CLUSTAL format seed alignment for MF_00338

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y2488_NOSS1      ---------------MIVTTTDVIQGAVIDSYLGIVTAEIVYGSNFLRDFLAGIRDVIGG
Y1118_SYNY3      ---------------MLTSTTDIVQGRTIARYHGIVTAEVVYGTNALRDFFAGIRDLIGG
Y1349_HAEDU      ---------------MIITTTPTVENRQIIEYKGLVFGEVVAGANIIRDFFASITDMIGG
Y1668_PASMU      ---------------MLITTTPSIEGKQIIEYKEVVFGEVVAGSNFIRDFFAGITDIIGG
Y226_BACFN       ---------------MLLATTPIIEGKRITTYYGIVSGETIIGANVFRDFFASIRDIVGG
Y270_BACFR       ---------------MLLATTPIIEGKRITTYYGIVSGETIIGANVFRDFFASIRDIVGG
Y3410_BACTN      ---------------MLVTTTPIIEGKRIVKYYGIVSGETIIGANVFRDLFASIRDIVGG
YBG4_VIBVU       ---------------MIVTTTQHIEGKKIIAYKGVIAGEAILGANLFKDLFAGIRDMVGG
Y4283_VIBVY      ---------------MIVTTTQHIEGKKIIAYKGVIAGEAILGANLFKDLFAGIRDMVGG
Y2791_GEOSL      ---------------MIITTTPTIEGKRIVRYCGVVAGEAILGANLFKDLFANIRDMVGG
Y3751_VIBCH      ---------------MIVTTTPNIEGKRIVRYCGVIAGEAILGANIFKDLSAGIRDIVGG
Y1032_NITEU      ---------------MLLTTTPVIEGKRITHYYGIVAGEAVLGANVLKDLFAGIRDFVGG
Y1619_AROAE      ---------------MLMTTTPTIEGRTIRSYHGVVAGEAIIGANVFKDMFAAVRDIVGG
Y892_THET2       ---------------MILTTTHEIEGRRIERYLGIVFGEAIVGANVLRDLLAQIRDIVGG
Y1256_THET8      ---------------MILTTTHEIEGRRIERYLGIVFGEAIVGANVLRDLLAQIRDIVGG
YK44_RHOS4       ---------------MIVTTTPNIEGYQIATYHGIVTGEAILGANVIRDLFAGITDFIGG
YBJQ_ECOLI       ---------------MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_ECOL6       ---------------MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_ECO57       ---------------MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_SHIBS       ---------------MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_SHIDS       ---------------MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_SHISS       ---------------MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_SHIFL       ---------------MQFSTTPTLEGLTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_SALTY       ---------------MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_SALTI       ---------------MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_SALCH       ---------------MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
YBJQ_SALPA       ---------------MQFSTTPTLEGQSIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
Y2666_PECAS      ---------------MQLSTTPNLEGFTITEYCGVVTGEAILGANIFRDFFASIRDVVGG
Y1048_GLOVI      ---------------MIISTTTAIEGRPVQGYLGVVTGEAILGANVFADFFAKIRDIVGG
Y2377_CAUVC      ---------------MLITTTPFIEGRPVQEYKGAIYAQSILGANVVLDLLAAIRDFIGG
Y3418_PSEF5      ---------------MIVTTTAHIEGREIASYLDIVSAESVHGINVVRDLFAGMRDFFGG
Y1745_PSEPF      ---------------MIISTTHSIEGRQITAYLDIVSAESVQGVNVIRDMFAGMRDFFGG
Y2873_PSEPK      ---------------MIISTTSQLEGRPIAEYLGVVSSESVQGIYFVRDFFARFRDFFGG
Y240_LISIN       ---------------MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGG
Y219_LISMF       ---------------MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGG
Y208_LISMO       ---------------MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGG
Y208_LISIV       ---------------MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGG
Y194_LISSS       ---------------MIVTTSPNIEGKQIIEYKKIVFGEIITGVNFMKDIGAGLRNFFGG
Y208_LISWE       ---------------MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGG
Y208_LISGR       ---------------MITTTSPTIEGKQIIEYKKIVFGEVITGINVLKDIGAGIRNFFGG
Y562_BIFLO       --------------MILVTTTPSVDGYTITNYQGIVFGEVVSGVNMFKDLGAGLRNMFGG
Y060_CORJK       ---------------MIVTTTNNVEGHTIGQYLRIVSGETVAGINMFKDIGAGFRNITGG
Y1111_BACHD      ---------------MISTTTHSVEGHEITDYVGIVNGEAIMGANVVRDFLAGISDVIGG
Y1405_GEOKA      ---------------MIVTTTNTIEGKEIEEYLGIVAGEVILGANVVRDFLASITDIIGG
Y2021_RUEPO      ---------------MIVTTTPNVEGRRITAYKGIVVGEAIMGANVVRDVFASITDIVGG
Y1265_SYMTH      ---------------MIVTTTPSVEGRQIAEYLGIVSAEAIMGANFFRDLAASITDLIGG
Y1001_BACAN      ---------------MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGG
Y1012_BACCR      ---------------MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGG
Y904_BACCZ       ---------------MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGG
Y921_BACHK       ---------------MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGG
YA95_BACC1       ---------------MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGG
Y3206_BACHK      ---------------MIVTTTSGIQGKEIIDYIDIVNGEAIMGANIVRDLFASVRDVVGG
Y1816_BACCR      ---------------MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGG
Y6552_BACAN      ---------------MIVTTTAEIQGKEIIEYIDIVNGEAIMGANIVRDVFASVRDVVGG
Y5181_BACCR      ---------------MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGG
Y4874_BACCZ      ---------------MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGG
Y4859_BACHK      ---------------MIVTTTSTIQGKEIIDYVDIVNGEAIMGANIVRDLFASVRDVVGG
YGI4_BACC1       ---------------MIVTTTSTIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGG
Y465_CARHZ       ---------------MLLATSGRLDGFKVTKYLGIVTGEAIMGTNFIRDLLASISDIIGG
Y3016_RHOBA      ---------------MPMTTTSTFETHIIEAYRGPVFGETIYGANVLRDISAVFTDVVGG
Y507_METTH       ---------------MLMLTSQTIDGKRISRYHGIVTGDALIGANIYKDIFSGVRDVVGG
Y643_BACHD       ---------------MMIVTTDRIDGYNVKAVKGYVKGSTVQTKHIGRDITAGLKGLVGG
Y882_CLOPE       ---------------MLVLTTETIPGKGIKEVKGLVKGSTVRCKNIGKDIASSFKNLVGG
Y763_THEMA       ---------------MIITTTEQVPGYRVKEILGVVSGNVVMSKHLGRDIAAAFKTLAGG
Y869_ARCFU       -----------MEKEIIITTTETVPQREVAEILGVVFGNTVRAKHVGKDILAGLKNIVGG
YF81_THET2       ----------MGVMEILVSTLEAVPGYRVAQVLGVVKGSTVRSKHLGKDLLAGLRTLVGG
Y1944_THET8      ----------MGVMEILVSTLEAVPGYRVAQVLGVVKGSTVRSKHLGKDLLAGLRTLVGG
Y2432_HALSA      ---------------MEFVTTETVPGREITESLGVARGNTVKARNVGRDITQSIRNITGG
Y2600_NATPD      ---------------MQTVSTETVPGHETVEALGIARGNTVEARNVGRDITQSIRNITGG
Y490_PYRAB       ---------METIEGIIVVTTSEIPGYRIVEVKGIARGGVVRATHLGRDIMALLRNIKGG
