINVEPLLNA----------------
BIOD_VIBPA       SRID----APKLGEIPYIPSAKRKE------LGKYINVEPLLNID---------------
BIOD_VIBVU       ERLE----VPKLGEIPYIPSAKRKD------LGKYINADVLLEL----------------
BIOD_VIBVY       ERLE----VPKLGEIPYIPSAKRKD------LGKYINADVLLEL----------------
BIOD_VIBCH       GRLG----TPKLGEIPYMPKAKRQE------LGKFIQLDHLLEPDTVA------------
BIOD_PHOPR       KNLP----GKKMGEIPYMPALKNVT------YQSILI-----------------------
BIOD2_ECOLI      KKLP----APLIGELPYLPRAEQRE------LGQYIRLAMLRSVLAVDRVTV--------
BIOD2_ECO57      KKLP----APLIGELPYLPRAEQRE------LGQYIRLAMLRSVLAVDRVTV--------
BIOD2_SALTI      KKLP----APLIGELPYLPRAEQRE------LGQYIRLSMLGSVLAVDRIMA--------
BIOD2_SALTY      KKLP----APLIGELPYLPRAEQRE------LGQYIRLSMLGSVLAVDRIMA--------
BIOD2_YERPE      DRLA----APQLGQLPYLPRPEEKP------LAKYLDLTAISG-----------------
BIOD_YERPS       DRLA----APQLGQLPYLPRPEEKP------LAKYLDLTAISG-----------------
BIOD_AERHH       GLLP----APFLGEIPFVNNPLEAD------LRGRLDISPLL------------------
BIOD_AERS4       GLLP----APFLGEIPFVNNPLEAD------LRGRLDISPLL------------------
BIOD_TOLAT       SLLP----APFMGEIPYINKPDEQD------LGKYLDISTLL------------------
BIOD_ALTMD       AMLP----EPLLAEIPYQTGIEA---------GTLLSAIEQLS-----------------
BIOD_PSEHT       LRLP----FPILAISPYSEQTPKLQ-----IYKTLLENFALNT-----------------
BIOD_IDILO       ELLD----EKELASIPYLPGWTE---------EDLSIYFHK-------------------
BIOD_BURCM       DWLAREHGAPLLGRIPHMSPAAAES------AAAMLDIAALVETLRAAQH----------
BIOD_BURA4       DWLAREHRAPLLGRIAHLRPAIPES------AAAMLDIAALVDTLRRAQH----------
BIOD_BURVG       DWLAREHRAPLLGRVAHLRPAAPES------AAAMLDIAALVDTLRRAQH----------
BIOD_BURCA       DWLAREHRAPLIGRIAHMTPAAPES------AAAMLDIAALVESLRTARR----------
BIOD_BURCH       DWLAREHRAPLIGRIAHMTPAAPES------AAAMLDIAALVESLRTARR----------
BIOD_BURCC       DWLARERRAPLIGRIAHMTPAAPES------AAAMLDIAALVESLRTARH----------
BIOD_BURCJ       DWLAREHRAPLVGRIAHMTPAAPES------AAAMLDIAALVESLRAARP----------
BIOD_BURM1       DWLAREHRAPLLGRIAHMAPADPES------AAATLDIAALVDTLRAAQR----------
BIOD_BURL3       DWLAREHGAPLLGRIPHMSPAAPES------AAAMLDIAALVETLRTAQP----------
BIOD_BURMA       AWLEREHRAPLLGALAHMSPPSPDA------ASHALDVNLLLNALRAAAPR---------
BIOD_BURM9       AWLEREHRAPLLGALAHMSPPSPDA------ASHALDVNLLLNALRAAAPR---------
BIOD_BURM7       AWLEREHRAPLLGALAHMSPPSPDA------ASHALDVNLLLNALRAAAPR---------
BIOD_BURMS       AWLEREHRAPLLGALAHMSPPSPDA------ASHALDVNLLLNALRAAAPR---------
BIOD_BURPS       AWLEREHRAPLLGALAHMSPPSPDA------ASHALDVNLLLNALRAAAPR---------
BIOD_BURP0       AWLEREHRAPLLGALAHMSPPSPDA------ASHALDVNLLLNALRAAAPR---------
BIOD_BURP1       AWLEREHRAPLLGALAHMSPPSPDA------ASHALDVNLLLNALRAAAPR---------
BIOD_BURP6       AWLEREHRAPLLGALAHMSPPSPDA------ASHALDVNLLLNALRAAAPR---------
BIOD_BURTA       AWLEREHGAPLLGDIAHMSPPSPEA------ASRSLDVNRLLGALRETAPR---------
BIOD_PARP8       DRLARQYDAPLLGSVPHLSPASPDV------AATHLDTTRLLHALRTAPR----------
BIOD_AROAE       RRID----APLLGVVPHVAGADPAQ------VAASLRLPG--------------------
BIOD_RALPJ       RWIN----APHLGTIPRLPHADARL------AAAHVDIAPLLARTAETRR----------
