CLUSTAL format seed alignment for MF_00337

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EX7S_CLOAB      -----------MPSKKE--------SYESMIKELEKIVSSMENEELPLEEAMKNYEDGVK
EX7S_CLOPE      -----------MARKET--------NYESMVSELNEIVKQLENGDLTLEESIKSYENGVK
EX7S_THEMA      ----------------M--------NFEEMMKELEEIVNRLENEDLPLEESIKLFERGVE
EX7S_STAAM      -----------MTKETQ--------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMK
EX7S_BACHD      ----------MIKNEQP------PLSFEEAMEQLEEVVEQLEQGDVPLEEAISMFQKGMN
EX7S_BACSU      -------MTDVKKNEN--------MTFEEAMKGLESIVSKLEEGDVPLEQAINYFQEGMA
EX7S_STRPN      -----------MSKQK---------KFEENLAELETIVQSLENGEIALEDAITAFQKGMV
EX7S_STRP1      -----------MSKTK---------TFEENLQDLETIVNKLENGDVPLEEAISEFQKGML
EX7S_LACLA      -----------MATKKE------DVKFEDNLAELENIVRKLESGDVALEDAIAEFQKGMK
EX7S_LISIN      -----------MATKK--------KTFEEAIAELETIVEALENGSASLEDSLDMYQKGIE
EX7S_LISMO      -----------MATKK--------KTFEEAIAELETIVEALENGSASLEDSLDMYQKGIE
EX7S_BRUME      -----------MTEPSN--ADIAVMSFEDALKQLEKIVDDLERGDVPLEESIRIYERGEA
EX7S_RHILO      -----------MAGETN--EDVKAMSFEQALDALEKIVDDLERGDVPLDQSIRIYERGEA
EX7S_RHIME      -----------MNNNAQ--PDVSALSFEQAVEELERIVSALERGDVALDKSIEIYERGEA
EX7S_ZYMMO      -----------MSQE----KNISELSFEEALKKLEEIVRRLESGDTTLEDSIQMYSQGDA
EX7S_CAUVC      -----------MTDAANPPADISALSFEEALSQLERIVQELESGQAALERSIDIYERGAA
EX7S_RICCN      -----------MTNTKT---LEANISFEEALKELEEIVKKIDNGQESLETAVNSFERGIL
EX7S_RICPR      -----------MTNTKT---LKDNISFEEALRELEEIVKKIDTGQENLETAVNSFERGIL
EX7S_ECOLI      ------------MPKKNEAP----ASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQ
EX7S_SALTY      ------------MPKKNEAP----ASFETALSELEHIVTRLESGDLPLEDALNEFERGVQ
EX7S_YERPE      ------------MPKKAASPEIKAASFETSLSELEQIVTRLESGELPLEDALNEFERGVQ
EX7S_VIBCH      ------------MASKKPEN----MSFESTIEELEQLVEQLESGDLALDEALRKFERGIS
EX7S_HAEIN      ------------MARKPASSQ----DFETTLVQLENIVTHLENGDLPLEEALKEFEQGVQ
EX7S_PASMU      ------------MAKKSTEKTE--LDFENTLQQLEAIVTRLESGELPLESALEEFERGIK
EX7S_PSEAE      ------------MARKKTLD------FEQSLTELQTLVERLESGELSLEESLGAFEQGIR
EX7S_XYLFA      ------------MPKHSPPDTSPVARFEQSLQELEQLVQNMETGALSLEQSLGAYERGIA
EX7S_MYCLE      ----------MRSTTPINTTPINQLGYEACRDELIEVVRLLEQGGLNLDMSLKLWERGEQ
EX7S_MYCTU      ---MVCDPNGDDTGRTHATVPVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQ
EX7S_STRCO      ----------MTSEVEQPTAMSEALGYEQARDELIEVVRRLEAGGTTLEESLALWERGEE
EX7S_NEIMA      ------------------MKKNAPKSFEEALSRLESLTQAMQ-GEMPLEDALAAYQEGNE
EX7S_NEIMB      ------------------MKKNAPKSFEEALSRLESLTQSMQ-GEMPLEDALAAYQEGNE
EX7S_RALSO      ----MPRAQDVAQSDATLSSPATPASYEAAMAELETLVASMESGELPLEASLAAYRRGAE
EX7S_HELPH      MQDELFETEKAPQKNTKNAKNAPKKSFEEHVHSLEQAIDRLNDPNLSLKDGMDLYKTAMQ
EX7S_HELPJ      MQDELFETEKAPQKNAKNAKNAPKKSFEEHVHSLERVIDRLNDPNLSLKDGMDLYKTAMQ
EX7S_HELPY      MQDELFETEKIPPKNTKNTKNAPKKSFEEHVHSLERAIDRLNDPNLSLKDGMDLYKTAMQ
EX7S_CHLMU      --------------MTKKAKNVEKVPFEDAMKRLEEIIDLMNQPTTALEASLALYEEADQ
EX7S_CHLTR      --------------MTKKAKNVEKISFEDAMKRLEEIIDLMNQPTTSLEASLALYEEADQ
EX7S_CHLPN      ---------------------MEEVPFENAMQRLEEIVDLMNQPTTSLDASLALYEEADA
EX7S_NOSS1      ---------MVKRKNSDNSDTVAHGNYEAKVAEIEAIISRIESGELELEAVFEQFANAVE
                                          :*     :      ::     *.  .  :  .  