Y1682_PYRHO      ------MKDMKTIEGIIVVTTPEIPGYKVVEVKGVARGGTVRATHIGRDIMALLRNLKGG
Y1926_THEKO      ---------METVEGIMVVTTETIPGYRIVEVKGIARGGIVKATHIGRDIMAVLRNIKGG
Y1756_PYRFU      --------MVNIMDEIIVVTTPTIPGYKIIEVKGIARGGIVMATHLGRDILALLRNIKGG
Y3383_METAC      ---------------MIIATTDTIAGKEITKTLGMARGSTIQAKHLGKDIMSGLRSVVGG
Y1617_DEHM1      ---------------MILTNTEDVAGHKIIKNLGLVKGNTIRAKHIGKDILAGLRSIVGG
Y1711_DEHMC      ---------------MIMTNTEAVAGHKIIKNLGLVKGNTIRAKHIGKDIMASLRSIVGG
Y1283_VIBPA      ---------------MIYTTTDTIPGKEIAEVRGVVTGNVVQSKHIGRDLMAGLKSIVGG
Y2458_COLP3      ---------------MIYSTTESIPGKEIEEIVGVVTGNVVQAKHIGRDIMAGLKSIVGG
Y4184_PHOPR      ---------------MLCVTTSDIIGREITETLGVVTGNVVQSKHVGRDIMAGFKTIFGG
Y2946_ACIAD      -----------------------MPGHEITQQLDVVYGSTVRSKHVGRDLLAGLKNIVGG
Y1800_HELHP      ---------------MKLYSVAYIP--QSYEVLGLVKGSMVQSKHIGRDIMAGLKGIVGG
Y1287_LACJO      -----------MAEQILVTTTENIPGRK-YEIIGEVFGVTTQSKNAIRDFGAGLKSIVGG
Y1282_LACSS      -----------MTNQILITTTESIPGKH-YEVLGEVFGLTTQSKNVFKNIGASLKNVVGG
Y2083_LACPL      ------------MTQLLVTTTENIPGHP-YEVIGEVFGLTTQSKNLVRNIGAGLKGLVGG
Y241_ENTFA       ---------------MLVTTTERISGQE-YEIIGEVFGLTTRSKNMFKDLGAGLKSVVGG
YY10_ENTFL       ---------------MLITTSEKLYGVE-YETLDVVFGVTTHSKNIVKNIGAGLKNLVGG
YJFJ_LACLA       ------------MEEILIVTTNEVAGYRITEVYGEVFGLTTRSRNLFSSAGQQMKTVVGG
Y3412_STRCO      ---------------MLVVTTNDLPGHRVQEVLGEVFGLTVRSRHLGSQIGAGLKSLVGG
Y4658_STRAW      MGIEEYGGGQGPHSDVLVVTTNDVPGYRVQHVIGEVFGLTVRSRHLGSQIGAGLKSMIGG
Y1976_SACS2      --------MSYKEGDVLVTNGEQSPGYKIVEIKGLVVGITVRSRGLGKNIIASLRSLLGG
Y1080_SULTO      --------MSFRESDILITTAQELPGYKIVEVKGVVIGITVRSRGLGGNIAASFRSLIGG
Y544_METTH       --------MVEEHRDVIYVTSNYVPGYRAVEVLGFVYGLTVRSRRLGGQI-DRFKSILGG
Y182_THEAC       ------------MSDVIMVNTEYIPGKRIVKVFGTIWGITVRSRGLGGNLVAGLRSLAGG
Y671_THEVO       ---------MDEEHNIIMVTTNYIPGKKITRIIGTIWGITVRSRGLGGNIVAGLRSLAGG
Y347_PICTO       ------------MDDVIVVTSDYVPGHRIVKILGVTWGLTVRSRGLGGNLVAGLRTIAGG
Y904_BURMA       --MAD---------PQLITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGG
Y1822_BURP1      --MAD---------PQLITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGG
Y2003_BURPS      --MAD---------PQLITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGG
Y595_BURL3       --MIDTTRSLDDLSPARVTTAFDLPGHTTVRSLGVAQGIIVRSRSIVGSFGAALQTIFGG
Y4322_CHRVO      --MLP---------AKMVTTAFELPGYRVSANLGVVRGITVRSRSLVGNFFGGLQSLFGG
Y954_FRATT       ---------------MILTTADTLGKREIIEYKGLVTGIIVRTPTITQGILGGLKNIIGG
Y197_LEGPH       -------------MTMMITTGNSFEGKVIKQYLGIVRGIVVRSPTISQGLMGGLKSIVGG
Y5168_BACLD      ---------------MIIVTTDTIANQNIVEVKGLVTSSIVQSRNIGKDILSGLKSVIGG
Y1500_CLOTE      ----------------MILSNLSYIDNKELETINIVEGVCVFSKNVGKDIMASFKNVVGG
Y1882_PSEHT      -----------------MLTTETASNLKVLKRLDVITAECVYGMNIFKDILASLSDTFGG
Y1413_METJA      ------------MGGMITTTTPYIEGKKIIKYLGFVHGVASVYVTV---------KYYED
                                                      .                     .