BIOD_RALSO       RWID----APHLGTIPRLPRPDARL------AASHVDIAPLLAR----------------
BIOD_JANMA       ARLS----APLLGCVPRLAAPLPAA------AAAYLDFSCLPNWPKA-------------
BIOD_XANAC       QRLA----MPYWGRIPWRPGADAAT------QAHGLQLPR--------------------
BIOD_XANC5       QRLA----MPCWGRIPWRPGADAAA------QAHGLQLPR--------------------
BIOD_XANOM       QRLA----MPCWGRIPWRPDAEAAA------QAQGLQLPR--------------------
BIOD_XANOP       QRLA----MPCWGRIPWRPDAEAAA------QAQGLQLPR--------------------
BIOD_XANCP       QRLA----MPCWGRIPWRPNAQAEA------LAQHIRLPQ--------------------
BIOD_XANCB       QRLA----MPCWGRIPWRPNAQAEG------LAQHIRLPE--------------------
BIOD_XANC8       QRLA----MPCWGRIPWRPNAQAEG------LAQHIRLPE--------------------
BIOD_XYLFM       QRLP----IPYWGHLPHIPPGINPA------TLATRLHPQGD------------------
BIOD_XYLFT       QRLP----IPYWGHLPHIPPGINPA------TLATRLHPQGD------------------
BIOD_XYLFA       QRLP----IPYWGHLPHIPPGINPA------TLAARLHPQGD------------------
BIOD_NITMU       QRLD----CPLLGILPYDQNHDARD------LSSLLDIARIGMSS---------------
BIOD_PSEAE       ERLP----APCLGRVPRLEEATPAA------VAAHLDLRPLGIGL---------------
BIOD_PSEA8       ERLP----APCLGRVPRLEEATPAA------VAAHLDLRPLGIGL---------------
BIOD_PSEAB       ERLP----APCLGRVPRLEEATPAA------VAAHLDLRPLGIGL---------------
BIOD_PSEA7       ERLP----APCLGRVPRLADAGPAA------VAAHLDLRPLGIGL---------------
BIOD_CELJU       QRIP----APCLGVVPRLSMASADA------ASAHLDLTPLLDA----------------
BIOD_CHRSD       RTLE----APCLGIVPRLAAATPDAR-----AHAAADYLTLPGDA---------------
BIOD_MARHV       THLG----APCLGVLPWLENTDTAEMPAI--LSRYLNITPLIEN----------------
BIOD_MANSM       KRIK----APLLGKIPYMHKPETQE------LGHYITDID-RLSYMKTEILK--------
BIOD1_PASMU      EKID----APLLGQIPYLHKPEEQD------LARYIHNLD-RLTYMETVLAD--------
BIOD1_HAEIN      EHID----APLLGKIPYLHKPEEQE------LGHYLTNID-RLMYMQTEFIK--------
BIOD_ACTSZ       SKIA----APLLGCIPYIHKPETQD------VGKFLTNTE-QLRHIQTLLAK--------
BIOD1_HAEDU      KKIS----APLLGQIPYIAQPHKKD------LTSYIENPDPLLAYFQK------------
BIOD_BUCAI       NYIK----SPFLGVVPYFKNK------------NRINFKKIKIKLPK-------------
BIOD_BUCA5       NYIK----SPFLGVVPYFKNK------------NRINFKKIKIKLPK-------------
BIOD_BUCBP       KNMK----SPYLGCIAYTPNIY-----------NQIHHIPITIKLPLQN-----------
BIOD_WIGBR       KVIK----YPLIGKIPFIKNK------------KNFSNLHKYIFLKKVI-----------
BIOD_FRATF       ELSG----YKCSAKISRNADYLDFI------DLSKILI----------------------
BIOD_FRATH       ELSG----YKCSAKISRNADYLDFI------DLSKILI----------------------
BIOD_FRATO       ELSG----YKCSAKISRNADYLDFI------DLSKILI----------------------
BIOD_FRATM       ELSG----YKCSAKISRNADYLDFI------DLSKILISPEENE----------------
BIOD_FRATT       ELSG----YKCSAKISRNADYLDFI------DLSKILISPEENE----------------
BIOD_FRAT1       ELSG----YKCSAKISRNADYLDFI------DLSKILISPEENE----------------
BIOD_FRATW       ELSG----YKCSAKISRNADYLDFI------DLSKILISPEENE----------------
BIOD_FRATN       ELSG----YKCSTKISQNADYLDFI------DLSKILISPEENE----------------
BIOD_FRAP2       EISG----YTCSAKISQNADYLDFI------DLSKILISPEENE----------------
BIOD_LEGPC       AKLK----YPLLARTNYGGKISDIC------LSSL-------------------------
