CLUSTAL format seed alignment for MF_00339

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PFKA1_THET8       --------MKRIGVFTSGGDAPGMNAAIRAVVRQAHALGVEVIGIRRGYAGMIQGEMVPL
PFKA_DEIRA        MAYPNPAGIKRVAVLTSGGDAPGMNAAIRAVVRTGAQQGIEVVGVRRGFSGLHRGEVQLL
PFKA1_BACTN       ------MDNKYIGILTSGGDASGMNAAIRAVTRAAIFNGFKVKGIYRGYEGLIAGEVKEL
PFKA2_BACTN       -----MGTVKCIGILTSGGDAPGMNAAIRAVTRAAIYNGLQVKGIYRGYKGLVTGEIKEF
PFKA_COXBU        -----MTEIKKLIVLTSGGDAPGMNAAIRAVVRTALHYQFEVYGATAGFAGLVNGQVVPL
PFKA_ECOLI        -------MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQL
PFKA_SHIDS        -------MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQL
PFKA_SALTY        -------MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQL
PFKA_BUCAI        -------MIKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVQL
PFKA_YERPE        -------MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKL
PFKA_VIBCH        -------MIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDRIKQL
PFKA_ALIF1        -------MVKKIGVLTSGGDAPGMNAAVRGVVRTALTEGLEVFGIHDGYLGLVEDRIEKL
PFKA_HAEIN        -------MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQL
PFKA_MYCHJ        -------MSKKIGILTSGGDAPGMNSAISFLAKSALSLGFEPYLIFDGYSGIIARKILPA
PFKA_MYCPU        -------MIKKIAILTSGGDSPGMNNAIRAIIKTARLYDIETYLVYEGFLGLYNGWIKPS
Q6F1U2_MESFL      --------MKRIGVLTSGGDAPGMNNAIAGVVKAAEAQGIEVYGVRDGYKGLINGWFEKL
PFKA_SPICI        -------MLKKIGILTSGGDSQGMNAAIAGVIKTAHAKGLETYIIRDGYLGLINNWIEVV
PFKA_BACAN        --------MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKL
PFKA_BACCR        --------MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKL
PFKA_GEOSE        --------MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKL
PFKA_BACSU        --------MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKL
PFKA_LACLA        --------MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPL
PFKA_STRR6        --------MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPL
PFKA_ENTFA        --------MKRIGILTSGGDAPGMNAAIRAVVRKSIFDGIEVYGINYGFAGLVAGDIRRL
PFKA_LACPL        --------MKRIGILTSGGDAPGMNAAVRAVAGKAMAEGLEAYGINYGFAGLVAGDIHKI
PFKA_LISMO        --------MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKL
PFKA_CLOBH        --------MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEM
PFKA_CLOAB        --------MKTIAVLTSGGDAPGMNAAIRAVVRTAIEKGINVKGIQRGYSGLINGEIFDM
PFKA_FUSNN        -------MEKKLAILTSGGDAPGMNAAIRATAKIAEYYGFEVYGIRRGYLGMLNDEIFPM
PFKA_THEMA        --------MKKIAVLTSGGDAPGMNAAVRAVVRYGVRQGLEVIGVRRGYSGLIDGDFVKL
PFKA_AQUAE        ---------MRIGILTAGGDAPGMNAVIRAVVRSAEREGHEVIGIKRGYKGLIEGDFIKL
PFKA_WOLSU        ---------MRIGLVCSGGDCAGMNPATKKFVEYSLELGYEPYFIREGLEGLIEGKIEPA
PFKA_SULNB        --------MKNIAILCSGGDVSGMNAALKRFVEYAFDQGLTPFFVENGYEGLIDNKISKA
                             : :. :***  *** .       .            *  *:    .   