Y2488_NOSS1      RTGSYERLFEQGQRKAIEELELRAQRLGANAVIGIEIDTGTINVDQSGVLLLITATGTAV
Y1118_SYNY3      RTGSYEQIFEKGHREAIAELTERAQKLGANGVIGVAVNTGTINIDDRGALLLITATGTAV
Y1349_HAEDU      RSGVYEDKLNVARQEALVELQKQARNIGANAVIGVSIQYQSMGK---KDMFIIVATGTAV
Y1668_PASMU      RSGAYESKIARARKEALEELQQQAKRLGANAVVGVEVNYTSINGE-GKSMFMIVASGTAV
Y226_BACFN       RSGSYEEVLREAKDTALKEMSEQARQMGANAVIGVDLDYETVGG--SGSMLMVTASGTAV
Y270_BACFR       RSGSYEEVLREAKDTALKEMSEQARQMGANAVIGVDLDYETVGG--SGSMLMVTASGTAV
Y3410_BACTN      RSGAYEEVLRMAKDTALQEMQAQAAKLGANAVIGVDLDYETVGG--SGSMLMVTANGTAV
YBG4_VIBVU       RSGTYERELERARTIAFQELEQKARELGANAIVGVDIDYEVLGQ--SNGMLMVSASGTAV
Y4283_VIBVY      RSGTYERELERARTIAFQELEQKARELGANAIVGVDIDYEVLGQ--SNGMLMVSASGTAV
Y2791_GEOSL      RSATYERELQRARDIALRELEERAEELGATAVVGVDLDYEVMGQ--GNGMLMVSASGTAV
Y3751_VIBCH      RSGTYERELEKARAIALEELQQHAVALGANAVVGIDLDYETFGK--ANGMLMVSVSGTAV
Y1032_NITEU      RSGTYEKELQHAREIALEELQENAHRLGANAVIGIDIDYEVLGK--ENGMLMVSVSGTAV
Y1619_AROAE      RSGSYEKTLRSARETAFEDLAEAAGRLGANAVVGVDIDYEVLGE--KNGMLMVAVSGTAV
Y892_THET2       RSGAYEAELRRARETALAEMAEAARRLGADAVVGVDLDYEVLGS--GNSMLMVTASGTAV
Y1256_THET8      RSGAYEAELRRARETALAEMAEAARRLGADAVVGVDLDYEVLGS--GNSMLMVTASGTAV
YK44_RHOS4       RSGAYEKELGRARETALSEMEEAARAKGANAVVGVDLDYEVI-----NNMLMVSASGTAV
YBJQ_ECOLI       RSGAYEKELRKAREIAFEELGSQARALGADAVVGIDIDYETVGQ--NGSMLMVSVSGTAV
YBJQ_ECOL6       RSGAYEKELRKAREIAFEELGSQARALGADAVVGIDIDYETVGQ--NGSMLMVSVSGTAV
YBJQ_ECO57       RSGAYEKELRKAREIAFEELGSQARALGADAVVGIDIDYETVGQ--NGSMLMVSVSGTAV
YBJQ_SHIBS       RSGAYEKELRKAREIAFEELGSQARALGADAVVGIDIDYETVGQ--NGSMLMVSVSGTAV
YBJQ_SHIDS       RSGAYEKELRKAREIAFEELGSQARALGADAVVGIDIDYETVGQ--NGSMLMVSVSGTAV
YBJQ_SHISS       RSGAYEKELRKAREIAFEELGSQARALGADAVVGIDIDYETVGQ--NGSMLMVSVSGTAV
YBJQ_SHIFL       RSGAYEKELRKAREIAFEELGSQARALGADAVVGIDIDYETVGQ--NGSMLMVSVSGTAV
YBJQ_SALTY       RSGAYEKELRKAREIAFQELGEQAKALGADAVVGIDIDYETVGK--DGSMLMVSVSGTAV
YBJQ_SALTI       RSGAYEKELRKAREIAFQELGEQAKALGADAVVGIDIDYETVGK--DGSMLMVSVSGTAV
YBJQ_SALCH       RSGAYEKELRKAREIAFQELGEQAKALGADAVVGIDIDYETVGK--DGSMLMVSVSGTAV
YBJQ_SALPA       RSGAYEKELRKAREIAFQELGEQAKALGADAVVGIDIDYETVGK--DGSMLMVSVSGTAV
Y2666_PECAS      RSGAYEKELRKARQIAFKELQEQAEDLGANAIVGIDLDYETVGK--DGSMLMVTVSGTAV
Y1048_GLOVI      RSAAYERELRKARQIAMDEMTREARELGADGVIGVDIDYETIAVPEGGSMLMVSVSGTAV
Y2377_CAUVC      HSKSYERVLARAREDAMKNLIKEAEKLGANAILAVDLDYNTVGP--QGSMMMVSVSGTAV