BIOD_LEGPA       AKLK----YPLLARTNYGGKISDIC------LSSL-------------------------
BIOD_LEGPL       AKLK----YPLLARTNYGGKISDIC------LSSL-------------------------
BIOD_LEGPH       AKLN----YPLLARTNYGGKISDIC------LSSL-------------------------
BIOD_BRUAB       TTIAHLGRVKRLGRLPL--LDDLSPEKLHHSFARNFHIDDFAGVAR--------------
BIOD_BRUA2       TTIAHLGRVKRLGRLPL--LDDLSPEKLHHSFARNFHIDDFAGVAR--------------
BIOD_BRUA1       TTIAHLGRVKRLGRLPL--LDDLSPEKLHHSFARNFHIDDFAGVAR--------------
BIOD_BRUME       TTIAHLGRVKRLGRLPL--LDDLSPEKLHHSFARNFHIDDFAGVAR--------------
BIOD_BRUMB       TTIAHLGRVKRLGRLPL--LDDLSPEKLHHSFARNFHIDDFAGVAR--------------
BIOD_BRUC2       TTIAHLGRVKRLGRLPL--LDDLSPEKLHHSFARNFHIDDFAGVAR--------------
BIOD_BRUO2       TTIAHLGRVKRLGRLPL--LDDLSPEKLHHSFARNFHIDDFAGVAR--------------
BIOD_BRUSU       TTIAHLGRVKRLGRLPL--LDDLSPEKLHHSFARNFHIDDFAGVAR--------------
BIOD_BRUSI       TTIAHLGRVKRLGRLPL--LDDLSPEKLHHSFARNFHIDDFAGVAR--------------
BIOD_AGRFC       RVITDIGAVRRLGRLPR--LPELTPEALHQAFAQHFNLADFLEVPA--------------
BIOD_OCHA4       KIIPELSGVRRLGRLPR--LAKLDPDALRQAFREHFDINIFGGASE--------------
BIOD_BRADU       SAVCEIGRVRWLGRLPW--LVPLTNDRLQAAFKDSFVSSDFLNL----------------
BIOD_BRASB       ETICRLGAVKRLGRLPW--LPELTARSLQHAVAAEFRRADFAP-----------------
BIOD_NITHX       RIITEMGKVRRLGRLPH--VAPLTRDTLREAFADGFAIDDFLKGPA--------------
BIOD_NITWN       GIIIDMGRVKRLGRLSY--VTPLTRATLRQAFADGFDIGDFVKERAR-------------
BIOD_RHOPS       RIIVELGRARRLGRLPH--LAQLTTDALRAAFARNFNTADFLKETA--------------
BIOD_RHOP2       RVIVQIGRVPRLGRLPR--LVEVTADALRAAFAQNFNTDDFLKDPAS-------------
BIOD_RHOP5       NIIAAMGQVRRLGRLPH--LASLTTDSLKAAFADAFNIGDFFKDATA-------------
BIOD_RHOPA       QIIVELGHTRRLGRLPR--LERLDAAALRAGFAAAFEPRDFLGDAP--------------
BIOD_RHOPT       QIIVELGHTRRLGRLPR--LERLDAAALRAAFAAAFEPRDFLGDAP--------------
BIOD_OLICO       RIICKIGGVRHLGRLPP--LSPLTPEALRAAFITSFNLSDFTA-----------------
BIOD_RHOPB       DIICAIGQVRRLGRLPR--LDPLDRHTLQAAFKTSFNREDFTS-----------------
BIOD_SPHWW       RTIAAIGGVRRLGRLPR--LDPLDAGTLAAAFAAAFSPEDFAP-----------------
BIOD_NOVAD       ATICAMGEVRRLGRLPM--LGQLDRPALAQAFAEGFRVEDFA------------------
BIOD_SPHAL       AIIADVSGVRRLGRLPV--VAPLTSENLAAAFGANFDIADFR------------------
BIOD_MAGSA       QAIEHFGGVRVLAEIQP--LPAVTAATIAGLPPPTFTCPGDP------------------
BIOD_CHLAB       DWLLRTTGLPFLGRLNY--EKSISKATVQNYANLWKETWKYRDTLLC-------------
BIOD_CHLFF       DWLLNMTGIPYLGRLNY--ENIISKETVKNYANLWKETWEDREAKLCS------------
BIOD_CHLPN       HWLTQEIKLPIIGTLAK--EKEITKTIISCYAEQWKEVWTSNHQGIQGVSGTPSLNLH--
BIOD_CYTH3       RIILKHTGYKVLLHVSP--EEKITKEVVTAYAVKLFDNWYE-------------------
BIOD_GRAFK       AAIKKLGKVKVVGRIEE--EPYFDEMVVKEYAEKFRKRLCEI------------------
BIOD_CAMJE       DFIKNYAKIPIIN------LDFFDENSILNKDFKEQMQEILQLKIP--------------
BIOD_CAMJR       DFIKNYAKIPIIN------LDFFDENSILNKDFKEQMQEILQLKIP--------------
BIOD_CAMJJ       DFIKNYAKIPIIN------LDFFDENSILNKDFKEQMQEILQLKIP--------------
BIOD_CAMJ8       DFIKNYAKIPIIN------LDFFDENSILNKDFKEQMQEILQLKIP--------------
