CLUSTAL format seed alignment for MF_00344

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GUAA_RHIME       -------------------------------MTQTAHPDTVLIVDFGSQVTQLIARRVRE
GUAA_BRUME       -------------------------------MSTTAYPDTILIIDFGSQVTQLIARRVRE
GUAA_AGRFC       -------------------------------MTQIAHPDSILIIDFGSQVTQLIARRIRE
GUAA_BRADU       MGVQTCAVAGRGVVAYLLAMTAAQNDRSASTPSVASAHDKILIVDFGSQVTQLIARRVRE
GUAA_CAUVC       -------------------------------MTQKTDHQRVLIVDFGSQVTQLIARRVRE
GUAA1_BACTN      ------------------------------------MQEKIIILDFGSQTTQLIGRRVRE
GUAA_PORGI       ------------------------------------MLEKLIILDFGSQTTQLIARRIRE
GUAA_CHLTE       ---------------------------------MATSLQSVIVLDFGSQYTQLIARRIRE
GUAA_CAMJE       -----------------------------------MKKADILVLDFGSQYTQLIARRLRE
GUAA_WOLSU       ------------------------------MSIQLHDKVSLLILDFGSQYTQLIARRLRE
GUAA_HELPJ       ---------------------------------------MILVLDFGSQYTQLIARRLRE
GUAA_AQUAE       -----------------------------------MQRRPILVVNFGSQYVQLIARRVRE
GUAA_THEMA       ---------------------------------------MVLVVDYGSQYSRLITRRIRE
GUAA_GLOVI       ---MTSSPTAAARTEGEAAPTVPTQVESGTAQRPGLAREMVAILDFGSQYSELIARRIRE
GUAA_THEEB       -------------------MTHSTLHQPDTATGQGLQRQLIVILDFGSQYSELIARRIRE
GUAA_PROMP       ---------------------------MSKKLLKKERDPSILILDFGSQYSELIARRIRE
GUAA_SYNPX       ---------------------------MSQSSSDGQRQPAIVILDFGSQYSELIARRVRE
GUAA_DEIRA       --------------------------------------MSIVILDFGSQFTRLITRRFRE
GUAA_LACLA       --------------------------------MSDTTLEKIIVLDYGSQYNQLIARRIRE
GUAA_STRMU       -------------------------------MTDIKDIQKIIVLDYGSQYNQLIARRIRE
GUAA_LACPL       -----------------------------MAKTDTASFDSILVLDFGSQYNQLITRRIRD
GUAA_ENTFA       ----------------------------MTNVADLTSVEKIIVLDFGSQFNQLITRRIRE
GUAA_BACCR       ------------------------------MIILKKQHDTIIVLDFGSQYNQLIARRIRE
GUAA_OCEIH       ----------------------------------MENNELVLVLDFGSQYNQLITRRIRE
GUAA_STAES       -------------------------------MEMAKEQELILVLDFGSQYNQLITRRIRE
GUAA_CLOTE       -----------------------------------MKKELVFIIDFGGQYSQLIARRVRE
GUAA_CALS4       ---------------------------------MGIKRETILILDFGGQYTQLIARRIRE
GUAA_MYCPE       -------------------------------------MDKILILDFGGQYTQLIARRIRD
GUAA_MYCTU       ------------------------MVQPADIDVPETPARPVLVVDFGAQYAQLIARRVRE
GUAA_STRAW       ----------------------------MPSAPSAAAPDTVLVVDFGAQYAQLIARRVRE
GUAA_BIFLO       --------------------MFSPRKIPMNVRGISMANGPVLVVDFGAQYAQLIARRVRE
GUAA_TROWT       -------------------------------------MRPVLVVDFGSQYSQLVVRAIRE
GUAA_AERPE       -------------------------------MAKTLDSPGVLVVDFGGQYAHLIARRIRE
GUAA_PYRAE       -------------------------------------MEKVLVVNFGGQYAHLIARRIRE
GUAA_BORBU       -----------------------------------MNTQAILVLDFGSQYSQLIARRIRE
GUAA_FUSNN       -----------------------------------MKKGGIVILDFGSQYNQLIARRVRE
GUAA_ECOLI       -------------------------------MTENIHKHRILILDFGSQYTQLVARRVRE
GUAA_HAEDU       --------------------------------MNNIHNHKILILDFGSQYTQLIARRIRE
GUAA_PSESM       -------------------------------MALDIHAHRILILDFGSQYTQLIARRVRE
GUAA_XYLFT       -------------------------------MTPNIHHDKILILDFGAQYTQLIARRIRE
GUAA_CHRVO       -------------------------------------MDKILILDFGSQVTQLIARRVRE
GUAA_RALSO       ----------------------------MPILSLHNMHDKVLILDFGSQVTQLIARRVRE
GUAA_NITEU       ------------------------------------MHSAILILDFGSQYTRLIARRIRE
GUAA_GEOSL       -------------------------------MSTDIHTEKILILDFGSQYTQLIARRVRE
GUAA_COXBU       -------------------------------MLKDIHQHRILILDFGSQYAQLIARRVRE
GUAA_CHLMU       -------------------------------------MSNILILDFGSQYTNVLAKKIRL
GUAA_WIGBR       -----------------------------------MNNQYILIIDFGSQYTKLVARRMKD
GUAA_BLOFL       --------------------------------MKQCTRQCILIIDFGSQYTQLLLRRIRE
                                                         : ::::*.*  .:: : .: 

GUAA_RHIME       SGVYCEIVPFQSAEEGFHRL-KPKAVILSGSPASTLDTGSPRAPSVIFDSGLPVFGICYG
GUAA_BRUME       ANVYCEIVPFQSADEAFKRL-QPKGVILSGSPHSTTDIGSPRAPQAIFDAGIPVLGICYG
GUAA_AGRFC       AGVYCEIHPFQNAAEAFEKL-QPKGVIFSGGPASVTAEGSPRAPQAVFDSKVPILGICYG
GUAA_BRADU       DGVYCEIVPFNKAEEAFKEM-KPKAVILSGGPESVHEAGSPRAPQLIFASGVPVMGICYG
GUAA_CAUVC       AGVYCEIHPFDKAEAIVDEY-APSAIILSGGPASVLEADSPRIGRKLFDLGLPLLAICYG
GUAA1_BACTN      LDTYCEIVPYNKFPKE--DP-TIKGVILSGSPFSVYDKDAFKVDLSEIRGKYPILGICYG
GUAA_PORGI       LNTYCEVYPYNKLPED--LS-GVRGIILSGSPYSVYDSKAFRIELSELRGKLPLLGICYG
GUAA_CHLTE       IGIYSEIFPYHTKAETIRAH-QPKAIILSGGPNSVYDEKAFMPDPEVFSLGVPVLGICYG
GUAA_CAMJE       QGVYAEILPFNVSLADIKAK-EPKGIILSGGPASVYATDAYFCDKGIFDLNLPVLGICYG
GUAA_WOLSU       YGIYCEIVPYHEKLEAIKAR-EPKGIILSGGPASVYEEDAFLIDKAVFELGIPVLGICYG
GUAA_HELPJ       SGIYAEIVPFFESVENIQKK-APKGLILSGGPASVYAKDAYKPSEKIFDLNLPILGICYG