Y3418_PSEF5      RSQTLERALKEARIQATNEIKERARQCNADAVVGVDFEISMPAG--RGGMVVVFATGTAV
Y1745_PSEPF      RSQTLERALKEARVQATDEIKERARALQADAVVGVDFEISMPAG--KGGMVVVFATGTAV
Y2873_PSEPK      RSQTLESALREAREQATEELKARARQLQADAVVGVDFEISMPSV--QGGMVVVFATGTAV
Y240_LISIN       RSQGYEDELINAREEAIREMEQRAKDIGANAVIGVDIDYEVLGA--DNGMLMVTASGTAV
Y219_LISMF       RSQGYEDELINAREEAIREMEQRAKDIGANAVIGVDIDYEVLGA--DNGMLMVTASGTAV
Y208_LISMO       RSQGYEDELINAREEAIREMEQRAKDIGANAVIGVDIDYEVLGA--DNGMLMVTASGTAV
Y208_LISIV       RSQGYEDELINAREEAIKEMEQRAKDIGANAVIGVDIDYEVLGA--DNGMLMVTASGTAV
Y194_LISSS       RSQGYEDELINAREEAIKEMEQRAQDIGANAVIGVDIDYEVLGA--DNGMLMVTASGTAV
Y208_LISWE       RSQGYEDELINAREEAIREMESRAKDIGANAVIGVDIDYEVLGA--DNGMLMVTASGTAV
Y208_LISGR       RSGGYEEELIQAREAAIEEMENRAEALGANAIIAVDVDYEVLGA--DNGMLMVSVSGTAV
Y562_BIFLO       RSQGYEEELMRARNEAIAEMQQRAEAMGAHAVVGVDIDYEVLGA--DNGMLMVTASGTAV
Y060_CORJK       RSSAYEGEILQARETALKEMVDRALEMGAHGIVGVDVDYESLG---QGGMVMVSATGTAV
Y1111_BACHD      RSAAYEDKLAEGRQIAVREMEDRAAQLGADAVVGVMLDFETLRD----GMLMCVATGTAV
Y1405_GEOKA      RSGTYESKLAEGREMAIKEMVNKARSLGANAVIGVDLDFETLRD----GMMMCIATGTAV
Y2021_RUEPO      RSGAYESKLQDARETALSELEGRAVALGANAVVGVDLDYEVVGQ----SMLMVSASGTAV
Y1265_SYMTH      RAGSYESKLREGREECLRELVAEAARLGADAVVGVDIDYEVVGE----SMLMVTASGTAV
Y1001_BACAN      RAGSYESKLKEARDIAMDEMKELAKQKGANAIVGVDVDYEVVRD----GMLMVAVSGTAV
Y1012_BACCR      RAGSYESKLKEARDIAMDEMKELAKQKGANAIVGVDVDYEVVRD----GMLMVAVSGTAV
Y904_BACCZ       RAGSYESKLKEARDIAMDEMKELAKQKGANAIVGVDVDYEVVRD----GMLMVAVSGTAV
Y921_BACHK       RAGSYESKLKEARDIAMDEMKELAKQKGANAIVGVDVDYEVVRD----GMLMVAVSGTAV
YA95_BACC1       RAGSYESKLKEARDIAMDEMKELAKQKGANAIVGIDVDYEVVRD----GMLMVAVSGTAV
Y3206_BACHK      RAGSYESKLKEARDIAMDEMKELAKQKGANAIVGIDVDYEVVRD----GMLMVAVSGTAV
Y1816_BACCR      RAGAYESKLKDARDIAMDEMKELAKQKGANAIIGIDVDYEVVRD----GMLMVAVSGTAV
Y6552_BACAN      RAGAYESKLKEARDIAMDEMKELAKQKGVNAIVGIDVDYAIIRA----GMLMVAVSGTAV
Y5181_BACCR      RSGAYESKLKEARDIAMEEMKTLARQKNANAIVGIDVDYEVVRE----GMLMVAVSGTAV
Y4874_BACCZ      RSGAYESKLKEARDIAMEEMKTLARQKNANAIVGIDVDYEVVRE----GMLMVAVSGTAV
Y4859_BACHK      RSGAYESKLKEARDIAMEEMKTLARQKNANAIVGIDVDYEVVRE----GMLMVAVSGTAV
YGI4_BACC1       RAGAYESKLKEARDIAMEEMKTFARQKNANAIVGIDVDYEVVRE----GMLMVAVSGTAV
Y465_CARHZ       RSGAYEQQLEEARNIVLNEMSERAKRLGANAVIGISLDYESVGQ----SMLMVVATGTAV
Y3016_RHOBA      RAGDYEKVLIRGRNAALAEMSERAKQLGANAVIGIRFDYSTVGR----SMLMICSSGTAV
Y507_METTH       RTSAYERELARARELALSSMASAAERLGADAIIGVRLDYHNLGGT-MGNTILVSTTGTAV