PFKA1_THET8       GVRDVANIIQRGGTILLTARSQEFLTEEGRAKAYAKLQAAGIEGLVAIGGDGTFRGALCL
PFKA_DEIRA        GPRDVANTIQRGGTILLTARSHTWRSPEGRAKGAAVLREWGVDGLVVIGGDGSFHGGYFL
PFKA1_BACTN       TTEDVSSIIQRGGTILKTARSETFTTPEGRKKAYKVIQKENINALIIIGGDGSLTGARIF
PFKA2_BACTN       KSQNVSNIIQLGGTILKTARCKEFTTPEGRQLAYDNMKREGIDALVIIGGDGSLTGARIF
PFKA_COXBU        NSRAVANCIQRGGTILKTGRFENFRFKAVRDKAREFLKKLQIDAMIVLGGNGSFAGASKL
PFKA_ECOLI        DRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRL
PFKA_SHIDS        DRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRL
PFKA_SALTY        DRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRL
PFKA_BUCAI        DRYSVSDMINRGGTFLGSARFASFYQDKIRSIAVQNIKKRKIDALVVIGGDGSYIGAQKL
PFKA_YERPE        DRYSVSDMINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGDGSYAGADLL
PFKA_VIBCH        DRSSVSDVINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMGAKKL
PFKA_ALIF1        ERHSVSDMINRGGTFLGSARFPEFKEVAVREKAIENLKKHDIDALIVIGGDGSYMGAKKL
PFKA_HAEIN        NRYSVSDVINRGGTFLGSARFPEFKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLL
PFKA_MYCHJ        KNFPYNGISSFGGTAIGSSRFPEFKKEEVQNKAVEILSEIGISSLVVVGGDGTYNGGYKL
PFKA_MYCPU        EGIDEDSYINKGGTFIFSARFVEFAQEKYRQVAKENLLKLGIEALVVIGGDGSYKGAQKL
Q6F1U2_MESFL      DSKFALEIISKGGTVLGSARLPEFKEESVRQKAVDQLKAHDIEALVVIGGDGSYMGAQRL
PFKA_SPICI        DNNFADSIMLLGGTVIGSARLPEFKDPEVQKKAVDILKKQEIAALVVIGGDGSYQGAQRL
PFKA_BACAN        ELGSVGDIIHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKL
PFKA_BACCR        ELGSVGDIIPRGGTKLYTARCLEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKL
PFKA_GEOSE        EVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKL
PFKA_BACSU        ELGSVGDIIHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKL
PFKA_LACLA        TSASVGDKIGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRL
PFKA_STRR6        DAASVGDIISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRL
PFKA_ENTFA        DVADVGDKIQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMAL
PFKA_LACPL        EAADLDGVIQRGGTLLYSARYPEFAHEEGQLKGIEQLKRFGIDALVVIGGDGSYHGALRL
PFKA_LISMO        ELGSVGDLLHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEAL
PFKA_CLOBH        DTHSVSDIIQRGGTILRTARCEEFRTEQGREKAAKILKAFGIDGLVVIGGDGSFHGAQLL
PFKA_CLOAB        NRHSVSDIIQRGGTILRTARCPEFLKEEVRQKAANVLRVFGIDGLVVIGGNGSFMGAQKL
PFKA_FUSNN        TGRFVSGIIDKGGTVLLTARSEEFKEARFREIAANNLKKKGINYLVVIGGDGSYRGANLL
PFKA_THEMA        EYKDVAGITEKGGTILRTSRCEEFKTEEGRELAAKQIKKHGIEGLVVIGGEGSLTGAHLL
PFKA_AQUAE        TSRDVGGILDRGGTILLSSRDPRYKKLEYREKAYKNLNEQGIEALIILGGEGTLAGAKLT
PFKA_WOLSU        TLKEVSGILHKGGTILQSSRSKRFFDPAFRLQAYQNLQRHSIEALVTLGGDGSFRAMEVL
PFKA_SULNB        DYSDVAGIISIGGTKIRTSRSERFKEISYRQIALENLRGHGIDGLIVLGGDGSFKGMQKL
                             *** : :.*   :     :      :    :  :: :**:*:  .    

PFKA1_THET8       VEE-HGMPVVGVPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHERVFFIEVMG
PFKA_DEIRA        QEE-HGIPVIGVPGTIDNDLYGTDHTIGYFTAVETALEAVDKLRDTGASHERIFVIEVMG
PFKA1_BACTN       AEE-YDVTCIGLPGTIDNDLYGTDFTIGYDTALNTIVECVDKIRDTATSHDRIFFVEVMG
PFKA2_BACTN       AQE-FDVPCIGLPGTIDNDLYGTDTTIGYDTALNTILDAVDKIRDTATSHERLFFVEVMG
PFKA_COXBU        YQE-GGPQMIGIPCTIDNDIQGTDYCIGFDTACNTALQAIDKIRDTAFSHERNFLIEVMG
PFKA_ECOLI        T-E-MGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMG
PFKA_SHIDS        T-E-MGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMG
PFKA_SALTY        T-E-MGFPCIGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMG
PFKA_BUCAI        T-E-MGIPCISIPGTIDNDVSGTDYTIGYFTALQTVVEAIDRLRDTSSSHQRISIVEVMG
PFKA_YERPE        TKE-GGIHCVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQRISIVEVMG
PFKA_VIBCH        TE--MGFPCIGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEIMG
PFKA_ALIF1        TE--MGYPCIGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEVMG
PFKA_HAEIN        TEE-HSFPCVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMG
PFKA_MYCHJ        H-L-KGIKVIALPGTIDNDIQFTDYTIGFDTALNTIVETIDKLRDTANSHRRCFVVEVMG
PFKA_MYCPU        H-E-MGIKTIALPGTIDNDITSSDFTIGYDTALNTIVEAVDKIRDTASSHKRCIMVEVMG
Q6F1U2_MESFL      T-E-MGINCIGLPGTIDNDIVSSDYTIGFDTALNTVIESVEKVRDTMQSHNRAAVIEVMG
PFKA_SPICI        T-E-LGINCIALPGTIDNDITSSDYTIGFDTAINIVVEAIDRLRDTMQSHNRCSIVEVMG
PFKA_BACAN        T-E-QGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMG
PFKA_BACCR        T-E-QGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMG
PFKA_GEOSE        T-E-HGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMG
PFKA_BACSU        T-E-HGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMG
PFKA_LACLA        T-E-HGFPAVGLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMG
PFKA_STRR6        T-E-HGFPAIGLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMG
PFKA_ENTFA        T-K-RGFPAVGIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMG
PFKA_LACPL        T-E-HGYNTIGLPGTIDNDIPYTDFTIGFDTAVNTNVQALDRIYDTAHSHDRTFVVEVMG
PFKA_LISMO        T-K-RGFPTIGIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMG
PFKA_CLOBH        S-K-LGINTVGLPGTIDNDLAYTDYTIGFDTSINTVLDAINKLRDTSTSHERVSVVEVMG
PFKA_CLOAB        S-K-LGVKTVGLPGTIDNDLPYTDYTIGFDTTLNTVLDAINKLRDTSTSHERVSIIEVMG
PFKA_FUSNN        YKE-HGIKVVGIPGTIDNDICGTDFTLGFDTCLNTILDAMSKIRDTATSHERTILIQVMG
