CLUSTAL format seed alignment for MF_00352

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BCHN_CHLPD      ------------------MMQVPGDVQ---IIKEDNVTHSFCGLACVGWMYQKIKDSFFL
BCHN_CHLL3      ------------------MLQVPGDVQ---ILKEDNVTHSFCGLASVGWMYQKIRDSFFL
BCHN_CHLCH      -----------------MMQGIGGDIQDSQLIREDNVTHSFCGLACVGWMYQKIKDSFFL
BCHN_CHLTE      -------------------MPVSSDCQ---ILKEDNVTHSFCGLACVGWLYQKIKDSFFL
BCHN_CHLAA      ------MFLNPVVPNGYYNLRGGAMQSKATPIREDGIYHSFCGLVSVGWLYQKIKDSFFL
BCHN_ROSS1      --------------------------MPATVIREDGAYHSFCGLTCVGWLYQKIKDSFFL
CHLN_ANTAG      -----------MSIQI---------SETLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_MARPO      -----------MSIKI---------SETLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_PHYPA      -----------MSNKI---------SETLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_PINKO      -----------MSTKI---------DETITFECETGNYHTFCPISCVSWLYQKIEDSFFL
CHLN_PINTH      -----------MSTKI---------VETITLECETGNYHSFCPISCVSWLYQKIEDSFFL
CHLN_CYCTA      -----------MSAKI---------SETLTFECETGNYHTFCPISCVSWLYQKIEDSFFL
CHLN_HUPLU      -----------MAVEI---------SETLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_ANGEV      -------------MNT---------FEILTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_ADICA      -------------MKT---------PETLAFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_CHAGL      -----------MNSAI---------SDTLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_CHAVU      -----------MLEKI---------SDTLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_CHLVU      ----------MTNSKL---------TETLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_PLETE      ---------MTATFKK---------EVNLVFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_MESVI      -----------MSAVT---------SDTITFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_CHLAT      -----------MSAMT---------SDTLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_STAPU      -----------MYFQKKETFFMPLTKDTLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_ZYGCR      -----------MSSKQ--------VPDTLTFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_NEPOL      ----------MLSDQVTTAELH--PSAPLT-ECETGIYHTFCPISCVAWLYQRVEDSFFL
CHLN_STIHE      -----------MSQLITSPKIN--EKETLKFECETGNYHTFCPISCVSWLYQKIEDSFFL
CHLN_NOSS1      ---------MTIAQE----------PTALNFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_TRIV2      ---------MTIAQE----------PTALNFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_TRIEI      ---------MSNTIQ----------PEALTFECETGNYHTFCPISCVSWLYQKIEDSFFL
CHLN_SYNY3      ---------MTVAQQA---------PSALNFDCETGNYHTFCPISCVSWLYQKIEDSFFL
CHLN_SYNJA      ---------MTAAVDT---------SNTLHFQCETGNYHTFCPISCVAWLYPKIEDSFFL
CHLN_SYNJB      ---------MNAALDS---------ANALNFQCETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_THEEB      -----------MTVTA---------PNALNFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_SYNP6      ----------MTTTEA---------PSALSFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_SYNE7      ----------MTTTEA---------PSALSFECETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_PORPU      -----------MSIVQ---------SDALTFECETGNYHTFCPISCVSWLYQKIEDSFFL
CHLN_CYAPA      -----------MNQIN---------NSTLTFQCETGNYHTFCPISCVAWLYQKIEDSFFL
CHLN_GLOVI      ----------MVSQPT--------TSSGPQFECETGNYHTFCPISCVAWLYQKIEDSFFL
BCHN_HELMO      ---------------------------MERVERENGCFHTFCPIASVAWLHRKIKDSFFL
BCHN_CERS4      MSLDLPPPP---ARGCR----------STEVLKERGQREVFCGLTGIIWLHRKMQDAFFL
BCHN_RHOS1      MSLDLPPPP---ARGCR----------STEVLKERGQREVFCGLTGIIWLHRKMQDAFFL
BCHN_CERS5      MSLDLPPPP---ARGCR----------NGDVLKERGQREVFCGLTGIIWLHRKMQDAFFL
BCHN_DINSH      -MNKPVTTI---APGCR----------DTPILKQRGQREVFCGLTGIIWLHRKMQDAFFL
BCHN_JANSC      -MNTPKSIP---SGTCR----------DTPVLKERGQREVFCGLTGIIWLHRKMQDAFFL
BCHN_ROSDO      MTELPRLPA---QGGCS----------NAPILKQRGQREVFCGLTGIIWLHRKMQDAFFL
BCHN_RHOCB      ---MSLDSP---TFGCT----------DSPVRRERGQKAVFCGLTSIVWLHRKMQDAFFL
BCHN_RHOPS      MTVHVSNCA-ATAEDPV----------SREIRTESGQREVFCGLTGIVWLHRKIQDAFFL
BCHN_RHOP2      MTVHVQPCA-APAEDPV----------SRAVRTESGQREVFCGLTGIVWLHRKIQDAFFL
BCHN_RHOPA      MTVHVTGCSTATADQLV----------SREIRTESGQREVFCGLTGIVWLHRKIQDAFFL
BCHN_RHOP5      MNARAEGCT-AAP-DPS----------SRVVRHERGQHEVFCGLTGIVWLHRKIQDAFFL
BCHN_RHOPB      MTVLAQGCD-VAPPNNL----------TKPVRHESGQREVFCGLTGIVWLHRKIQDAFFL
BCHN_BRASB      MNAHAQACA--VTSAAS----------PDGVLRERGQREVFCGLTGIVWLHRKIQDAFFL
BCHN_BRASO      MNAHAQACA--VTSSS-----------PDGVLRERGQREVFCGLTGIVWLHRKIQDAFFL
BCHN_RHORT      MTCRPALSDSHPPEPGTPSSPSFGVCGDRPLLRERGQHEVFCGLAGIIWLHRKIQDAFFL
CHLN_PROM1      -------------------------MSGATLLKESGPKEVFCGLTSIVWLHRRMPDAFFL