GUAA_AQUAE       LGVYSEIVHWDTPVEEIKKK-NPYGIIFSGGPASVYAEGAPLPDKRIYELGVPILGICYG
GUAA_THEMA       NEVYSEVVFPDDK-VDLSKV-D--AVILSGGPRSVYEEDAPKLPEWFQEYKGPVLAICYG
GUAA_GLOVI       TKVYSEVLSYQTPIAEIRRL-APKGIILSGGPNSVYEAYAPQCDPALWELGIPILGVCYG
GUAA_THEEB       TQVYSEVISYRTTAEQLAQL-APKGIILSGGPNSVYDENAPQCDPEIWNLGIPILGVCYG
GUAA_PROMP       ADVFSLVVSNFTSVKEIQDI-NPKGIILSGGPSSVYEDNAPKCDAKIFDLGIPILGICYG
GUAA_SYNPX       TEVFSVVLGYSTSAEELRAM-QPKGIVLSGGPSSVYAEHAPLCDPAIWELGIPVLGVCYG
GUAA_DEIRA       LGAYSVILPGTASLERIQQE-NPQGIVLSGGPSSVYDEGAPRPAPGVLDLNVPILGVCYG
GUAA_LACLA       IGVFSELMSHKVTAKEIREI-NPIGIILSGGPNSVYDEGSFDIDPEIFELGLPVLGICYG
GUAA_STRMU       FGIFSELRSHKVTADEVRAI-NPIGIVLSGGPSSVYAEDAFDIDKEILDLGIPVLGICYG
GUAA_LACPL       FGVYSELLPNTITAEEIKAR-HPKGIIFSGGPNSVYDDGAFRVDPEIFKLGLPILGICYG
GUAA_ENTFA       FGVFSELLSHRTTAEEIRKI-APKGIIFSGGPNSVYDKDAFSIDPEIYELGIPILGICYG
GUAA_BACCR       FGVYSELHPHTITAEEIKAM-NPKGIIFSGGPNSVYGEGALHCDEKIFELGLPIFGICYG
GUAA_OCEIH       FGVYSELHSHKLTAEEIKEM-NPKGIILSGGPHSVYDENSFRCDEGIFELGIPVLGICYG
GUAA_STAES       MGVYSELHDHEISIEEIKRM-NPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYG
GUAA_CLOTE       NNVYCEIIPYSTSIEKIKEK-NPKGIIFSGGPNSVYGENSPRISKEIFEIDVPVLGICYG
GUAA_CALS4       ANVYCEIVPYDISPEEIKKI-DPKGIVLSGGPASVYVKNAPKCDKEIFELGYPVLGICYG
GUAA_MYCPE       LNVYSEIVDYDISIEEIIKK-NPKGIILSGGYDSVYGDRSIKPNKGIWDLNIPILGICYG
GUAA_MYCTU       ARVFSEVIPHTASIEEIRAR-QPVALVLSGGPASVYADGAPKLDPALLDLGVPVLGICYG
GUAA_STRAW       ARVYSEIVPSTMPVAEMLAK-NPAAIILSGGPSSVYAEGAPRLDREIFEAGVPVFGMCYG
GUAA_BIFLO       AGVYSELVPHSMPVDEILAK-DPKAIILSGGPASVFEPGAPTIDTKVFESGVPVLGICYG
GUAA_TROWT       CGYYAEFASPSISAAECLAL-SPIAIFLSGGPASAYKDNAPKLDEEILNCGIPVFGICYG
GUAA_AERPE       LGVYSEIVPATSLDALGEALPRAAGVVLSGGPGSVWGSRHDEAAAMVLQLGKPVLGICYG
GUAA_PYRAE       VGVYAEIASPEE-AVIKASKEEVKAVILSGGPSSVYEPGAPDIDEGIFALSKPVLGICYG
GUAA_BORBU       IGVYTKVIPYYTPLKEIKNM-NISGIILSGSPASVYSKEAPTLNMEIFNLKIPILGICYG
GUAA_FUSNN       MGVYAEVVPFHEDVDKILAR-EPKGIILSGGPASVYAEGAPSLDIKLFQNNIPILGLCYG
GUAA_ECOLI       LGVYCELWAWDVTEAQIRDF-NPSGIILSGGPESTTEENSPRAPQYVFEAGVPVFGVCYG
GUAA_HAEDU       IGVYCELWAWDVTEKQIREF-NPTGIILSGGPESTTETNSPHAPEYVFKAGVPVLGICYG
GUAA_PSESM       IGVYCELHPFDMDDEAIREF-APKGVILAGGPESVHEANSPRCPQAVFDLGVPVFGICYG
GUAA_XYLFT       IGVYCEVWPWDHSPEEILSF-GAKGIILSGGPESTTSPGAPAAPQHVFDSDLPIFGICYG
GUAA_CHRVO       AHVYCELHSFDMPIEEIQAF-APKAIILSGGPNSVYES-DYQADPKLFELGVPVLGICYG
GUAA_RALSO       AHVYCEIHPNDVSDAFVREF-APKAIILSGSHASTYEDQDLRAPQAVWDLGVPVLGICYG
GUAA_NITEU       TNVYCELHPFDVSPQFIREF-APIGIILSGGPASTFTEDAPRVPQIVFELGVPVLGICYG
GUAA_GEOSL       AHVYCELHPFDMGLEAIRAF-APKGIILSGGPKSVYEEGAPAVEEALFDLGVPVLGICYG
GUAA_COXBU       IGVYCELMPCDIDEETIRDF-NPHGIILSGGPETVTLSHTLRAPAFIFEIGCPVLGICYG
GUAA_CHLMU       LSVFCEVLPWNTPLEKILQK-SPSGLIFSGGPHSVYQNNSPEVDKEIYNSNIPILGVCYG
GUAA_WIGBR       IGAKFIISSWEIKKKELLKK-NIKGILLSGSPMSVLDDKSPYVSKDILNMKVPILGICYG
GUAA_BLOFL       LGIYAKVCDWNISQDLLVSL-NPNGIIFSGGPDSVTNKHSSSISKVVFKIGVPILGICYG
                       .                 .:.::*.  :.                 *::.:***

GUAA_RHIME       QQTMCAQL-GGKVESGH---HREFGRAFLEVEKDC----PLFDGLWSL-----GSRHQVW
GUAA_BRUME       EQTMCAQL-GGNVESGH---DREFGRAFLDVQEDS----PLFAGIWAK-----GTRHQVW
GUAA_AGRFC       QQTLCTQL-GGVVEGGH---AAEFGRADIDIKKAS----PLFEGFWEQ-----GKSYPVW
GUAA_BRADU       QMTMAAQL-GGEVEGGH---HREFGRADVEVKAQS----KLFEDVWSS-----GSKNQVW
GUAA_CAUVC       QQLLCDVL-SGKVEGGH---AGEFGRAELTIGKDS----PMFQGLAGV-----GGVETVW
GUAA1_BACTN      AQFMAYTN-NGKVEPAG---TREYGRAHLTSFCKD---NVLFKGVRE--------NTQVW
GUAA_PORGI       AQSLVHQA-GGKVEPCD---SREYGRTHLTLRQPD---DALLTGLQS--------GTTVW
GUAA_CHLTE       LQAIAKHF-GGNVESSS---KQEFGRAKMLVNHDES--ESLLFRDIP--------DSDVW
GUAA_CAMJE       MQLMAHHY-KATVAPAG---HKEYGKANIEIKKD----NALFKNLPK--------KQTVW
GUAA_WOLSU       MQLMTHYF-GGVVAKAE---HHEYGKAEVIFDALEGSESKLFEGCHS--------GKVVW
GUAA_HELPJ       MQYLVDFF-GGVVAYAN---EQEFGKAILEIVQN----SVIFEGVKI--------KSLVW
GUAA_AQUAE       LQVITHQL-GGKVVRSE---KQEYGRARLRIIKE----DVIFEGIPK--------ESDVW
GUAA_THEMA       MQLIVKEL-GGEVRRG----RGEYGRTLVELSR-----DPIFEGIPE--------KVHVW
GUAA_GLOVI       MQLMVQQL-GGAVERAE---RAEYGKASLFINDP----TDLFTNVED--------GTTMW
GUAA_THEEB       MQLMVQQL-GGTVERAI---AGEYGKAALFIDDP----TDLLTNVEQ--------ETIMW
GUAA_PROMP       MQLMVKEL-GGEVTPAIN--KAEYGRAPINIDCE----SDLLSNVQD--------KSIMW
GUAA_SYNPX       MQLMVQQL-GGVVEAASG--KAEYGKAPLEVDDP----TDLLTNVTG--------GSTMW
GUAA_DEIRA       MQYLAHEA-GGDVKRAG---KREYGKADL-TEYG----GRLFEGIQG--------EFVAW
GUAA_LACLA       MQLLSYKL-GGMVEAAGER---EYGVAPLQLTGK----SALFAGTPE--------VQDVL
GUAA_STRMU       MQLLTEKL-GGKVVPAGQTGNSEYGQSTLHLTEN----SELFKETPA--------EQTVL
GUAA_LACPL       MQLMTYTLAGGKVESADNR---EYGKANIDVTSDS---ATLFKDTPA--------EQSVW
GUAA_ENTFA       MQLMTHNL-GGKVEPAANR---EYGKAELEILGD----ATLFQGTPA--------KQTVW
GUAA_BACCR       MQLMTQQF-GGKVERANHR---EYGKAVLKVENE----SKLYANLPE--------EQVVW
GUAA_OCEIH       MQLMSLHY-DGKVERSKNR---EYGKALIELDGE----PVLFKDTPK--------GQTVW