PFKA_THEMA        YEE-HKIPVVGIPATIDNDIGLTDMCIGVDTCLNTVMDAVQKLKDTASSHERAFIVEVMG
PFKA_AQUAE        AEE-TGIPVIGVPCTIDNDVGGTEYCIGYDTALRNAVDAIDKIRDTASSHERIFIVEVMG
PFKA_WOLSU        AKE-HSLLYAGIPATIDNDIRASDYALGVDSALNVILESTDRLRDTAESFRRAFVVEVMG
PFKA_SULNB        SDECNDIGFIGIPSTIDNDIAGTQYCLGVDTALNAIRVAIDSIRDTASSFGRAFVIEVMG
                            .:* *****:  ::  :*  :         . : **  *. *  .:::**

PFKA1_THET8       RHAGFIALDVGLAGGAEVIAVPEEPVDPKAVAEVLEASQRR-GKKSSIVVVAEGA--YPG
PFKA_DEIRA        RHAGHIALDVAVAGGAEEVFIPEDKKPIGDVVNIVKDSIAK-GKRGSIIIVAEG---YDG
PFKA1_BACTN       RDAGFLAQNSAIASGAEAAIIPEDRTDVDQLETFIGRGFRK-TKNSSIVIVTESPENKNG
PFKA2_BACTN       RDAGFLALNGAIASGAEAAIIPEFSTEVDQLEEFIKNGFRK-SKNSSIVLVAES--ELTG
PFKA_COXBU        RSSGFIAVNVGIAGGAEIIALPEFHVDIDTLTQKIKKQHGK--KSASIIVAAEAN--QPG
PFKA_ECOLI        RYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKAGIAK-GKKHAIVAITEH----MC
PFKA_SHIDS        RYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKAGIAK-GKKHAIVAITEH----MC
PFKA_SALTY        RYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEIKAGIAK-GKKHAIVAITEH----MC
PFKA_BUCAI        RHCGDLTLAAAIAGGCEFIVLPEIDYKKEDLVIEIQAGIAK-GKKHAIVAITEY----IC
PFKA_YERPE        RYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAK-GKKHAIVAITEK----LD
PFKA_VIBCH        RHCGDLTLTSAIAGGCEYIITPETGLNMEQLISNIKDGIAK-GKKHAIIALTEL----MM
PFKA_ALIF1        RHCGDLTLMSAIAGGCEYVITPETGLNKEALIQNIQDGIAK-GKKHAIIAITEL----MT
PFKA_HAEIN        RHCSDLTISAGIAGGCEYIVASEIEFNREELIQQIERSIIR-GKRHAIIAITEL----LT
PFKA_MYCHJ        RHCQDLALYSAMATGSEILITNTNILTPEEVSQKVLEQFAK-GKPSVIVTITENI---LP
PFKA_MYCPU        HGASDLALYSGMATGSEIIVSNDYKLSVEEMAKIVKKQFEKPNKRSVIITVSEFV---FK
Q6F1U2_MESFL      NGCGDLVTYAAIATQAEIFSPSESKLTVEQICEQA-KKFAEANHRSLIILISEK----QL
PFKA_SPICI        HACGDIALYAGIAGGADIISINEAALSETEIADRV-AMLHQAQKRSVIVVVSEMI---YP
PFKA_BACAN        RHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSER-GKKHSIIVVAEG----VG
PFKA_BACCR        RHAGDIALWAGLADGAETILIPEEEYDMDDVIARLKRGSER-GKKHSIIVVAEG----VG
PFKA_GEOSE        RHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHER-GKKHSIIIVAEG----VG
PFKA_BACSU        RHAGDIALWAGLAGGAESILIPEADYDMHEIIARLKRGHER-GKKHSIIIVAEG----VG
PFKA_LACLA        RNAGDIALNAGIAAGADDICIPEKEFKFENVVNNINKGYEK-GKNHHIIVLAEG----VM
PFKA_STRR6        RNAGDIALWAGIATGADEIIIPEAGFKMEDIVASIKAGYEC-GKKHNIIVLAEG----VM
PFKA_ENTFA        RNAGDIALWSGVAGGADEIIIPEHDFDMKNVAKRIQEGRDR-GKKHCLIILAEG----VM
PFKA_LACPL        RGAGDVALWSGVSIGATAIVVPEVDWDMEEIANKIKHNRAN-GHRSNLIVLAEG----VM
PFKA_LISMO        RDAGDIALWSGLAGGAEAIIVPEESFNMDDVVDRLNKGRER-GKKHSIIVVAEG----VM
PFKA_CLOBH        RNCGDIALYTGVAGGAESIIIPEKEYNADKLCKQILQGKLK-GKMHNLVLLAEG----VG
PFKA_CLOAB        RDCGDIALFSGIAGGAESVIIPEIGYDFNELCKNILEGKLR-GKMHNLIILAEG----VG
PFKA_FUSNN        RRAGDLALHACIAGGGDGIMIPEMDNPIEMLALQLKERRKN-GKLHDIVLVAEG----VG
PFKA_THEMA        RHSGYIALMAGLVTGAEAIIVPEIPVDYSQLADRILEERRR-GKINSIIIVAEG----AA
PFKA_AQUAE        RNRGFIAVEAGLATGAELILIPEERFPREQIPEEIEKAKKL-GKLHFIIVLAEG----YC
PFKA_WOLSU        RDCGYLALASAIACGAEVCIIPEMGYSLQSLGARLKEELGTGKRRYVLAIVSEG----AK