Y643_BACHD       EIKGYSEMMDEARKLAIHRMAQDAEAKGANAVIGFRLQTSTVMA----NAAEIIAYGTAV
Y882_CLOPE       EMNSYTEILTEARQIAIGRMVDEAESLGANAIIEMRLVSSSLAA----GAAEMVAYGTAV
Y763_THEMA       EIKGYTEMLTEARNIALERMMKEAEKLGADAVIGFRYSSSTIMS----GAAEILAYGTAV
Y869_ARCFU       EIEEYTEMLRDARMEALNRMIKEAKKLGADAVVNVRFTTSQTMA----GAAELLAYGTAV
YF81_THET2       ELPEYTEMLQEAREVAEARMLEEARRLGAHAVLGVRYATASVMQ----GAAEILVYGTAV
Y1944_THET8      ELPEYTEMLQEAREVAEARMLEEARRLGAHAVLGVRYATASVMQ----GAAEILVYGTAV
Y2432_HALSA      ELKAYSELLTDARDDALDRMAEDARSMGADAVVNVRLESSEIAN----GGSEVIAYGTAV
Y2600_NATPD      ELKAYSELLSKARDEALSRMEADAEEMGADAVVNVRLETSKVTD----GGSEVIAYGTAV
Y490_PYRAB       EVKEYTEMMAEAREEALRRMALHAKELGANAVVNMRFATSNLGG----SMAEIYAYGTAV
Y1682_PYRHO      EVKEYTEMMAEAREEALRRMALHAKELGANAVVNFRFATSNLGG----SMAEIYAYGTAV
Y1926_THEKO      EVREYTQMMAEAREEALRRMALHAKELGANAVVNVRFATSNVGS----SVAEVYAYGTAV
Y1756_PYRFU      EVKEYTQMMAEAREEALRRMIEHAKKLGANAVVNFRFATSNVGG----GMAEVYAYGTAV
Y3383_METAC      ELTEYSKMLEEAREKAINRMVEDAEKMGADAVVNVRFMTSMVMA----GAAEILAYGTAV
Y1617_DEHM1      EIEEYTQMLDEARNEAIRRMEAEAKEKGANAIICVRFSTSAVMQ----NASEVMAYGTAV
Y1711_DEHMC      EIEEYTQMLDEARNEALKRMEADAKEKGANAIICVRFSTSAVMQ----NASEVMAYGTAV
Y1283_VIBPA      EIRGYTEMMTEARDIAIQRMVEQANQKGADAIVGIRFTTSSIVD----GSSEILAFGTAV
Y2458_COLP3      EIRGYTEMLTDARDIAIQRLVANAEEKGADAVVGIRFTTSAIMD----GSSEIMVFGTAV
Y4184_PHOPR      EIRGYTEMLTEAREEALNRAIADAQSQGADAIVNLRFTTSAIMQ----GASEILAYGTAV
Y2946_ACIAD      ELTAYTELLEESRQEAMQRMIAKAQQLGANAIVGIRFSTSNIAQ----GASELFVYGTAV
Y1800_HELHP      EIKGYTEMLNDARNIATDRMIEEAHALGANGIIGISYVTSSLMS----NTSEVLVYGTAV
Y1287_LACJO      EIKAYTSMLTESRDQSIARLRQNASEMGANAVVMMRFDSGSIAG----DMQSVVAYGTAV
Y1282_LACSS      EIRAYTEMMTESRDVAIDRLRQNAIEMGADAVVMMRFDSGSIGT----DMQSVAAYGTAV
Y2083_LACPL      EIKDYTKMLEESRDVAVNRLRDNASAMGADAVVMMRFDTGSISQ----DMQSVAAYGTAV
Y241_ENTFA       EIKGYTDMQREARDQAIERLKAEASKLGADAVVMMRFDSGTIGT----DMQSVVAYGTAV
YY10_ENTFL       EIKAYTEMQQEARKIAMDRLKEEAKNIGADAIIAMRFDSGSISN----DMQSVVAYGTAV
YJFJ_LACLA       EINGYTKLQHETRETSIDRMREEAKAKGANAIVAMRFDS-STFQ----NIDSVAAYGTAV
Y3412_STRCO      ELRGLTKTLVETRNQAMERLVEQARARGANAVLSFRFDVTEAAD----VGTEVCAYGTAV
Y4658_STRAW      ELKGLTKTLVETRNQAMERLVEQARVRGGNGILMMRFDVTEAAD----VGTEVCAYGTAV
Y1976_SACS2      EIKEYVELAEQARLQALQRMVDNAKALGANAVVNVRFDSNELSE----AMDEIIAYGTAV
Y1080_SULTO      EIKEYVEMAEQARMQALERMIERAKALGANAVISVRFDSNELAQ----NMDEIIAYGTAV