BIOD_LAWIP       DAITWYGKTTILAQFPF--LSTITKTTLRNIPLTQELKQLFIV-----------------
BIOD_NEOSM       KAIAEYGSTEILATFPY--LKEVTRDSILSVQMGDSMKALLESTLKCKNSLL--------
BIOD_LEPBJ       RTITEWSGVTLLGNFFLNSKEKMSRERFQIECLSRFDQCEVIKKMFV-------------
BIOD_LEPBL       RTITEWSGVTLLGNFFLNSKEKMSRERFQIECLSRFDQCEVIKKMFV-------------
BIOD_LEPIN       RTITEWSGVISLGSFFLNSNERISCECFQEECIPKFDLDESIKNILV-------------
BIOD_LEPIC       RTITEWSGVISLGSFFLNSNERISCECFQEECIPKFDLDESIKNILV-------------
BIOD_RUTMC       QAIKQHTDIDINVFNQNH-LASFERKVKKILLVI--------------------------
BIOD_VESOH       KEITQYTNANIVVFNQND-LKSFERQIEKILLADLIK-----------------------
BIOD_CALBD       NTIAKFTNIPILAKVDFINDFPSDVDENKFKNVFKKCFDDRAIMKIMGVFEC--------
BIOD_CALS8       NTITKFTNIPILAKVDFINDFPSDVDENKFKNVFKKCFDDRAIRKIMGVFEC--------
BIOD_CLOB1       GYLSDNLLIPVYTCNKNANNLE-IPVEK-LIEIYEEI-----------------------
BIOD_CLOBH       GYLSDNLLIPVYTCNKNANNLE-IPVEK-LIEIYEEI-----------------------
BIOD_CLOBJ       GYLSDNLLIPVYTCNKNANNLE-IPVEK-LIEIYEEI-----------------------
BIOD_CLOBK       GYLSDNLLIPVYTCNKNANNLE-IPVEK-LIEIYEEI-----------------------
BIOD_CLOBL       RYLSDNLLIPVYTCNKNANKLE-IPVEK-LIEIYEEI-----------------------
BIOD_CLOB6       RYLSDNLPIPVYTCNKNSNNLE-IPAEK-LIEYYEEI-----------------------
BIOD_CLOBM       RYLSDNLSIPVYTCCKDSNNLE-IPVER-LIEFYEEI-----------------------
BIOD_CLOBA       IILEEMTNLPVYICEQYSKDID-IPLKE-LKQFYDFI-----------------------
BIOD_CLOBB       RILEEMTNLPVYTCEQYSEDID-IPLKE-LKQFYDFI-----------------------
BIOD_CLOTE       RVIKELSRLTVYTCGTNVKDCE-ISLED-ILNFYTDV-----------------------
BIOD_CLOPE       KIIKELTGVNNISTVPKIEDIEKYDLNE-LNEVLYGI-----------------------
BIOD_CLOP1       KIIKELTGVNNISTVPKIEDIEKYDLNE-LNEVLYGI-----------------------
BIOD_BRAHW       KMIEEMTGVKIIGIV--IDGILKLDEKN-IETLFE-------------------------
BIOD_CLOK5       GMIEKITKLPIVAKLKNIKDMNDNEIEA-IRIHSEKAFSAENIIKHMEQL----------
BIOD_CLOK1       GMIEKITKLPIVAKLKNIKDMNDNEIEA-IRIHSEKAFSAENIIKHMEQL----------
BIOD_CLONN       KMIKKLTSKDIIALIPRIKD-NNNHKEI-KKVFDDLDY--KKIKKCIGA-----------
BIOD_CLOAB       NMIKKMTGIPILGVMPYINENKKNFIEE-LKYNACNIFKADEIAGLMKEV----------
BIOD_ANOFW       RMIEEMTHVPVIGEIPHMTNFS----------HQQIVWRKEWWQ----------------
BIOD_BACHD       ETIRKLTDTPILGFVPYSPDIHTVLADDKLRRHLYKDWDKRRFKELIHSD----------
BIOD_LYSSH       QTILQYYTLPYMTIPKLEELSDINEYAITGTSLFERLIRRETSIN---------------
BIOD_LYSSC       HTILQYHPLPYAIIPRLQDISELANINITHTTLFERLYGNDPRNN---------------
BIOD_FUSNN       KVVLALSKIKNYLIIK-------NGQKEISDKEIEKFFN---------------------
BIOD_GEOKA       ETIAALLRLPVLAVVPLLPAVSRRELETLAQHWIEQGKAKQLL-EVLGVGV---------
BIOD_GEOSW       ETIKKMLDLPVIATLPSLAKVTKHTMMALAERWLENNEQKQLLQEVLSVAI---------
BIOD_STAES       HTIEKLIHKSVYTLGHQATQESFS--EAFIQRIIGGSNG---------------------
BIOD_STAEQ       HTIEKLIHKSVYTLGHQATQESFS--EAFIQRIIGGSNG---------------------
BIOD2_HAEIN      ------------PNAI--------------------------------------------
BIOD2_PASMU      QHFLRRYLEKYSPNTLFEVMDLISV-----------------------------------
BIOD2_HAEDU      QLYLQQYIKQHFPNTEFLVMDRQ-------------------------------------