PFKA_SULNB        RECGYLALVSALTSGAEMCLIPEVPYNLEVYKEEFLEEKEQG-RTYFIAVVSEA----LK
                  .    :.    :                               :   :   :*       

PFKA1_THET8       GAAGLLAAIR-EHLQV--EARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALVGGA---
PFKA_DEIRA        GAEAVAQAIH-AGTGL--ETRVSILGHIQRGGTPVSSDRILASRLGEAAVYALMDGK---
PFKA1_BACTN       GAIYYADRVKKEYPGY--DVRVSILGHLQRGGAPSANDRILASRLGEAAIQALMEGQ---
PFKA2_BACTN       GAMHYAERVKNEYPQY--DVRVTILGHLQRGGSPTAHDRILASRLGAAAIDAIMEDQ---
PFKA_COXBU        HSFEVAKQIK-EKTGI--EYRVCVLGHTQRGGTPTVKDRVLASLMGAQAIEALKKGL---
PFKA_ECOLI        DVDELAHFIEKETGR---ETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGY---
PFKA_SHIDS        DVDELAHFIEKETGR---ETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGY---
PFKA_SALTY        DVDELAHFIEKETGR---ETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGH---
PFKA_BUCAI        DVEELAQYIEKKTNR---ETRATILGHIQRGGAPVVYDRILASRMGAYSVELLIKGY---
PFKA_YERPE        DIDSLAKYIEKETGR---ETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDHDYK
PFKA_VIBCH        DANKLAKEIESATGR---ETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGH---
PFKA_ALIF1        DVNQLAKEIEAETGR---ETRATVLGHIQRGGQPGAFDRILASRMGNYGVKLLIDGH---
PFKA_HAEIN        DVHSLAKEIEARVGH---ETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGK---
PFKA_MYCHJ        NLKEFAAKIEELTKI---STRSLEVGHTQRGGRPSAFDRILAAKMAMKAMELINQDK---
PFKA_MYCPU        DLQQVAKQIEELTNI---TTKAVVLAHIQRGGYPSARERINATILGKHAVLRLKQGQ---
Q6F1U2_MESFL      DANELAKKVEEASGY---VTRATILGHVQRGGRPSGMDRYLAFTAAIYAVEKLIEGK---
PFKA_SPICI        DVHKLAKLVESKSGY---ITRATVLGHTQRGGNPTAMDRYRAFQMAQFAVEQIIAGV---
PFKA_BACAN        SAIDIGKHIEEATNF---DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGK---
PFKA_BACCR        SAIDIGKHIEEATNF---DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGK---
PFKA_GEOSE        SGVDFGRQIQEATGF---ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGK---
PFKA_BACSU        SGVEFGKRIEEETNL---ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGK---
PFKA_LACLA        TGEEFATKLKEAGYKG--DLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGI---
PFKA_STRR6        SAAEFGQKLKEAGDIS--DLRVTELGHIQRGGSPTPRDRVLASRMGAHAVKLLKEGI---
PFKA_ENTFA        GGNEFADKLSEYGDF---HTRVSILGHVVRGGSPSARDRVLASKFGSYAVELLKEGK---
PFKA_LACPL        GAQEFVEKLSEYGDF---DARGNTIAHMQRGGNPTAKDRVMASKMGAYAVELLLAGK---
PFKA_LISMO        SGNEFAKQLAEYGDY---HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENR---
PFKA_CLOBH        GANELAKYIEEVTGI---ETRSTILGHIQRGGSPTCMDRILASRMAYKAVELLISGK---
PFKA_CLOAB        GAAELAKKVEEVTGI---ETRSTILGHIQRGGSPSAFDRMLASRMGVKAVEVLMEGK---
PFKA_FUSNN        NVLDIEEKLKGHINS---EIRSVVLGHIQRGGTPSGFDRVLASRMAAKAVEVLNKGE---
PFKA_THEMA        SAYTVARHLEYRIGY---ETRITILGHVQRGGSPTAFDRRLALSMGVEAVDALLDGE---
PFKA_AQUAE        RAKELEDFLLEKIGDKYGEIRSTVLGHIQRGGIPTHFDRIMGTKFGVVAYESLIAGE---
PFKA_WOLSU        ASSEVVSWLKEEVGI---ETRITILGHVQRGGSPSVYDRLMGFRFMQKALDSLSLG----
PFKA_SULNB        NTEQIVRWFEEEIDI---ESRMTVLGHIQRGGIPTVHDRLMAFHFVTSAIDALREGT---
                          .           :   :.*  *** *   :*  .      .   :  .    