Y544_METTH       EIKEYVTMMEHSRQEALERMLDHARELGANAVISVRFDSDSISD----IMQEILAYGTAV
Y182_THEAC       EIKEYTKMLSDARNTAMERLQSAAEQIGANAVINVRFDSSDIGQ----VMTEIVAYGTAV
Y671_THEVO       EIKEYSKMLSDTRNTAMERLRDAAEQVGANAVIELRFDSSDIGQ----VMTEIVAYGTAV
Y347_PICTO       EIKEYVTLLNDARETALQRLISSAKAMGATAVINMRFDTSDMAQ----AMTEIVAYGTAV
Y904_BURMA       NISLYTSLCERARQDAYERMIDEARRMGGNAIVGMRYDATEIA----SGVTEVLCYGTAV
Y1822_BURP1      NISLYTSLCERARQDAYERMIDEARRMGGNAIVGMRYDATEIA----SGVTEVLCYGTAV
Y2003_BURPS      NISLYTSLCERARQDAYERMIDEARRMGGNAIVGMRYDATEIA----SGVTEVLCYGTAV
Y595_BURL3       NITLYTSLCEKAREHAFEKMLADARKVGANAIVAMRYDSTEIG----SGVTEVICYGTAV
Y4322_CHRVO      NITIYTSLCERARSETYAEMCQHAQALGADAVIGMRYDATEVM----TGLTEVLCYGTAV
Y954_FRATT       KNTSYTNVCKEARLHAEQEMINQAKELGANAIVAIRYDSSSLGGN--TSGTEVFCYGTAV
Y197_LEGPH       KIGAYSEMCEHAREEAFQLMIEHAQALNANGIIAMRYDTGEIG----QAGTEVLCYGTAV
Y5168_BACLD      ELKNYTQMLEDSKKAVRERLVNQAEELGANAIVGLRFELSAGQG-----TSELIGYGTAV
Y1500_CLOTE      EIKSYSEMVRDVKDTAVKKMVEEAKNLGADAVINIRYAMTSMSQ---GSTLAVIVSGTAV
Y1882_PSEHT      RNKSIQNTLRDARRTALTELRKEAYSLGANAVIGIDLDYSEISGGGKAGMLFIVASGTAV
Y1413_METJA      VKDAYERALRESEDTALIRMVDNAKKLGANAIIGINSNYAMVGE--KGDMIMVGIYGTAV
                             .          *      .:: .                     ****

Y2488_NOSS1      RVR------------
Y1118_SYNY3      TVD------------
Y1349_HAEDU      VIG------------
Y1668_PASMU      VVR------------
Y226_BACFN       FLE------------
Y270_BACFR       FLE------------
Y3410_BACTN      TIED-----------
YBG4_VIBVU       VIE------------
Y4283_VIBVY      VIE------------
Y2791_GEOSL      VVE------------
Y3751_VIBCH      VVE------------
Y1032_NITEU      FVE------------
Y1619_AROAE      TVE------------
Y892_THET2       KLAP-----------
Y1256_THET8      KLAP-----------
YK44_RHOS4       TIA------------
YBJQ_ECOLI       KTRR-----------
YBJQ_ECOL6       KTRR-----------
YBJQ_ECO57       KTRR-----------
YBJQ_SHIBS       KTRR-----------
YBJQ_SHIDS       KTRR-----------
YBJQ_SHISS       KTRR-----------
YBJQ_SHIFL       KTRR-----------
YBJQ_SALTY       KTRR-----------
YBJQ_SALTI       KTRR-----------
YBJQ_SALCH       KTRR-----------
YBJQ_SALPA       KTRR-----------
Y2666_PECAS      KVRR-----------
Y1048_GLOVI      KLS------------
Y2377_CAUVC      VL-------------
Y3418_PSEF5      RLK------------
Y1745_PSEPF      KLR------------
Y2873_PSEPK      RLK------------
Y240_LISIN       VIEAQDY--------