GUAA_STAES       MQLTTKLL-GGKVERANER---EYGKATINAKSD-----ELFFGLPS--------EQTVW
GUAA_CLOTE       QQLASFIL-GGKVESAKVR---EYGKTAVNLDNK----CALFEGIDK--------VQECW
GUAA_CALS4       VQLMTELL-GGKVAPAPVR---EYGKTEVVINNT----IPLFKGIER--------DTIVW
GUAA_MYCPE       FQVMMQEN-GGQVENDKDS--EEYGSTDIRLTTN-----ELFENIEL--------DNNCW
GUAA_MYCTU       FQAMAQAL-GGIVAHTGTR---EYGRTELKVL--G---GKLHSDLPE--------VQPVW
GUAA_STRAW       FQLMATTL-GGTVDNTGAR---EYGRTPLHVSKSG---STLFEGTPD--------EQPVW
GUAA_BIFLO       FQVMAYEL-GGKVDKAALG---EYGKTSATID-DA---AGILADSPA--------EQTTW
GUAA_TROWT       FQLLAQAF-GGSVKKANAP---EYGPADITIV--N---KAFFSGQPD--------RQTVW
GUAA_AERPE       HQLLAKVL-GGEVGRSPLP---EFGPTEVEVL-DY---GILLNGLPS--------RFKVW
GUAA_PYRAE       HQMIAKKL-GGKVERG-KG---EYGKTIVKIL-VN---DPLFDGWKP--------EEAVW
GUAA_BORBU       MQIIVKLF-GGLVSKDS---KQEYGSSEIFLRD---EKSLLFSELPN--KFQ------II
GUAA_FUSNN       MQLITHLH-GGKVARAD---KQEFGKAELELDD---KNHILYKNIPN--KTT------VW
GUAA_ECOLI       MQTMAMQL-GGHVEASN---EREFGYAQVEVV----NDSALVRGIEDALTADGKPLLDVW
GUAA_HAEDU       MQTMAMQL-GGLTEASE---QREFGYAAVELQ----HADQLFAKLNDDLTAS-QPKLDVW
GUAA_PSESM       MQTMAEQL-GGKVAGSE---LREFGYARVDVV----GKSRLLDGIEDHIDADGLFGLDVW
GUAA_XYLFT       MQTMAVHL-GGATEAAD---KREFGHASVQVI----YPDTLFSGLSDHPSEF---RLDVW
GUAA_CHRVO       MQFMAQTL-GGKVESGD---KREFGYAQIKAR----HHSKLLEGLQDQIDDAGNGFLDVW
GUAA_RALSO       MFAMTVQQ-GGKVEASA---HREFGYAEVRAH----GHTRLLDSIEDFRTPEGHGMLKVW
GUAA_NITEU       MQAMAAQL-GGEVEDAQ---TREFGYAELLT-----APCKLFHGIQDRINSDGKPALDVW
GUAA_GEOSL       MQLMSRHF-GGEVVPAG---KREFGHADLLAAG---TPGPLFEGFFVEGKSP------VW
GUAA_COXBU       MQTMAYQL-GGKVNRTA---KAEFGHAQLRVL----NPAFLFDGIEDQVSPQGEPLLDVW
GUAA_CHLMU       MQLIARDF-GSEVQGG----KSEFGYTPIVF-----YPSELFKGLADQDAFH----TEIR
GUAA_WIGBR       MHTLVKQL-GGKVERKS---VREFGYASIKILK---NHSNLFYDNFEVSEKNYTKRQKVW
GUAA_BLOFL       MQILVSQC-GGNIRSVSN--KGEFGYAQVEILS---QKNTLIGNLYDYINDQGHCVLEVW
                           .           *:* :             :                   

GUAA_RHIME       MSHGDRVTALPEGFEVVATSSNAPFAFIADEKRK----YYAVQFHPEVVHTP-DGAKLIA
GUAA_BRUME       MSHGDRVTSLPDGFTIIGTSPNAPYAVIADEKRK----YYGVQFHPEVVHTP-DGAKLLQ
GUAA_AGRFC       MSHGDRVTKLPEGFEVIATSENAPFAIAADEKRH----YYTTMFHPEVVHTP-DGGKLLS
GUAA_BRADU       MSHGDRITKMPPGFSVAGTSPNAPFAIIQDEKRK----YYGLMFHPEVVHTP-DGAKLIR
GUAA_CAUVC       MSHGDRVTAIPEGFEVIGTSTGAPFAAIANDAKK----IYALQFHPEVYHTV-NGPAMYR
GUAA1_BACTN      MSHGDTITAIPDNFKKIASTDKVDIAAYQVEGEK----VWGVQFHPEVFHSE-DGTQILR
GUAA_PORGI       MSHGDTITSLPEGFEVIAGTEDVPNAAFRIRGEK----TWGVQFHPEIYHSE-EGTKLLG
GUAA_CHLTE       MSHGDKVTQLPEGFRVTASTANAEVCAIESFGSKAALKVYGLQFHPEVQHSL-YGKQLLS
GUAA_CAMJE       MSHSDKVENLPQGFEVLATSENSPFCVFGNEDKK----FFALQFHPEVQHSE-FGKNILK
GUAA_WOLSU       MSHGDKVEKLPEGFTRIAHSTNSPFAAIAHQEKP----FYAVQFHPEVVHSE-EGALYLK
GUAA_HELPJ       MSHMDKVIELPKGFTTLAKSPNSPYCAIESD--K----IFGLQFHPEVIQSE-EGGKILE
GUAA_AQUAE       MSHADKVVELPEGFEVLAVSENSPYAVIANREKK----IYGFQFHPEVTHTV-FGKEMLA
GUAA_THEMA       MSHGDEVVRLPEGFHPIAVSETGVIAAATDG-KR----FWLLQFHPEVHHTE-YGDRMIS
GUAA_GLOVI       MSHADSVLRMPEGFELLAHTENTPCAAIAHHSRH----LYGVQFHPEVVHSR-GGMALLR
GUAA_THEEB       MSHGDSVTELPPGFRVLAHTDNTPIAAIAHPERK----LYGVQFHPEVVHSV-GGIALIR
GUAA_PROMP       MSHGDSINNLPEGFIKISHTENTLHAAISNKQKK----LFGVQFHPEVIHSE-FGMTVIK
GUAA_SYNPX       MSHGDSVKALPEGFVRLAHTANTPEAAVAHLQRR----LYGVQFHPEVVHST-CGMALIR
GUAA_DEIRA       MSHSDSVTQLPQGYQVVARTEHTPVTAIENNDTR----RYGVQFHPEVVHTP-KGGQMLA
GUAA_LACLA       MSHGDRVTAIPEGFHVVGTSPNSPFAAVENTERN----LYGIQFHPEVRHSV-HGTEMLR
GUAA_STRMU       MSHGDAVTEIPEGFQLVGKSSDCPYAAIENVEKK----IFGIQFHPEVRHTE-YGNAILR
GUAA_LACPL       MSHGDLVTQAPDGFDVVATSKNCPIAAIQDVDRK----LYGIQFHAEVRNTD-YGNDILR
GUAA_ENTFA       MSHGDLVTEIAPGFEKVGTSNDCPIASIEDANRK----FYGVQFHPEVRHSE-YGNDLLR
GUAA_BACCR       MSHGDLVTGLPEGFVVDATSESCPIAGMSNEAKN----LYGVQFHPEVRHSE-HGNDLIK
GUAA_OCEIH       MSHGDKVTAAPPSFNIDATSPSTPIAAISNVEKN----LYGVQFHPEVRHTE-YGNDLLN
GUAA_STAES       MSHSDKVIEIPEGFEVIADSPSTNYAAIEDKKRR----IYGVQFHPEVRHTE-YGNDLLR
GUAA_CLOTE       MSHTDYVSEIPSGFNIVAYTDGCKVAAMANEDKK----IYGVQFHPEVEHTP-FGKKMLK
GUAA_CALS4       MSHTDQIELPPPDFKVVASTENCPIAAIANVEKK----LYGVQFHPEVSHTH-RGTEIIR
GUAA_MYCPE       MSHSDSVIFLPKGFKVIASTNKCLVASACNREKK----FYGVQFHPEVTQTT-FGNQLLQ
GUAA_MYCTU       MSHGDAVTAAPDGFDVVASSAGAPVAAFEAFDRR----LAGVQYHPEVMHTP-HGQQVLS
GUAA_STRAW       MSHGDACSAAPEGFTVTASTDVVPVAAFENDEKR----LYGVQYHPEVMHST-HGQQVLE
GUAA_BIFLO       MSHGVAVEQAPAGFEVLAHTEGAPVAAMADESRK----LYGVQWHPEVKHSP-LGQKLIE
GUAA_TROWT       MSHGDSVIRAPKNFCILSTSQDAVLSFCNR-DRT----IAGVQWHPEVKHSR-FGKHTIK
GUAA_AERPE       MSHYDAVLRPPGEAKVLARTPGSPVAAMELW-GR----VFGVQWHPEVRHTQ-YGREVLD
GUAA_PYRAE       MSHSDFVEEPPPGFHVLAISENGYIAAMRK--GL----IYGVQFHPEVHHTS-KGRVMFE
GUAA_BORBU       MSHGDSIEKIPDNFKQLAFTKNC-IASISNETQK----IYGLQFHPEVTHSE-FGDQIIK
GUAA_FUSNN       MSHGDHVTEMAPDFKIIAHTDSS-IAAIENSDKN----IYAFQYHPEVTHSQ-HGFDMLK
GUAA_ECOLI       MSHGDKVTAIPSDFITVASTESCPFAIMANEEKR----FYGVQFHPEVTHTR-QGMRMLE