PFKA1_THET8       -SGVMVGEVEGEVDLTPLKEAVE----------------RRKDINRALLRLSQVLAL---
PFKA_DEIRA        -KGVMVGRIGGGIAYTPLHETWE----------------KRKDVSRDLYRCAKMLSI---
PFKA1_BACTN       -RNVMIGIRNNEIVYVPFVQAIK----------------KDKPIDKSLIRVLNELSI---
PFKA2_BACTN       -RNVMIGIEHDEIVYVPFSKAIK----------------NDKPVKRDLVNVLKELSI---
PFKA_COXBU        -TEKMIAYQNGKIAVAPLPDPDNG---------------TRYFADEALLRVNNIICAM--
PFKA_ECOLI        -GGRCVGIQNEQLVHHDIIDAIE---------------NMKRPFKGDWLDCAKKLY----
PFKA_SHIDS        -GGRCVGIQNEQLVHHDIIDAIE---------------NMKRPFKGDWLDCAKKLY----
PFKA_SALTY        -GGRCVGIQNEQLVHHDIIDAIE---------------NMKRPFKSDWMECAKKLY----
PFKA_BUCAI        -QGKCVGIQNEKMVFNDIKNALK---------------NMKRTFKKDWLITAKKLY----
PFKA_YERPE        KGGFCVGVQNEKMVHELISVCIAPE-------------NKKSKFKEDWYDTAKKLF----
PFKA_VIBCH        -GGRCVGIQKEQLVHHDIIDAIE---------------NMKRPVRTDLYKVAEELF----
PFKA_ALIF1        -GGRCVGIQNEQLVHHDIIDAIE---------------NMRRPEKLELYKVAEELF----
PFKA_HAEIN        -GGYCVGIQNEQLVHHDIIDAIN---------------NMQRVFKADWLKVAKRLE----
PFKA_MYCHJ        -SGLAISYLDGKIQTFDIAKVVSKP-------------VRKTNDL---VLEINKINQN--
PFKA_MYCPU        -SGIALGLIKNQVAATPILEALAMP-------------QTRKDLLERRTKSYNDINQA--
Q6F1U2_MESFL      -GGLYIGLSENKLVARDIESTLNMP-------------KPDKTEFIEKIRLLNAKISK--
PFKA_SPICI        -GGLAIGNQGDQIIARPIMEALSIP-------------RSSRKEIWAKFDQLNQNIYQKS
PFKA_BACAN        -GGRCVGIQDNKLVDHDIIEALAQ----------------KHTIDKDMYQLSKELSI---
PFKA_BACCR        -GGRCVGIQDNKLVDHDIIEALAQ----------------KHTIDKDMYQLSKELSI---
PFKA_GEOSE        -GGRCVGIQNNQLVDHDIAEALAN----------------KHTIDQRMYALSKELSI---
PFKA_BACSU        -GGRCVGIQNNKLVDHDIIEILET----------------KHTVEQNMYQLSKELSI---
PFKA_LACLA        -GGVAVGIRNEELVESPILGTAEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNL
PFKA_STRR6        -GGVAVGIRNEKMVENPILGTAEEGALFSLTAEGKIVVNNPHEADIELSSLNKSLS----
PFKA_ENTFA        -GGLCIGMLDNQVVAADIIDTLENN---------------KHKPDLSLYELNHEISF---
PFKA_LACPL        -GGLAVGIQNNQLVNHNILDLFES----------------KHDVEVSLDKLNEEISFK--
PFKA_LISMO        -GGLAVGIRENRIVENDISEILKE----------------KHTLDQKLFDLASILSI---
PFKA_CLOBH        -SSRVVGIKNGKIIDMDIDEALAV----------------ERSFDQELYDIATILSK---
PFKA_CLOAB        -TSRVIGIKEGKIMDQDIDEALAV----------------PRSFNKELYDIANMLSK---
PFKA_FUSNN        -AGVMVGIEKNEMVTHPLEEACSVD---------------KRKSIEKDYELALLLSK---
PFKA_THEMA        -VDVMIALQGNKFVRVPIMEALST----------------KKTIDKKLYEIAHMLS----
PFKA_AQUAE        -RSGFVAYEKGKFYIEDFEKAQEY-----------------KPIDREAYKLNTRLAI---
PFKA_WOLSU        -KSGVVVLREGRVEFLSSQEASSA----------------PASLPLDMVRLASRLMF---
PFKA_SULNB        -KSKVVCYDDGMFICKDIKDVAFK----------------KYMIDEDLLALGREFESPQH
                       :      .                                               

PFKA1_THET8       ---
PFKA_DEIRA        ---
PFKA1_BACTN       ---
PFKA2_BACTN       ---
PFKA_COXBU        ---
PFKA_ECOLI        ---
PFKA_SHIDS        ---
PFKA_SALTY        ---
PFKA_BUCAI        ---
PFKA_YERPE        ---
PFKA_VIBCH        ---
PFKA_ALIF1        ---
PFKA_HAEIN        ---
PFKA_MYCHJ        ---
PFKA_MYCPU        ---
Q6F1U2_MESFL      ---
PFKA_SPICI        ---
PFKA_BACAN        ---
PFKA_BACCR        ---
PFKA_GEOSE        ---
PFKA_BACSU        ---
PFKA_LACLA        N--
PFKA_STRR6        ---
PFKA_ENTFA        ---
PFKA_LACPL        ---
PFKA_LISMO        ---
PFKA_CLOBH        ---
PFKA_CLOAB        ---
PFKA_FUSNN        ---
PFKA_THEMA        ---
PFKA_AQUAE        ---
PFKA_WOLSU        ---
PFKA_SULNB        KQV