Y219_LISMF       VIEAQDY--------
Y208_LISMO       VIEAQDY--------
Y208_LISIV       VIEAQDY--------
Y194_LISSS       VIEAQDY--------
Y208_LISWE       VIEVQDY--------
Y208_LISGR       VVE------------
Y562_BIFLO       QIARTA---------
Y060_CORJK       TFQ------------
Y1111_BACHD      KLRRRS---------
Y1405_GEOKA      RLKS-----------
Y2021_RUEPO      VLD------------
Y1265_SYMTH      RLR------------
Y1001_BACAN      RI-------------
Y1012_BACCR      RI-------------
Y904_BACCZ       RI-------------
Y921_BACHK       RI-------------
YA95_BACC1       RI-------------
Y3206_BACHK      RI-------------
Y1816_BACCR      RI-------------
Y6552_BACAN      RI-------------
Y5181_BACCR      RI-------------
Y4874_BACCZ      RI-------------
Y4859_BACHK      RI-------------
YGI4_BACC1       RI-------------
Y465_CARHZ       YIEPEM---------
Y3016_RHOBA      IANPRIPDASH----
Y507_METTH       STEDEE---------
Y643_BACHD       EVEKE----------
Y882_CLOPE       IYEDA----------
Y763_THEMA       KLEKI----------
Y869_ARCFU       RLR------------
YF81_THET2       RLEPARER-------
Y1944_THET8      RLEPAREV-------
Y2432_HALSA      TLA------------
Y2600_NATPD      RLR------------
Y490_PYRAB       VIEREEK--------
Y1682_PYRHO      VVERVEK--------
Y1926_THEKO      VVEKEE---------
Y1756_PYRFU      VVEREK---------
Y3383_METAC      KIMNR----------
Y1617_DEHM1      IVE------------
Y1711_DEHMC      IVE------------
Y1283_VIBPA      KLVE-----------
Y2458_COLP3      KLKK-----------
Y4184_PHOPR      KL-------------
Y2946_ACIAD      IVQPNAPKLPDPFNP
Y1800_HELHP      KILS-----------
Y1287_LACJO      KFID-----------
Y1282_LACSS      KYID-----------
Y2083_LACPL      RFITEDLTTDNA---
Y241_ENTFA       KYI------------
YY10_ENTFL       KFKNQ----------
YJFJ_LACLA       KIEKI----------
Y3412_STRCO      VVARE----------
Y4658_STRAW      VLVKA----------
Y1976_SACS2      VVEKSS---------
Y1080_SULTO      VVTKSI---------
Y544_METTH       IVEPEE---------
Y182_THEAC       LVEDVTDNIQRVGLS
Y671_THEVO       VVEDVSSDIQRVGLS
Y347_PICTO       VTEPVENS-QNVTLS
Y904_BURMA       QAVRAG---------
Y1822_BURP1      QAVRAG---------
Y2003_BURPS      QAVRAG---------
Y595_BURL3       IVEPA----------
Y4322_CHRVO      KLEPLAGREPNP---
Y954_FRATT       VVR------------
Y197_LEGPH       II-------------
Y5168_BACLD      VIG------------
Y1500_CLOTE      KVKGE----------
Y1882_PSEHT      IIEQ-----------
Y1413_METJA      VVEEDG---------