GUAA_HAEDU       MSHGDKVTRLPAGFQTTAVTPTCPIAAMSDEKRR----FYGVQFHPEVTHTK-SGLALLT
GUAA_PSESM       MSHGDKVTKLPEDFHILASTPSCPIAGMADDARG----YYGVQFHPEVTHTK-QGGRILS
GUAA_XYLFT       MSHGDHVSRVPPCFTITAATDRIPIAAMSREDKR----WYGVQFHPEVTHTL-QGQALLR
GUAA_CHRVO       MSHGDKVTQLPAGFQVIAETPSCPYAAMADEARG----FYGVQFHPEVTHTK-RGTEMIH
GUAA_RALSO       MSHGDKVTEMPPGFKLMASTPSCPIAGMADEARG----YYAVQFHPEVTHTV-QGRALLE
GUAA_NITEU       MSHGDRVNKLPPGFTAIASNAATPFAAMADETRN----FYGVQFHPEVTHTR-QGKAILD
GUAA_GEOSL       MSHGDHVSRMPQGFQVVAETANAPVCAIQDTARN----LYGVQFHPEVNHTP-RGEILID
GUAA_COXBU       MSHGDIVSELPPGFEATACTDNSPLAAMADFKRR----FFGLQFHPEVTHTP-QGHRILA
GUAA_CHLMU       MSHCDCVVVPPKDFFVIASSQHCPIAAIECPKKK----LFGLQFHPEVSDSQDIGDKILS
GUAA_WIGBR       MSHEDSVINIPKGFSIIASTKNCKYAAIFNKKNK----FYGVQFHPEVTHSE-KGYLILN
GUAA_BLOFL       MSHKDIVETMPQGFTVIGITENQQIAIIINEKCR----WYGIQFHPEVTHTK-KGKDILK
                 ***       .      . .                       :*.*: .:   *     

GUAA_RHIME       NFVHKIAGITGDWTMSAYRAKAVEAIRKQVGDK-KVICALSGGVDSSVAALLIHEAVGDQ
GUAA_BRUME       NFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSG-KVICALSGGVDSSVAALLAHEAVGDQ
GUAA_AGRFC       NFVHKIVGLKSDWTMAAYRAEMIRKIREQVGTG-RVLCALSGGVDSSVAAILIHEAIGDQ
GUAA_BRADU       NFVRKIAGLTGDWTMRAFREEEIAKIRAQVGKG-KVICGLSGGVDSAVAAVLIHEAIGDQ
GUAA_CAUVC       NFLFNIAGLKGDWTMAAFRQEMVQKIRDQVGDG-KVICGLSGGVDSSVAAVLIHEAIGDQ
GUAA1_BACTN      NFVVDVCGCKQDWSPASFIESTVAELKAQLGDD-KVVLGLSGGVDSSVAAVLLNRAIGKN
GUAA_PORGI       NFL-DICGMKRDWTPASFIEATVQELRERLGDD-KVILALSGGVDSSVVAVLLNKAIGRN
GUAA_CHLTE       NFLIDIAGITPDWSPKSFIQHQIEEIKRVAGDS-TVVCGISGGVDSTVAAVLVSKAIGDK
GUAA_CAMJE       NFAKYACNCESIWNMGSFAKTQAEKIREEVGND-KVLCAVSGGVDSSVVAALLASAIKEQ
GUAA_WOLSU       NFALGICGCENDWNMHNFAEEQIKKIQERVKSG-KVLCAVSGGVDSSVVAALLYRAIGEK
GUAA_HELPJ       NFALLVCGCEKTWGMQHFAQREIVRLKEKIANA-KVLCAVSGGVDSTVVATLLHRAIKDN
GUAA_AQUAE       NFIYGVCKAEKNWEMGDFIHEKIEEIRKTVGDA-KVIAALSGGVDSTVAAVLTHRAIGDK
GUAA_THEMA       NFLFNVCKLEKNWKIGDLVEEKIRHIKETIGNK-KAILALSGGVDSSVAAVLVHRAIGKN
GUAA_GLOVI       NFVYHICGCEPEWTTAAFIEEAIREVRARVGDK-RVLLALSGGVDSSTLAFLLHRAIGDN
GUAA_THEEB       NFVYHICDCEPTWTTAAFVEEAIREVRAKVGDK-RVLLALSGGVDSSTLAFLLHRAIGDQ
GUAA_PROMP       NFVYSIAKCKADWTTETFLEETIPRIKQQVGDK-RVLLALSGGVDSSTLAFLLNKAIGKK
GUAA_SYNPX       NFVYHICGCEPDWTTSAFIDEAVAVVREQVGEK-RVLLALSGGVDSSTLAFLLKKAIGDQ
GUAA_DEIRA       NFL-DICGVTRDWNAEHIVDELIEGVRAQVGDTGRVLLGISGGVDSSTLALLLAKAVGER
GUAA_LACLA       NFALNICGAKGNWSMENFIDMQIKNIREKVGDK-KVLLGLSGGVDSSVVGVLLQRAIGDQ
GUAA_STRMU       NFAFNVCKAKGDWSMDSFIDMEIEKIREQVGNR-KVLLGLSGGVDSSVVGVLLQKAIGDQ
GUAA_LACPL       HFAFDVCQAEANWSMDDFIDMQIEKIRAEVGDK-KVLLGLSGGVDSSVVGVLLHKAIGTQ
GUAA_ENTFA       HFAFDVCGCTGDWSMENFIDMEVAKIREQVGDK-KVLLGLSGGVDSSVVGVLLQKAIGDQ
GUAA_BACCR       NFVFGVCGCSEGWNMENFIEVELEKIRETVGDK-KVLCALSGGVDSSVVAVLIHKAIGDQ
GUAA_OCEIH       RFVFDVCGCTGDWSIENFIDMEVEKIQETVGDR-KVLCALSGGVDSSVVAALIHKAIGDQ
GUAA_STAES       NFVRRVCNCTGEWTMENFIEIEIEKIRQQVGNR-KVLCAMSGGVDSSVVAVLLHKAIGEQ
GUAA_CLOTE       NFLFNICELKGDWSVTSFAEEKIKEIRELVGDK-KVICALSGGVDSSVAAVIVHKAIGDQ
GUAA_CALS4       NFLFEVCDCSADWTMDSLIEQTVKEVRAKVGNH-KAVCALSGGVDSAVAAVLVDRAIHDQ
GUAA_MYCPE       NFVYSICDVAGDWEPKNIKLEKIEEIKSIVKDD-YVLCAISGGVDSLVAAVLTAQAIGDK
GUAA_MYCTU       RFLHDFAGLGAQWTPANIANALIEQVRTQIGDG-HAICGLSGGVDSAVAAALVQRAIGDR
GUAA_STRAW       HFLYRGAGLTPSWTTGNVIDEQVELIREQVGTR-RAICGLSGGVDSAVAAALVQKAIGSQ
GUAA_BIFLO       NFLHRCAALPNDWDASSIIEDQVKKIREQVGDA-EVICGLSGGVDSAVAAALVHKAIGDQ
GUAA_TROWT       AFLSSFAA--PNWDPEQTICGTVDSIRKTVGCK-RVLCALSGGVDSVVAATLTHRAIGDR
GUAA_AERPE       NWL-SLVGAPRTWRPGDMVSELVESVKKEVGDA-LAVAAVSGGVDSTVAALIAKKAIGSR
GUAA_PYRAE       NFLRKIARISDVWRPEDQITRIVEEIRSRVKGG-DVIVGVSGGVDSTVTAVLLYKAVGQR
GUAA_BORBU       NFVFKICQAQINWSLEGNLETIVKKIKLKVG-SKKVILGLSGGTDSLVCALLIKKAINEN
GUAA_FUSNN       NFIFGIAKAEKNWSMENYIESTVKQIKERVG-NKQVILGLSGGVDSSVAAALINKAIGRQ
GUAA_ECOLI       RFVRDICQCEALWTPAKIIDDAVARIREQVG-DDKVILGLSGGVDSSVTAMLLHRAIGKN
GUAA_HAEDU       NFVENICGCARSWTPENIIEDAVAKIKQKVG-NDQVILGLSGGVDSSVTALLLHRAIGKN
GUAA_PSESM       RFILDICGCEALWTPSKIAEDAIAQVRAQVG-TDSVLLGLSGGVDSSVVAALLHKAIGDQ
GUAA_XYLFT       RFVVDICGCQTLWTSANIIEDQIARVRERVG-CDEVILGLSGGVDSSVVAALLHKAIGSQ
GUAA_CHRVO       RFVLHVAGCKPSWTMPNYIDEAVKKIREQVG-DEEVILGLSGGVDSSVAAALIHRAIGDQ
GUAA_RALSO       RFVLEIAGAKPDWIMRDHIEEAVKSIREQVG-DEEVILGLSGGVDSSVAAALIHRAIGDQ
GUAA_NITEU       HFVHDICSAGYDWNMPDYVEEAIGRIRARVG-NDKVVLGLSGGVDSSVAAALIHRAIGDQ
GUAA_GEOSL       TFVRKICGCTGQWTPGHIIEDAVNRIRAQVG-RERVILGLSGGVDSSVAAALIHRAIGDQ
GUAA_COXBU       HFVIHICQCIPNWTTKHIIEDSIRDIQEKVG-KEQVIVGLSGGVDSAVTATLVHKAIGDQ
GUAA_CHLMU       NFVKHICQTSETWKIETIEKQLIQGIREKVGETERVLLGLSGGVDSSVLAVLLHNALGDR
GUAA_WIGBR       RFVKNICNYTNVIKYSLSIRKIILKIKNKVN-DEKVILGLSGGIDSFTSAILIHKAIGNN
GUAA_BLOFL       RFAVDICRCEVTWKPVYIVKNIIKTIKKVVG-QDRVVLAFSGGIDSLVTALLLKYAINHE
                  :                       ::        .: ..*** ** . . :   *:  .