EX7S_CLOAB      LCDKLYKILNKAEGKIKLLTENGEEEFKKAGDSYEQ----
EX7S_CLOPE      IVNKLYKKLSTLEGKIKVVEDEKEEDFGGYSNEY------
EX7S_THEMA      LYRKCKEILQQNRLKIIDVMKELEGEIDASGRDQENELR-
EX7S_STAAM      LSAACDTTLKNAEKKVNDLIKEEAEDVKNDESTDE-----
EX7S_BACHD      LSKVCHEKLATVEKQMDQILK-EDGNFEETVLQEEQE---
EX7S_BACSU      LSKMCHEKLQKVEKQMDFILK-EDGELAPFSVQEEDEGDK
EX7S_STRPN      LSKELQATLDKAEKTLVKVMQ-EDGTESDFE---------
EX7S_STRP1      LSKELQKTLQAAEKTLVKVMQ-ADGTEVDMDD--------
EX7S_LACLA      ISETLKKTLNEAEETLVKIVG-KNDQESDFSPEQKDY---
EX7S_LISIN      LTKLCQDKLQSAEQRMAKVVT-EAGEEIPFEADGE-----
EX7S_LISMO      LTKLCQDKLQSAEKRMAKVVT-DAGEEIPFEADGE-----
EX7S_BRUME      LKKHCDTLLKSAEDKVEKIRIGRDGQPVGTEPLDPE----
EX7S_RHILO      LKAHCDRLLKAAEDKVEKIRLSRDGKPVGTEPLDAD----
EX7S_RHIME      LKKHCEALLKAAEDRIEKIRLDRAGRPQGVEPLDAE----
EX7S_ZYMMO      LKKQCEARLKAAQKKIEQISLDQDGRATGTSPFDAE----
EX7S_CAUVC      LKAHCEKKLEAARLKVEKIVLGQGG-AVAAEPAEFN----
EX7S_RICCN      LKNHCEKKLKEARLKIEKITKLADS-TVVLEEMEV-----
EX7S_RICPR      LKNHCEKKLKEARLKIEKITKLADS-TVILEETEV-----
EX7S_ECOLI      LARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE----
EX7S_SALTY      LARQGQAKLQQAEQRVQILLSDNEEASPEPFIADNE----
EX7S_YERPE      LARQGQQTLLQAEQRVQILLSDDVDAPLKPFTPDTE----
EX7S_VIBCH      LARAGQLKLDDAEQRVRILLSNSDDAPLSDFSDVAE----
EX7S_HAEIN      LAKLGQERLQQAEQRIQILLQKTEDAPLNDYKGNDYEGNA
EX7S_PASMU      LAHLGQERLQQAEQRIQILLQKSDSAKLSDYQAEE-----
EX7S_PSEAE      LTRECQTSLSQAEQKVQILLERDGELSEAPFDAEGDEA--
EX7S_XYLFA      LYRECHQALEQAQLRVRLLSDPMHPDDGEPFDPSLVSTSQ
EX7S_MYCLE      LAKRCEEHLDGARQRVADVLSARQVEEA------------
EX7S_MYCTU      LAKRCEEHLAGARQRVSDVLAGDEAQNG------------
EX7S_STRCO      LAEVCRRRLDGARARLDAALAEEADPEDGASGADGGGA--
EX7S_NEIMA      LVIYCQTKLAQVEQKLQVLDADGLKELNLESDE-------
EX7S_NEIMB      LVRYCQTKLAQVEQKLQVLDTDGLKELNLESDE-------
EX7S_RALSO      LVRYCQQVLERVEQQVRVLDGDALKPLAGEGTNEQGGA--
EX7S_HELPH      ELVLAQKLLENAYLEYEKLQTLDKKA--------------
EX7S_HELPJ      ELFLAQKLLENAYSEYEKLQTPNKKA--------------
EX7S_HELPY      ELFLAQKLLENAYLEHEKLQTPDQKA--------------
EX7S_CHLMU      LMRICESRIQEVEARIKQLSDQRSES--------------
EX7S_CHLTR      LMRICESRIQEVEARIKQLSDQRSES--------------
EX7S_CHLPN      LMRICESRIRQVEQRVRELAEKRHESSLFEEQAVVR----
EX7S_NOSS1      YLRQCDTFLQQRQQQMDLLIETLNDEDNSEL---------
                        :