BIOD_NEIG1       LNYLQCRLKADFPEAEWMELAKTGAV----------------------------------
BIOD_NEIG2       LNYLQCRLKADFPEAEWMELAKTGAV----------------------------------
BIOD_NEIMF       LSYLKCRLKADFSEAEWMELAKTDAV----------------------------------
BIOD_NEIMB       LSYLKCRLKADFSEAEWMELAKTDAV----------------------------------
BIOD_NEIM0       LNYLKCRLKADFSEAEWMELAKTDAV----------------------------------
BIOD_NEIMA       LNYLKCRLKDSFPEAEWLELAKTDAV----------------------------------
BIOD_CHLTE       EVIAAALKRYGFGEAPVIDLNTSGLSAEPGDLQRILNPPGQ-------------------
BIOD_HELPY       PYIELFNTRSNNPIVIFQQSLKVLMSFALK------------------------------
BIOD_HELPJ       PYIELFNKRSNNPIVIFQQSLKELMSFALK------------------------------
BIOD_HELPS       PYIELFNERSNNPIVIFQQSLKELMSFALK------------------------------
BIOD_WOLSU       PYWKERPERLFRLDSELEELTQTLLSAI--------------------------------
BIOD_SULNB       PFYDAVFPAWWSDKEGMEKFARSL------------------------------------
BIOD_ANAD2       AEIARLTYREPLALLPWEPDIARRARSLGSILGAKIQF----------------------
BIOD_ANASK       AEIARLTHREPIALLPWEPDIARRARSLGSILGAKIQF----------------------
BIOD_ANADE       AEIARLTHREPLALLPWEPDIARRARALGSVLAAKIQF----------------------
BIOD_ANADF       AEIARVTGREPLARLAHVRDIAERQRFLRSRLAGKIQF----------------------
BIOD_AKKM8       SMVEEFSDAPILGELIHGQDYMDMDVLLERLH----------------------------
BIOD_BACVZ       SMIETLCKVPILGITPKLD-HVSSENIQHMIEKHIDVSSFMNLTQMGR------------
BIOD_BACLD       DMIERFCGVPLLGVTPKLE-DASPTQIHHMIKDHVDVSLIMNQMQMGAEK----------
BIOD_BACSU       EMIERLCGVPILGVTPKLA-NVTKETVLHMVKDHINLSLLMNQVGV--------------
BIOD_BACNA       EMIERLCGVPILGVTPKLA-NVTKETVLHMVKDHINLSLLMNQMGV--------------
BIOD_BACAN       VMIEELSGVPVLGLLPFFEGEFTKEEVLESAKEYIMISKLEEFIRNESTVAHTSSN----
BIOD_BACAA       VMIEELSGVPVLGLLPFFEGEFTKEEVLESAKEYIMISKLEEFIRNESTVAHTSSN----
BIOD_BACAC       VMIEELSGVPVLGLLPFFEGEFTKEEVLESAKEYIMISKLEEFIRNESTVAHTSSN----
BIOD_BACC0       VMIEELSGVPVLGLLPFFEGEFTKEEVLESAKEYIMISKLEEFIRNESTVAHTSSN----
BIOD_BACHK       VMIEELSGVPVLGLLPFFEGEFTKEEVLESAKEYIMISKLEEFIRNESTVAHTSSN----
BIOD_BACC3       VMIEELSGVPVLGLLPFFEGEFTKKEVLESAKEYIMISKLEEFIRNESTVAHTSSN----
BIOD_BACAH       VMIEELSGVPVLGLLPFFEGEFTKKEVLESAKEYIMISKLEEFIRNESTVAHTSSN----
BIOD_BACCZ       VMIEELSGVPVLGLLPFFEGEFTKKEVLESAKEYIMISKLEECIRNESTVAHTSSN----
BIOD_BACCR       EMIEELSGVPVLGLLPFFAGEFTKEEVLESAKEHIMISKLEEFIQNESNVAGAPSM----
BIOD_BACC4       EMIEELSGVPVLGLLPFFAGEFTKEEVLESAKEHIMISKLEEFIQNESNVAGAPSM----
BIOD_BACC2       EMIEELSGVPVLGLLPFFEGEFTKEEVLESAKEYIMISKLEEFIQNESNVAGAPSI----
BIOD_AQUAE       QIIEEMTGIKPYKVPRIQDVELPKDIRTGLADYVLSRFTP--------------------
BIOD_HYDS0       YILQDM--IEEHINIWRLDKNPDENQRINLAENIWKSIANF-------------------
BIOD_METJA       ETIEKVGNIEIIGIVKSREDFEIDFEKILR------------------------------
BIOD_META3       ETINRCGNVEIIGIVKNENEYNINFDKIIG------------------------------
BIOD_METVS       KSIEEFGNVEIIGIVNDKKDFYIDLKKLNLP-----------------------------
BIOD_UNCTG       -IIKKITNLSVLELGYNEK---IDLEKNIWIIK---------------------------