GUAA_RHIME       LT-CILVDHGLMRKDEAANVVAMFKEHYNLHLLHIDASDRFIGELEGVSDPETKRKIIGR
GUAA_BRUME       LT-CILVDHGLMRKDEVQQVVEMFREHYNLPLILVDASDRFIGALEGESDPEKKRKTIGR
GUAA_AGRFC       LT-CVYVDHGLMRLGESEQVVGMFRDHYNIPLVHVDAADLFLGELSGVSDPEVKRKTIGR
GUAA_BRADU       LT-CVFVDHGLMRLNEAEQVVDLFRHHYNIPLVHVDASKQFLGELEGVTDPETKRKTIGR
GUAA_CAUVC       LT-CVFVDTGLLRKNEADQVVTLFRDHYNIPLVHVDAGDLFLGELAGVSDPETKRKTIGR
GUAA1_BACTN      LT-CIFVDHGMLRKNE-FKNVMNDYECLGLNVIGVDASEKFFAELAGVTEPERKRKIIGK
GUAA_PORGI       LT-CIFVDHGLLRKGE-FERVLQDYEHLGLNVIGVNAKEKFFAALSGVTDPEQKRKIIGR
GUAA_CHLTE       LH-CVFVDNGLLRKDE-AVKVMEFLKPLGLNISLVDASDLFLGRLKGVASPEKKRKIIGR
GUAA_CAMJE       II-VVFVDNGLLRSGEKEQVEFMFKNTLGIDLISIDASEIFLSRLVNVTDPEQKRKIIGN
GUAA_WOLSU       LI-PVFVDHGLLRAGEREAVEKMFKENLHVPLITVDASEIFLGKLKGVSDPETKRKIIGE
GUAA_HELPJ       LI-AVFVDHGLLRKNEKEKVQAMFKD-LQIPLNTIDAKEVFLSKLKGVSEPELKRKIIGE
GUAA_AQUAE       LH-CFFIDHGLLRYKEREEVEKNLRS-LGLPLTVVDASEEFLEKLKGVEDPEEKRKIIGR
GUAA_THEMA       LV-CVFVDHGLLRKNEREEVERVFKEHFDMNLVVVDARKRFLEKLRGVTDPEKKRKIIGE
GUAA_GLOVI       LT-CMFIDQGFMRKNEPERLVKLFKEQFHIPVAYVDAAERFIVRLEGVSDPEQKRKIIGA
GUAA_THEEB       LT-CMFIDQGFMRKGEPERLLKLFQEQFHIKVEYVNARDRFLAQLVGVTDPEEKRKRIGH
GUAA_PROMP       LT-CMFIDQGFMRKGEPEFLMEFFDKKFHIKVEYINARERFIDKLNGITDPEEKRKIIGR
GUAA_SYNPX       LT-CMFIDQGFMRKGEPEFLMDFFDRKFNIHVEYINARQRFISKLKGITDPEEKRKIIGT
GUAA_DEIRA       LT-AVFIDHGLLRLGERE-QVEAALTPLGVNLVTVDAKDEFLGQLAGVSDPEQKRKIIGR
GUAA_LACLA       LT-SIFVDHGFLRKGEADQVMETLGGKFGLNIIKVDAQKRFMDKLVGLSDPETKRKIIGN
GUAA_STRMU       LT-CIFVDHGLLRKGEGDQVMEMLGGRFGLNIIRVDASKRFLDLLAGIDDPEKKRKIIGN
GUAA_LACPL       LT-SIFVDHGLLRKGEADQVMASLEGKFGLNIIKVDAKDRFLSKLAGVSDPERKRKIIGN
GUAA_ENTFA       LT-CIFVDHGLLRKGEAEQVMESLGGKFGLNIIKVDAKERFLSKLAGVSDPEQKRKIIGN
GUAA_BACCR       LT-CIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDARDRFMDKLKGVEDPEQKRKIIGN
GUAA_OCEIH       LT-CIFVDHGLLRKNEGDDVMKVFAEDFQMNIIKVDAKDRFLFKLEGVSDPELKRKIIGN
GUAA_STAES       LT-CIFVDHGLLRKGEGDMVMEQFGEGFDMNIIRVNAQERFMSKLKGVSDPERKRKIIGN
GUAA_CLOTE       LT-CIFVDHGLLRKDEGDQVESIFKEKFQMNLIRVNAQDRFLGKLKGVTEPERKRKIIGE
GUAA_CALS4       LV-CIFVDTGLLRTNEGDMVIETFRKNYDMNIIRVDAKDRFLSRLKGVTDPEEKRKIIGN
GUAA_MYCPE       LY-CVFVDHGLLRKNESQEVCALLKKLIGKNIFLVDQKQLFLSKLKGVVDPEQKRKIIGK
GUAA_MYCTU       LT-CVFVDHGLLRAGERAQVQRDFVAATGANLVTVDAAETFLEALSGVSAPEGKRKIIGR
GUAA_STRAW       LT-CVYVDHGLMRQGETEQVEKDFVAATGVQLKVVDAEERFLTALKGVSDPEEKRKIIGR
GUAA_BIFLO       LT-CVFVDHGLLRKGEVEQVKHDFVAATGIRLITVDAADDFLDALAGVSEPERKRKIIGE
GUAA_TROWT       LR-CVFVDHGLLRLNEREQVE-EYCSSLGLNVSTYDASDCFLSALSGIRDSEQKRKVIGR
GUAA_AERPE       LY-PVFIDHGLHPEGEVERVV-KLLSRLGLEPVMVDAGEEFLAALEGVGDPEEKRRVVGR
GUAA_PYRAE       VK-AVFIDHGLFREGEPEEAA-SLLKSIGIDVVYIDAKERFLKRLEGVADCEEKRRIIGE
GUAA_BORBU       LI-CVFVNTGLLRKNEDKKILEL-KHQYDLNIKYIDASTKFLNRLKNISDPEEKRKIIGK
GUAA_FUSNN       LT-CIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCINAEERFLTKLAGVTDPETKRKIIGK
GUAA_ECOLI       LT-CVFVDNGLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAGENDPEAKRKIIGR
GUAA_HAEDU       LH-CVFVDNGLLRLNEGDQVMEMFGDKFGLNIIRVNAEERFLEALKGIDEPEAKRKIIGK
GUAA_PSESM       LT-CVFVDNGLLRLHEGEQVMAMFAENMGVKVIRANAEEQFLNNLEGESDPEKKRKIIGR
GUAA_XYLFT       LT-CVFVDTGMLRWGEGDQVMAMFAEHMGVNVVRINAASRYFDALQGVYDPEAKRKIIGN
GUAA_CHRVO       LT-CVFVDHGLLRLNEGKMVMEMFAQNLGVKVVHVQAEADFMAKLAGETDPEKKRKIIGA
GUAA_RALSO       LT-CVFVDHGLLRLNEGQMVLDMFEGRLHAKVVHVDASEQFLGHLTGVTDPEAKRKIIGR
GUAA_NITEU       LV-CVFVDNGLLRLNEAKQIMETFSRNLAVNVIYIDAGRQFLEQLKGITDPEQKRRTIGR
GUAA_GEOSL       LT-CVFVDNGLLRLAEGDQVMATFAENLGVKVIRVDAEQRFLTALADEADPEKKRKIIGN
GUAA_COXBU       LV-CVLVDTGLLRLNEVDEVLNVFQKHLGAKVICVDAKDRFMKALKGISDPEEKRKIAGE
GUAA_CHLMU       LS-CVFVDTGLLRKNEVEEVKQQFS-SLGLEILVVDASEKFFHDLSGIEDPEQKRKVIGA
GUAA_WIGBR       LF-CICIDNGLLRNDEILKIKNLIKKVGKINVIYINHKKRFLKSLNGITDPEKKRKTIGN
GUAA_BLOFL       QFVCVFVNNGLLCCNEINRISNFCKKYQDLNIIHLSEEKRFLSALTGVIDPEEKRKIIGK
                     . :: *:    *                        ::  * .    * **:  * 

GUAA_RHIME       LFIEVFEEEAKKLGG--------ADFLAQGTLYPDVIESVSFTGGP------SVTIKSHH
GUAA_BRUME       LFIEVFEEEARKLGG--------ADFLVQGTLYPDVIESVSFTGGP------SVTIKSHH
GUAA_AGRFC       LFIEVFEAEAAKIAADG---KGAPKFLAQGTLYPDVIESVSFSGGP------SVTIKSHH
GUAA_BRADU       LFIEVFEAEAKKIGG--------ADFLAQGTLYPDVIESVSFTGGP------SVTIKSHH
GUAA_CAUVC       LFIDVFDKEAAKIEG--------ATFLAQGTLYPDVVESVSARGGP------SAVIKSHH
GUAA1_BACTN      GFIDVFDVEAHKIKD--------VKWLAQGTIYPDCIESLSITG---------TVIKSHH
GUAA_PORGI       GFIEVFDEEARKLKD--------IKWLGQGTIYPDVIESLSITG---------MVIKSHH
GUAA_CHLTE       TFIQVFE---KNIHD--------EKFLVQGTLYPDVIESVSVKGP-------SETIKSHH
GUAA_CAMJE       TFIEVFEEEAKKHK--------DVKYLAQGTLYTDIIESSVV-GA-------SKTIKSHH
GUAA_WOLSU       TFIEVFDVEAKKHD--------GIQYLAQGTLYPDVIESVSVKGP-------SKTIKSHH
GUAA_HELPJ       TFIEVFEKEAKKHHL-----KGKIEFLAQGTLYPDVIESVSVKGP-------SKVIKTHH
GUAA_AQUAE       TFIEVFEREAKKIEG--------AEFLLQGTLYPDVVESAGI--KG------SAKIKTHH
GUAA_THEMA       EFIRVFEEEAKKHD---------VEFLVQGTIYSDVIESAASG-KT------TAKIKSHH
GUAA_GLOVI       EFIRVFESESQRLGPFD--------YLAQGTLYPDIIESAGENIDPKTGERVAVKIKSHH
GUAA_THEEB       EFIRVFEEESQRLGPFD--------YLAQGTLYPDVIESANTNIDPQTGERVAVKIKSHH
GUAA_PROMP       EFIRVFEEESNRLGPFQ--------YLAQGTLYPDVIESAGTNLDPKTGERIAVKIKSHH