BIOD_THEYD       QVLKELVDVPCLGILPYLTELNKDKIGETAIKNFDIEALISL------------------
BIOD_ACICJ       RESLLRHLGATPPPVFI-DDTPDWHAWLDEAARR--------------------------
BIOD_METNO       AEAIARHAGVRVLCVAR-GGGFPAEGLDVVPA----------------------------
BIOD_CAUVC       GLLRAFEHQATILSAPR-AGNWDAGSLVDLLMA---------------------------
BIOD_CAUVN       GLLRAFEHQATILSAPR-AGNWDAGSLVDLLMA---------------------------
BIOD_CAUSK       QALAPFLDGAPLFLAPR-GESWDAGALADHLLAAVAPNAFGGTP----------------
BIOD_PHEZH       ELTRQHAGGVPIFAAPRNGHAAWASALTEALAARRRLRTSAA------------------
BIOD_CORGL       EEFERVTGVPFWGALPEGLSRVEGFVEKQSFPALDAFKKPPAR-----------------
BIOD_CORGB       EEFERVTGVPFWGALPEGLSRVEGFVEKQSFPALDAFKKPPAR-----------------
BIOD_CORDI       AEMEKVTGIPLWGSIAEGAGQLSKEAFCQLVEDLHLPTMWP-------------------
BIOD_COREF       GELTRICRVPLLGVLPAGAGDLLPDDFQAMAQSCLTLPL---------------------
BIOD_CORK4       EDLPVVTGTDVLGYIPEGAGGWSQQRFVQEAPGFFVPDVVGRVTRESD------------
BIOD_FRACC       IDLESLAARPLAGVLPAGAGLLARLEFLAVARASLQPALGGTFRAQEFRARYET------
BIOD_FRASN       VDLELLAARPLAGAVPAGAGLLGTGQFLQIARSSLEPALGGAFNAAEFRRRYAV------
BIOD_STRAW       ADLPAVAGAGLLGAIPAGAGAHSPVGFRAGAPGWLAPRLGGTWDADTFASAFVP------
BIOD_STRCO       ADLPDVSGAPLLGAVPAGAGSLSPAAFRSAAPHWLAPPLDGTWDADAFGDRHGP------
BIOD_SACEN       DDLPEVTGAPLLGVLPEGAAA-DPAAFGDIARAGLAPALGGRWSR---------------
BIOD_NOCFA       EDLPRLTGVPIVGAVPAGVGAWDHDRFTAAVPGWFAPGWSPRLPFNSDSPPSTWGFDTSQ
BIOD_RHOJR       DDLPAVTGVDVVGSVPAGSGRLASASFGAAASTWFDSTWLKSTLTRL-------------
BIOD_RHOE4       EDLVSVSGVPLLGLMPAGSGSESVQEF--AQTAWGALGKSPLAI----------------
BIOD_MYCBO       SALARI--ATVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG---------------
BIOD_MYCTU       SALARI--AMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG---------------
BIOD_MYCTA       SALARI--AMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG---------------
BIOD_MYCBP       SALARI--ATVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG---------------
BIOD_MYCBT       SALARI--ATVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG---------------
BIOD_MYCMM       DALARL--APMRAVLSAGAAQLSVADFAVMSAGAFDREWVATLVG---------------
BIOD_MYCUA       DALARL--APMRAVLSAGAAQLSVADFAVMSAGAFDREWVATLVG---------------
BIOD_MYCLE       SALARL--APMRATLPAGAGSMDATDFAAMSAAAFDRDWVTTLVH---------------
BIOD_MYCLB       SALARL--APMRATLPAGAGSMDATDFAAMSAAAFDRDWVTTLVH---------------
BIOD_MYCA1       PALEAL--APVRAVLPAGAAALAAAEFEAVSAGAFDRDWVTALAG---------------
BIOD_MYCGI       DALARL--GPVRAALPAGAGTLSGTDFERLSVQAFDEAWVRGLVG---------------
BIOD_MYCVP       DALSRL--APVRAALPAGAGSLGRADFERLSVDAFDPSWVEGLAA---------------
BIOD_MYCSK       DTLARL--APVRAALPAGVGSVSPVDFERISATAFDPNWLAGLL----------------
BIOD_MYCSS       DTLARL--APVRAALPAGVGSVSPVDFERISATAFDPNWLAGLL----------------
BIOD_MYCSJ       DALARL--APVRAALPAGVGSVSPVDFERISATAFDPNWLAGLL----------------
BIOD_MYCS2       TALEAL--APVRAVLPAGAGAASPERFEALSAAAFDADWITSLS----------------
BIOD_MYCA9       ENLANQFGTPVRAVIPEGAARLMPPVFAELSIELFEPQWVAGLVA---------------
BIOD_CROS5       TLIESLTKTPVLGMISYLEN---IEDITKLAHIASSLDLEMLF-----------------
BIOD_RIPO1       DLIQSLTGVPVLGVIPYLET---IKDLDQLAKSASHLDLEPLISLDCRTQFLG-------
BIOD_GLOC7       NLIQSLTSTPVLGILPYISD---LNDLEKLTQAASTLDLEKLLPL---------------
BIOD_MICAN       DLIQSLTNCPVLGVFPFIED---RRDLDKLASVVASWPEIKLSSI---------------
BIOD_CYAP4       DLITNLTQIPVLGVLPYLGD---RTNLAQLAAAAAQLDLEAFLSA---------------
BIOD_SYNY3       AMLESFTHLPVLGIVPYLTES-ERENLSRLAEITARFGLEKLAYF---------------
BIOD_GLOVI       QLIENLCHLPVLGVLSHLEA---ATDRAALAAAGSGLWLEAAGTLFTAERG---------
BIOD_NITMS       RDLESLTGVKVLGSIPFIKDMSNASLNRIFKKNIDLKSLLK-------------------
BIOD_RHOBA       EDLRRWCGIPMVASVRQPSGPLVVFSGPNGRNASGETSRETAGGVNFLNQTTIRR-----
                                                                             

BIOD1_ECOLI      ---
BIOD1_ECO57      ---
BIOD_PSEVU       ---
BIOD1_SALTI      ---
BIOD1_SALTY      ---
BIOD_SERMA       ---
BIOD1_YERPE      ---
BIOD_YERPG       ---
BIOD_BAUCH       ---
BIOD_ALIF1       ---
BIOD_ALIFM       ---
BIOD_ALISL       ---
BIOD_VIBCB       ---
BIOD_VIBPA       ---
BIOD_VIBVU       ---
BIOD_VIBVY       ---
BIOD_VIBCH       ---
BIOD_PHOPR       ---
BIOD2_ECOLI      ---
BIOD2_ECO57      ---
BIOD2_SALTI      ---
BIOD2_SALTY      ---
BIOD2_YERPE      ---
BIOD_YERPS       ---
BIOD_AERHH       ---
BIOD_AERS4       ---
BIOD_TOLAT       ---
BIOD_ALTMD       ---
BIOD_PSEHT       ---
BIOD_IDILO       ---
BIOD_BURCM       ---
BIOD_BURA4       ---
BIOD_BURVG       ---
BIOD_BURCA       ---
BIOD_BURCH       ---
BIOD_BURCC       ---
BIOD_BURCJ       ---
BIOD_BURM1       ---
BIOD_BURL3       ---
BIOD_BURMA       ---
BIOD_BURM9       ---
BIOD_BURM7       ---
BIOD_BURMS       ---
BIOD_BURPS       ---
BIOD_BURP0       ---
BIOD_BURP1       ---
BIOD_BURP6       ---
BIOD_BURTA       ---
BIOD_PARP8       ---
BIOD_AROAE       ---
BIOD_RALPJ       ---
BIOD_RALSO       ---
BIOD_JANMA       ---
BIOD_XANAC       ---
BIOD_XANC5       ---
BIOD_XANOM       ---
BIOD_XANOP       ---
BIOD_XANCP       ---
BIOD_XANCB       ---
BIOD_XANC8       ---
BIOD_XYLFM       ---
BIOD_XYLFT       ---
BIOD_XYLFA       ---
BIOD_NITMU       ---
BIOD_PSEAE       ---
BIOD_PSEA8       ---
BIOD_PSEAB       ---
BIOD_PSEA7       ---
BIOD_CELJU       ---
BIOD_CHRSD       ---
BIOD_MARHV       ---
BIOD_MANSM       ---
BIOD1_PASMU      ---
BIOD1_HAEIN      ---
BIOD_ACTSZ       ---
BIOD1_HAEDU      ---
BIOD_BUCAI       ---
BIOD_BUCA5       ---
BIOD_BUCBP       ---
BIOD_WIGBR       ---
BIOD_FRATF       ---
BIOD_FRATH       ---
BIOD_FRATO       ---
BIOD_FRATM       ---
BIOD_FRATT       ---
BIOD_FRAT1       ---
BIOD_FRATW       ---
BIOD_FRATN       ---
BIOD_FRAP2       ---
BIOD_LEGPC       ---
BIOD_LEGPA       ---
BIOD_LEGPL       ---
BIOD_LEGPH       ---
BIOD_BRUAB       ---
BIOD_BRUA2       ---
BIOD_BRUA1       ---
BIOD_BRUME       ---
BIOD_BRUMB       ---
BIOD_BRUC2       ---
BIOD_BRUO2       ---
BIOD_BRUSU       ---
BIOD_BRUSI       ---
BIOD_AGRFC       ---
BIOD_OCHA4       ---
BIOD_BRADU       ---
BIOD_BRASB       ---
BIOD_NITHX       ---
BIOD_NITWN       ---