GUAA_SYNPX       EFIRVFEEESKRLGPFD--------YLAQGTLYPDVIESAGTNVDPKTGERVAVKIKSHH
GUAA_DEIRA       EFIRAFERETAKLGDFE--------FLAQGTLYPDVIESAGGE--------GAANIKSHH
GUAA_LACLA       EFVYVFDDEANKLEGVD--------FLAQGTLYTDVIESGTD---------TAQTIKSHH
GUAA_STRMU       EFVYVFDDEASKQKGVD--------FLAQGTLYTDVIESGTE---------TAQTIKSHH
GUAA_LACPL       EFIQVFDEEATKLNGME--------FLAQGTLYTDVIESGTS---------TAQTIKSHH
GUAA_ENTFA       EFVYVFDDEATKLAGEEG-----VSFLAQGTLYTDVIESGTE---------TAQTIKSHH
GUAA_BACCR       EFIYVFDDEASKLQGMD--------FLAQGTLYTDIVESGTA---------TAQTIKSHH
GUAA_OCEIH       EFIYVFDDEASKLKDID--------FLAQGTLYTDVIESGTD---------TAQTIKSHH
GUAA_STAES       EFVYVFDDEAAKLTDVD--------FLAQGTLYTDVIESGTK---------TAQTIKSHH
GUAA_CLOTE       EFIRVFEEEANKLGKID--------YLVQGTIYPDVVESGTD---------TSATIKSHH
GUAA_CALS4       VFIEVFKEEAMKIGDVK--------FLVQGTLYPDVIESGHG---------ISSTIKSHH
GUAA_MYCPE       TFIEVFEKVANKINVPF-------KYLLQGTIYPDIVESGSK---------FSKTIKSHH
GUAA_MYCTU       QFIRAFEGAVRDVLD-----GKTAEFLVQGTLYPDVVESGGGS--------GTANIKSHH
GUAA_STRAW       EFIRVFEQAQAEIIADE---GPEVAFLVQGTLYPDVVESGGGT--------GTANIKSHH
GUAA_BIFLO       KFIRTFEKAQRQVLEEAGARGKEVKFLVQGTLYPDVVESGGGD--------GAANIKSHH
GUAA_TROWT       EFIACFSKLQERFDI-------KPHFLLQGTLYPDLVESGATP--------GGATIKSHH
GUAA_AERPE       VYAEVLERAARDI---------GAEYLVQGTIYPDVIESGARP--------GADTIKTHH
GUAA_PYRAE       TFAEVFSDAVKQMP--------NVKYLAQGTLYPDVVESGAVK--------GADKIKSHH
GUAA_BORBU       EFVDVFEKITLEDQNI--------EYLAQGTIYSDVIESKSKD-------SSSSKIKSHH
GUAA_FUSNN       EFVEVFNEEAKKIEGA--------EFLAQGTIYPDVIESVSVK-------GPSVTIKSHH
GUAA_ECOLI       VFVEVFDEEALKLEDV--------KWLAQGTIYPDVIESAASA------TGKAHVIKSHH
GUAA_HAEDU       VFIDIFDDEAKKLTDV--------KWLAQGTIYPDVIESAASK------TGKAHVIKSHH
GUAA_PSESM       TFIDVFDAESCKLDNI--------KYLAQGTIYPDVIESAGAK------SGKAHVIKSHH
GUAA_XYLFT       LFIQIFEEEASKRKQA--------KWLAQGTIYPDVIESAGSK------TGKAHVIKSHH
GUAA_CHRVO       EFIEVFDRESGKLTNA--------KWLAQGTIYPDVIESAGAK------TKKAHTIKSHH
GUAA_RALSO       EFVEVFQAEAKTLTNA--------KWLAQGTIYPDVIESGGAK------TKKATTIKSHH
GUAA_NITEU       EFVEIFQQEAEKIENA--------KWLAQGTIYPDVIESAGSH------TKKAGVIKSHH
GUAA_GEOSL       LFVEIFEEESSRIEGA--------TWLAQGTIYPDVIESAGAK------TGKAHNIKSHH
GUAA_COXBU       QFIRVFEEQAKKL-NV--------KWLGQGTIYPDVIESAKTK------TGKGHIIKTHH
GUAA_CHLMU       AFIEVFDEASKNL-DV--------QWLAQGTIYSDVIESAKS-------CDATQVIKSHH
GUAA_WIGBR       LFFKIFQEQADILKA---------KWLAQGTIYPDIIESSQNNL-----LKKDNFIKSHH
GUAA_BLOFL       IFVEIFQAQISQLKNI--------KWLAQGTIYSDVIESGMS-------CASANIIKSHH
                  :   :.                  :* ***:*.* :**                **:**

GUAA_RHIME       NVGGLPERMNMQLVEPLRELFKDEVRVLGRELGLPESFIGRHPFPGPGLAIRCPGGITRE
GUAA_BRUME       NVGGLPERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTRE
GUAA_AGRFC       NVGGLPERMNMQLVEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRCPGAITRE
GUAA_BRADU       NVGGLPERMNMKLVEPLRELFKDEVRKLGRELGLPEIFVGRHPFPGPGLAIRCPGDITSD
GUAA_CAUVC       NVGGLPDYMKLKLVEPLRELFKDEVRALGVELGLAPAFVGRHPFPGPGLAIRIPGEITPE
GUAA1_BACTN      NVGGLPEKMHLKLCEPLRLLFKDEVRRVGRELGMPEHLITRHPFPGPGLAVRILGDITRE
GUAA_PORGI       NVGGLPERMNLRLVEPLRMLFKDEVRRVGLELGMMPHLIHRHPFPGPGLGIRILGEITEE
GUAA_CHLTE       NVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFPGPGLAVRVLGSLTRE
GUAA_CAMJE       NVGGLPEKMNLKLIEPLKEIFKDEVRALGLELGLSKEVVYRHPFPGPGLAIRIMGEVNRA
GUAA_WOLSU       NVGGLPDWMTFELIEPLRELFKDEVRALGAELGMPREMLMRHPFPGPGLAIRIMGEVNFE
GUAA_HELPJ       NVGGLPEWMDFKLIEPLRELFKDEVRLLGKELGVSQDFLMRHPFPGPGLAIRILGEINEN
GUAA_AQUAE       NVGGLPERMNLKLLEPFRELFKDEVRKIGKLLGVPEEILRRHPFPGPGLAIRIIGEVNKK
GUAA_THEMA       NVGGLPEKMNLKLVEPLRDLFKDEVRKVGKYLGIPDRIINRHPFPGPGLAVRVLGEVTEE
GUAA_GLOVI       NVGGLPENLRFKLVEPLKRLFKDEVRQVGRALGLPEEIVQRQPFPGPGLAIRVLGELTKD
GUAA_THEEB       NVGGLPENLRFKLVEPLRKLFKDEVRQVGRSLGLPEEIVQRHPFPGPGLAIRILGEVTPE
GUAA_PROMP       NVGGLPKDLQFKLVEPLRKLFKDEVRKVGGALGLPDEIIKRHPFPGPGLAIRILGDVSHE
GUAA_SYNPX       NVGGLPKDLQFKLVEPLRKLFKDEVRKVGRALGLPEEIVRRHPFPGPGLAIRILGEVTDE
GUAA_DEIRA       NVGGLPDDVQFKLVEPFRTLFKDEVREIARLLGLPDHIRMRHPFPGPGLAIRCLGEVTAE
GUAA_LACLA       NVGGLPEDMQFQLIEPLNTLFKDEVRALGTQLGMPDEIVWRQPFPGPGLAIRVLGDLTEE
GUAA_STRMU       NVGGLPEDMQFELIEPLNTLFKDEVRTLGTALGMPDEIVWRQPFPGPGLAIRVMGEITAE
GUAA_LACPL       NVGGLPEDMQFKLIEPLRTLFKDEARELGEKLGMPSDLVWRQPFPGPGLGIRVIGEITED
GUAA_ENTFA       NVGGLPEDMQFELIEPLNTLFKDEVRALGTELGMPDAIVWRQPFPGPGLGIRVLGEITED
GUAA_BACCR       NVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEE
GUAA_OCEIH       NVGGLPEDMQFTLIEPLNTLFKDEVRELGSQLGVPDRIVWRQPFPGPGLAIRILGEVTEE
GUAA_STAES       NVGGLPEDMEFELIEPINTLFKDEVRALGIELGIPEHLVWRQPFPGPGLGIRVLGEITED
GUAA_CLOTE       NVGGLPEDIEFELIEPLRELFKDEVRRVGEELGIPHKLVWRQPFPGPGLGIRVLGEVTEE
GUAA_CALS4       NVGGLPEDIGFELIEPLRMLFKDEVRQVGKELGIPDEILYRQPFPGPGLAVRIVGEVTEE
GUAA_MYCPE       NVGGLPERLQFELLEPLKYLFKDEVRKLGLSLDIPYQNVYRQPFPGPGLAVRVLGEITED
GUAA_MYCTU       NVGGLPDDLKFTLVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLGIRIVGEVTAK
GUAA_STRAW       NVGGLPEDLEFELIEPLRKLFKDEVRMVGQELGLPDEIVQRQPFPGPGLGIRIVGEVTKE
GUAA_BIFLO       NVGGLPKDIKFQLIEPLRTLFKDEVRAIGTELGLPDEIVWRQPFPGPGLGIRIIGEITKE
GUAA_TROWT       NVGGLSDNLGFELLEPLKYLFKDEVRKIGLQLGIPKHIVHRQPFPGPGLAIRIIGEVTNK
GUAA_AERPE       NVGGLPKDMRLKLVEPLRYFYKDEVRLLAEKLGVPRELIWKQPVPGPGLAVRVEGPITRE
GUAA_PYRAE       NVGGLPPWFQLELIEPLREFYKDEVRRIAKALGLPEDVVYRHPFPGPGLAVRIIGPFTRE
GUAA_BORBU       NVGGLPDKMSLKLLEPLNEFFKDEIIQIGINLGIKKESLYRHPFPGPGLAIRIIGEVTQE
GUAA_FUSNN       NVGGLPEDLKFELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKE
GUAA_ECOLI       NVGGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKE
GUAA_HAEDU       NVGGLPDYMKLGLVEPLRELFKDEVRKIGLTLGLPAEMLNRHPFPGPGLGVRVLGEIKKE
GUAA_PSESM       NVGGLPEEMNLKLVEPLRELFKDEVRRLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKE
GUAA_XYLFT       NVGGLPEQMTLGMVEPLRELFKDEVRRLGVALGLPHAMVYRHPFPGPGLGVRILGEVKPE
GUAA_CHRVO       NVGGLPEDMNLKLLEPLRELFKDEVRQLGVALGLPHDMVYRHPFPGPGLGVRILGEVKKE
GUAA_RALSO       NVGGLPETLGLKLLEPLRDLFKDEVRELGVALGLPPEMVYRHPFPGPGLGVRILGEVKRE
GUAA_NITEU       NVGGLPETLHLKLLEPLRELFKDEVRELGLALGLPHDLVFRHPFPGPGLGVRILGEVKYE
GUAA_GEOSL       NVGGLPEYMKLKLLEPLRELFKDEVRAIGEELGLPRQMVWRHPFPGPGLGVRILGEVKKE
GUAA_COXBU       NVGGLPLNMELKLIEPLRELFKDEVRKLGLELGLPADLIYRHPFPGPGLAIRILGEVSAE
GUAA_CHLMU       NVGGLPEKLNLKLLEPLRFLFKDEVRALGKVLGLPDVLISRHPFPGPGLGVRVLGEVRRE
GUAA_WIGBR       NVCPLPKGIKLKILEPLKHLFKDEVKKIAKKIGIPKEIIFRHPFPGPGLAVRIIGEIKEE
GUAA_BLOFL       NVGGFPSSVNIQLLEPIKDLFKDEVRNIGLYLGLPLNVVNQYPCPGPGMAIRILGEVREE
                 **  :.  . : : **:. ::***   :.  :.:      : * ****:.:*  * .   

GUAA_RHIME       KLEILREADAIYLDEIRKAG-------------------LYDAIWQAFAVLLPV-QTVGV
GUAA_BRUME       KLEILREADAIYLDEIRKAG-------------------LYDAIWQAFAVLLPV-QDRGR
GUAA_AGRFC       KLDILRKADAIYLDEIRKAG-------------------LYDTIWQAFAVLLPV-QTVGV
GUAA_BRADU       KLDILRKADAVYIDQIRKHG-------------------LYDDIWQAFAVLLPV-KTVGV
GUAA_CAUVC       KVKVLQDADAIYLEEIRNAG-------------------LYDQIWQAFAVLLPV-KTVGV
GUAA1_BACTN      KVRILQDADDIYIQGLRDWG-------------------LYDQVWQAGVILLPV-QSVGV
GUAA_PORGI       KATILQNADDIYMSLMREWG-------------------LYDQVWQAGAILLPV-RSVGV
GUAA_CHLTE       RLDVLRDADQIFIDELKSSG-------------------LYSKVWQAFSVLLPV-QSVGV
GUAA_CAMJE       SLELLRKADVILLEELKSTG-------------------WYDKTWQAFCVLLNV-KSVGV
GUAA_WOLSU       DLELLRKADVIMLDELKKSG-------------------FYDKTWQAFTVLLNV-RSVGV
GUAA_HELPJ       KIKRLQEADAIFIEELKKAN-------------------LYDKVWQAFCVLLNV-NSVGV
GUAA_AQUAE       DLEILRKADYIFIQELKKEG-------------------LYDRVWQAFAVLLPV-KSVGV
GUAA_THEMA       KLEILREADYIFIETLRKHD-------------------YYDKVWQAFAVLLPI-KSVGV
GUAA_GLOVI       KVDILREADFILRQEVNRSG-------------------RYNDYWQSFAVLLPV-KTVGV
GUAA_THEEB       RLEILRDADLIVRQEINRAQ-------------------MYHELWQAFAVLLPI-RTVGV
GUAA_PROMP       KLNCLRDADWIVRDEIKKAG-------------------LYNDIWQAFAVLLPV-KTVGV
GUAA_SYNPX       KLNCLRDADLIVREEIREAG-------------------LYHEIWQAFAVLLPV-RSVGV
GUAA_DEIRA       KVDILQRVDDIFISGLREFG-------------------LYDGCSQALAVLTPI-QSVGV
GUAA_LACLA       KLETVRESDAILREEIAAAG-------------------LERDVWQYFTVNTDV-KSVGV
GUAA_STRMU       KLETVRESDAILREEIAAAG-------------------LNRDIWQYFTVNTGV-RSVGV
GUAA_LACPL       KLEIVRDSDFILRDEIKKAG-------------------LDREIWQYFTVLPGI-KSVGV
GUAA_ENTFA       KLQIVRDSDAILREEIAAAG-------------------LDRDIWQYFTVLPGI-RSVGV
GUAA_BACCR       KLEIVRESDAILREEIIKAG-------------------LDREIWQYFTALPGM-RSVGV
GUAA_OCEIH       HLEIVRESDAILREEIAKAG-------------------LDRDIWQYFTVLPNI-KSVGV
GUAA_STAES       KLEIVRESDAILREVIREEG-------------------LERDIWQYFTVLPGI-QSVGV
GUAA_CLOTE       KLEIVREADAIFREEIANAG-------------------LDEKIWQYFACLPNI-RSVGV
GUAA_CALS4       KLEILRLADSIVQREMKRFG-------------------WYNKVWQSFAILPGI-KSVGV
GUAA_MYCPE       KLEIVREADFLFRSYIDQLYK-----------------NSEHKPWQYFTVLTNS-KSVGV
GUAA_MYCTU       RLDTLRHADSIVREELTAAG-------------------LDNQIWQCPVVLLADVRSVGV
GUAA_STRAW       RLDLLREADAIAREELTAAG-------------------LDREIWQCPVVLLADVRSVGV
GUAA_BIFLO       RLDLLREADAIAREELSKAG-------------------LDRDIWQCPVVLLADVHSVGV
GUAA_TROWT       KLSILRAADAIVRHELRDW----------------------TDIWQCPVILLSDVQSVGV
GUAA_AERPE       KLRIVRRADAIVREEVEAAG-------------------LGGKLWQYFAVLTAS-MATGV
GUAA_PYRAE       KLAIVRKATKIVEEELRKAG-------------------LFRKVWQAFATVGED-KWVGV
GUAA_BORBU       KINILQEADNILTEELFIN-------------------DLYYQIRQAFVVLLPV-KSVGV
GUAA_FUSNN       KADILREADAIFIEELRKA-------------------DLYNKVSQAFVVLLPV-KSVGV
GUAA_ECOLI       YCDLLRRADAIFIEELRKA-------------------DLYDKVSQAFTVFLPV-RSVGV
GUAA_HAEDU       YCDLLRNADAIFIEELYKS-------------------GWYYKVSQAFTVFLPV-KSVGV
GUAA_PSESM       YADILRRADHIFIEELRKA-------------------DWYHKVSQAFVVFQPV-KSVGV
GUAA_XYLFT       YAELLAKADSIFIDELHQA-------------------DLYDKVSQAFAVFLPV-KSVGV
GUAA_CHRVO       YADLLRQADAIFIEELRNT------------VDEKTGKNWYELTSQAFAVFLPV-KSVGV
GUAA_RALSO       YADLLRRADAIFIEELRGTKATAQDAVAGLCTEDQVGKSWYDLTSQAFAVFLPV-KSVGV
GUAA_NITEU       YTELLRQADAIFIEELRNA-------------------GWYEKTSQAFAVFLPI-KSVGV
GUAA_GEOSL       YADILRRADAIYIEELYAA-------------------GHYDKISQAFAVFLPV-KSVGV
GUAA_COXBU       YINILKQADAIFIEELKKS-------------------DYYHQVSQAFAVFMPL-KSVGV
GUAA_CHLMU       YVEIVKNADSIFIEELKKA-------------------NLYHKVSQAFAVFLPC-KSVAV
GUAA_WIGBR       YCNILRMADEIFISELKSE-------------------NLYFNISQAFSVLLPI-KSVAV
GUAA_BLOFL       YCNILRRVDYIFMEELNKS-------------------DLYNTVDQAFAVFLPV-QSVGV
                     :     :    :                             *            . 