BIOD_RHOPS       ---
BIOD_RHOP2       ---
BIOD_RHOP5       ---
BIOD_RHOPA       ---
BIOD_RHOPT       ---
BIOD_OLICO       ---
BIOD_RHOPB       ---
BIOD_SPHWW       ---
BIOD_NOVAD       ---
BIOD_SPHAL       ---
BIOD_MAGSA       ---
BIOD_CHLAB       ---
BIOD_CHLFF       ---
BIOD_CHLPN       ---
BIOD_CYTH3       ---
BIOD_GRAFK       ---
BIOD_CAMJE       ---
BIOD_CAMJR       ---
BIOD_CAMJJ       ---
BIOD_CAMJ8       ---
BIOD_LAWIP       ---
BIOD_NEOSM       ---
BIOD_LEPBJ       ---
BIOD_LEPBL       ---
BIOD_LEPIN       ---
BIOD_LEPIC       ---
BIOD_RUTMC       ---
BIOD_VESOH       ---
BIOD_CALBD       ---
BIOD_CALS8       ---
BIOD_CLOB1       ---
BIOD_CLOBH       ---
BIOD_CLOBJ       ---
BIOD_CLOBK       ---
BIOD_CLOBL       ---
BIOD_CLOB6       ---
BIOD_CLOBM       ---
BIOD_CLOBA       ---
BIOD_CLOBB       ---
BIOD_CLOTE       ---
BIOD_CLOPE       ---
BIOD_CLOP1       ---
BIOD_BRAHW       ---
BIOD_CLOK5       ---
BIOD_CLOK1       ---
BIOD_CLONN       ---
BIOD_CLOAB       ---
BIOD_ANOFW       ---
BIOD_BACHD       ---
BIOD_LYSSH       ---
BIOD_LYSSC       ---
BIOD_FUSNN       ---
BIOD_GEOKA       ---
BIOD_GEOSW       ---
BIOD_STAES       ---
BIOD_STAEQ       ---
BIOD2_HAEIN      ---
BIOD2_PASMU      ---
BIOD2_HAEDU      ---
BIOD_NEIG1       ---
BIOD_NEIG2       ---
BIOD_NEIMF       ---
BIOD_NEIMB       ---
BIOD_NEIM0       ---
BIOD_NEIMA       ---
BIOD_CHLTE       ---
BIOD_HELPY       ---
BIOD_HELPJ       ---
BIOD_HELPS       ---
BIOD_WOLSU       ---
BIOD_SULNB       ---
BIOD_ANAD2       ---
BIOD_ANASK       ---
BIOD_ANADE       ---
BIOD_ANADF       ---
BIOD_AKKM8       ---
BIOD_BACVZ       ---
BIOD_BACLD       ---
BIOD_BACSU       ---
BIOD_BACNA       ---
BIOD_BACAN       ---
BIOD_BACAA       ---
BIOD_BACAC       ---
BIOD_BACC0       ---
BIOD_BACHK       ---
BIOD_BACC3       ---
BIOD_BACAH       ---
BIOD_BACCZ       ---
BIOD_BACCR       ---
BIOD_BACC4       ---
BIOD_BACC2       ---
BIOD_AQUAE       ---
BIOD_HYDS0       ---
BIOD_METJA       ---
BIOD_META3       ---
BIOD_METVS       ---
BIOD_UNCTG       ---
BIOD_THEYD       ---
BIOD_ACICJ       ---
BIOD_METNO       ---
BIOD_CAUVC       ---
BIOD_CAUVN       ---
BIOD_CAUSK       ---
BIOD_PHEZH       ---
BIOD_CORGL       ---
BIOD_CORGB       ---
BIOD_CORDI       ---
BIOD_COREF       ---
BIOD_CORK4       ---
BIOD_FRACC       ---
BIOD_FRASN       ---
BIOD_STRAW       ---
BIOD_STRCO       ---
BIOD_SACEN       ---
BIOD_NOCFA       SGT
BIOD_RHOJR       ---
BIOD_RHOE4       ---
BIOD_MYCBO       ---
BIOD_MYCTU       ---
BIOD_MYCTA       ---
BIOD_MYCBP       ---
BIOD_MYCBT       ---
BIOD_MYCMM       ---
BIOD_MYCUA       ---
BIOD_MYCLE       ---
BIOD_MYCLB       ---
BIOD_MYCA1       ---
BIOD_MYCGI       ---
BIOD_MYCVP       ---
BIOD_MYCSK       ---
BIOD_MYCSS       ---
BIOD_MYCSJ       ---
BIOD_MYCS2       ---
BIOD_MYCA9       ---
BIOD_CROS5       ---
BIOD_RIPO1       ---
BIOD_GLOC7       ---
BIOD_MICAN       ---
BIOD_CYAP4       ---
BIOD_SYNY3       ---
BIOD_GLOVI       ---
BIOD_NITMS       ---
BIOD_RHOBA       ---