GUAA_RHIME       MGDGRTYEFVCALRAVTSVDGMTADFYHYDMEFLGRAATRIINEVRGINRVVYDVTSKPP
GUAA_BRUME       DGGWPHLRIRLRLARGDFGGRHDGGFLPLRHEFPRQCGHPHHQRSPRHQPRCL-------
GUAA_AGRFC       MGDYRTYDFVCALRAVTSVDGMTADFYPYDMNFLGRAATRIINEVRGINRVVYDVTSKPP
GUAA_BRADU       MGDGRTYDYVVGLRAVTSTDGMTADFYQFDMKFLGETATRIINEVKGVNRVVYDVTSKPP
GUAA_CAUVC       MGDARTYENVLALRAVTSTDGMTADFFEFPWPVLGKTATRIINEVRGVNRVVYDVTSKPP
GUAA1_BACTN      MGDERTYERAVALRAVTSTDAMTADWAHLPYEFLGKISNDIINKVKGVNRVTYDISSKPP
GUAA_PORGI       MGDERTYEYTVALRAVTSMDAMSADWVHLPYDFLAKVSNEIINKVRGVNRVVYDISSKPP
GUAA_CHLTE       MGDKRTYENVLALRAVESTDGMTADWAHLPHDFLAKVSNRIINEVRGINRVVYDISSKPP
GUAA_CAMJE       MGDNRTYDNAVCIRVVDASDGMTATFSHLPYEILENISRRIINEVEGINRVVYDISSKPP
GUAA_WOLSU       MGDNRTYDNTVCVRVVEAIDGMTATFAHLPHELLERMSTRIINEVDGINRVVYDISSKPP
GUAA_HELPJ       MGDNRTYENAICLRAVNASDGMTASFSFLEHSFLEKVSNRITNEVNGINRVVYDITSKPP
GUAA_AQUAE       MGDVRTYEKVVALRAVESVDGMTADWARLPYDFLDRVMRRIINEVEGVNRVVYDISSKPP
GUAA_THEMA       KGDARAYEYVVALRAVNSVEGMTADWSRIPHDILDEAARRITREVKGVGRVVYDITSKPP
GUAA_GLOVI       MGDRRTYAYALALRFVTSEDGMTADWARVPYDLLEQIANRIVNEVPGINRVVLDITSKPP
GUAA_THEEB       MGDQRTYAYPVVLRFVTSEDGMTADWARVPYDLLERISNRIVNEVPGVNRVVYDITSKPP
GUAA_PROMP       MGDKRTYAWPIVLRCVSSEDGMTADWSRIPYETLERISNRIVNEVEQVNRVVFDITSKPP
GUAA_SYNPX       MGDKRTYAWPIVLRCVSSEDGMTADWSRLPYDLMETISNRIVNEVKGVNRVVLDITSKPP
GUAA_DEIRA       MGDERTYSYTAALRAVTTDDFMTAEWARLPYDFLATMSNRIVNQVHEINRVVYDITGKPP
GUAA_LACLA       MGDQRTYDYTLAIRAITSIDGMTADFAQLPWDLLQKISKRIVNEVDHVNRIVYDITSKPP
GUAA_STRMU       MGDGRTYDYTIAIRAITSIDGMTADFARIPWEVLQKISVRIVNEVEHVNRIVYDITSKPP
GUAA_LACPL       MGDGRTYDYTVGIRAVTSIDGMTADFARIPWDVLQKISVRIVNEVDHVNRIVYDVTSKPP
GUAA_ENTFA       MGDGRTYDYTVGIRAVTSIDGMTADFARIPWDVLQKISVRIVNEVAHVNRIVYDITSKPP
GUAA_BACCR       MGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPP
GUAA_OCEIH       MGDARTYAHTIGIRAVTSIDGMTSDWARIPWDVLERISTRLVNDVDNINRVVYDVTSKPP
GUAA_STAES       MGDYRTYDHTVGIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPP
GUAA_CLOTE       MGDERTYSHTIGLRAVNSSDGMTSDWAKIPYEVLDKVSIRIVNEVKGVNRIVYDITSKPP
GUAA_CALS4       MGDERTYGYAIILRVVDSMDGMTADWTKLPYEILESISTSITNEVPGVNRVLYDITSKPP
GUAA_MYCPE       VGDNRSYGYTLALRAVDSMDAMSAKWYKIPLEHLEKISSIICNKVKNISRVVYDITNKPP
GUAA_MYCTU       QGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNEVAEVNRVVLDITSKPP
GUAA_STRAW       QGDGRTYGHPIVLRPVSSEDAMTADWSRLPYDTLAKISTRITNEVADVNRVVLDVTSKPP
GUAA_BIFLO       QGDERTYGSPIVLRPVSSEDAMTADWSRVPYDVLATISTRITNECRQINRVVLDCTSKPP
GUAA_TROWT       RGDSRSCGFPIVIRPVSSDDAMTADWYRLPYDVLARISGRITNEIPEIVRVVLDITPKPP
GUAA_AERPE       RGDSRSYGYVVAVRAVESVDAMTAKPAELPWWLLERIARRITSEIPEVVRVVYDITSKPP
GUAA_PYRAE       KGDRRAMGYIVTVRIVESEDAMTADWSRIPFEILEKISSRITSEIPEVTMVTYAVTSKPP
GUAA_BORBU       MGDQRTYEYTAVIRCVNTQDFMTAEWTELPYSFLKKVSSRIINEVRGINRVCYDISSKPP
GUAA_FUSNN       MGDERTYEYTAVLRSANTIDFMTATWSHLPYEFLEKVSNRILNEVKGINRLTYDISSKPP
GUAA_ECOLI       MGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPP
GUAA_HAEDU       MGDGRKYDWVVSLRAVETIDFMTAHWAHLPYELLGKISNRIINEVNGISRVVYDVSGKPP
GUAA_PSESM       VGDGRRYAWVVALRAVETIDFMTARWAHLPYELLETVSGRIINEIEGISRVTYDVSSKPP
GUAA_XYLFT       VGDARAYEWVIALRAVETVDFMTAHWAPLPYDFLSTVSNRIINELRGVSRVVYDISGKPP
GUAA_CHRVO       MGDGRTYDYVVALRAVVTSDFMTAHWAELPYSLLGRASNRIINEVRGINRVVYDVSGKPP
GUAA_RALSO       MGDGRTYDYVVALRAVQTTDFMTAHWAHLPYALLGRVSNRIINEVRGINRVVYDVSGKPP
GUAA_NITEU       MGDNRSYEYVVALRAVQTEDFMTAHWAELPYTLLSRISNRIINEIRGINRVVYDISGKPP
GUAA_GEOSL       MGDGRTYEYVIALRAVETKDFMTAGWYPLPYEDMARISGRIINEVKGVNRVVYDISSKPP
GUAA_COXBU       KGDARHYGYIIALRAVKTVDFMTAQWADLPHEFLSKVSHRIVNEIKEVSRVVYDMTNKPP
GUAA_CHLMU       KGDCRHYGYTIALRAVESTDFMTACWPSLSREFLNRCSSRIINEIPEVCRVVYDISDKPP
GUAA_WIGBR       MGDMRKYEWVISLRAIETLDFMSANWANIPYKILNNVSNRIINEVRGISRVVYDISNKPP
GUAA_BLOFL       QGDQRKYKWVIVLRAIETEDFMTAQWVRLPYTFLNKVSNRIVNEVEEVSRVVYDISCKPP
                  *.         :          .                                    

GUAA_RHIME       GTIEWE
GUAA_BRUME       ------
GUAA_AGRFC       GTIEWE
GUAA_BRADU       GTIEWE
GUAA_CAUVC       GTIEWE
GUAA1_BACTN      ATIEWE
GUAA_PORGI       STIEWE
GUAA_CHLTE       ATIEWE
GUAA_CAMJE       ATIEWE
GUAA_WOLSU       ATIEWE
GUAA_HELPJ       GTIEWE
GUAA_AQUAE       STIEWE
GUAA_THEMA       ATIEWE
GUAA_GLOVI       GTIEWE
GUAA_THEEB       GTIEWE
GUAA_PROMP       GTIEWE
GUAA_SYNPX       GTIEWE
GUAA_DEIRA       ATIEWE
GUAA_LACLA       ATVEWQ
GUAA_STRMU       ATVEWE
GUAA_LACPL       STIEWE
GUAA_ENTFA       ATVEWE
GUAA_BACCR       ATIEWE
GUAA_OCEIH       ATIEWE
GUAA_STAES       STIEWE
GUAA_CLOTE       STIEWE
GUAA_CALS4       ATIEWE
GUAA_MYCPE       GTIEWE
GUAA_MYCTU       ATIEWE
GUAA_STRAW       GTIEWE
GUAA_BIFLO       ATIEWE
GUAA_TROWT       ATIEWE
GUAA_AERPE       STIEWE
GUAA_PYRAE       STIEPC
GUAA_BORBU       STIEWE
GUAA_FUSNN       ATIEWE
GUAA_ECOLI       ATIEWE
GUAA_HAEDU       ATIEWE
GUAA_PSESM       ATIEWE
GUAA_XYLFT       ATIEWE
GUAA_CHRVO       ATIEWE
GUAA_RALSO       ATIEWE
GUAA_NITEU       ATIEWE
GUAA_GEOSL       ATIEWE
GUAA_COXBU       ATIEWE
GUAA_CHLMU       ATIEWE
GUAA_WIGBR       STIEWE
GUAA_BLOFL       ATIEWE