CHLN_PROMT      -------------------------MSGATLLKESGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_PROMA      -------------------------MSGSTLLKETGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_PROMS      -------------------------MSKVEFNKETGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_PROM0      -------------------------MSKVEFKKETGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_PROM2      -------------------------MSKVEFNKETGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_PROM9      -------------------------MSKVELNKETGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_PROMP      -------------------------MSKVDLNKETGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_PROM5      -------------------------MSKVDFNKETGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_PROM3      -------------------------MGSTTLLKESGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_PROMM      -------------------------MGSATLLKESGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_SYNSC      -------------------------MAGPTLLKESGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_SYNPW      --------------------------MSANLLKESGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_SYNS9      -------------------------MSGPTLLKESGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_SYNPX      -------------------------MAGPTLLKESGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_SYNS3      --------------------------MSVNLLKETGPREVFCGLTSIVWLHRRMPDAFFL
CHLN_SYNR3      --------------------------MQLQLLKESGQREVFCGLTSIVWLHRRMPDAFFL
BCHN_HALHL      ---------------MTESASCHGGGVCGGLAQEEGQRQVFCGLTSIVWLHRKMRDAFFL
                                                 : .    ** :  : *:: :: *:***

BCHN_CHLPD      ILGTHTCAHFLQNALGMMIFAKPRFGIALIEEGDLSKHEPT---LEEIISEIKADH-NPS
BCHN_CHLL3      ILGTHTCAHFLQNALGMMIFAKPRFGIALIEEGDLSKNEPT---LDEVIAEIKADH-NPS
BCHN_CHLCH      ILGTHTCAHFLQNALGMMIFAKPRFGIALIEEGDLAKNEPT---LQEVVSEIKADH-HPS
BCHN_CHLTE      ILGTHTCAHFLQNALGMMIFAKPRFGVALIEEADLSRAEPQ---LEAVIEEIKRDH-NPS
BCHN_CHLAA      ILGTHTCAHLLQNTLGVMIFARPRFAVSLLEESDLSSSQPD---ISAQIEEIKREH-HPS
BCHN_ROSS1      VLGTHTCAHLLQNVLGVMIFARPRFGVALIEEADLSKQQPE---LDRIIDEIVADH-HPS
CHLN_ANTAG      VIGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYEELKRLCFQIKKDR-NPS
CHLN_MARPO      VVGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYEELKRLCVQIKKDR-NPS
CHLN_PHYPA      VVGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYKELKRLCLQIKKDR-NPS
CHLN_PINKO      VVGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAHLNDYEELKTLCIRIRKDR-DPS
CHLN_PINTH      VVGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAHLNDYEELKTLCIRIRKDR-DPS
CHLN_CYCTA      MVGTKTCGYFLQNTLGVMIFAEPRYAMAELEEGDISAQLNDYEELKRLCIRIKKDR-DPN
CHLN_HUPLU      VVGTKTCGYFSQNSLGVMIFAEPRYAMAELEEGDIPAQLNDYGESKRLCIQIIKNR-NPS
CHLN_ANGEV      VIGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDHEELKRLCLHIKKDR-NPS
CHLN_ADICA      VVGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDQKELEKICLQIRDDR-NPS
CHLN_CHAGL      VVGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYQELKNICLQIKKDR-NPS
CHLN_CHAVU      VVGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYEELKRLCIQIKKDR-NPS
CHLN_CHLVU      VIGTKTCGYFLQNALGVMIFAEPRYAMAELEEADISAQLNDYKELKRLCLQIKQDR-NPS
CHLN_PLETE      VIGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYKELKRLCLQIKQDR-NPS
CHLN_MESVI      VIGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYKELTRLCNQIKKDR-NPS
CHLN_CHLAT      VIGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYQELKRLCTQIKQDR-NPS
CHLN_STAPU      VVGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYEELKRLCSQIKKDR-NPS
CHLN_ZYGCR      VVGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQLNDYEELKRLCVQIKKDR-NPS
CHLN_NEPOL      VIGTKTCGYFLQNALGVMIFAEPRYAMAELEEGDISAQFNDYHELRRLCVQIQQDR-HPS
CHLN_STIHE      VIGTKTCGYFLQNALGVMIFAEPRYAMAELEEADISAQLNDYKELKRLCLQIKRDR-NPS
CHLN_NOSS1      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAQLNDYAELKRLCEQIKRDR-NPS
CHLN_TRIV2      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAQLNDYAELKRLCEQIKRDR-NPS
CHLN_TRIEI      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAKLNDYNELKRLCLQIKRDR-NPS
CHLN_SYNY3      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAQLKDYEELKRLCLQIKRDR-NPS
CHLN_SYNJA      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAKLNDYEELKRLCLQIQRDR-NPS
CHLN_SYNJB      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAKLNDYEELKRLCLQIQRDR-NPS
CHLN_THEEB      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAQLNDYEELKRLCLEIKRDR-NPS
CHLN_SYNP6      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAQLNDFAELKRLCTQIKRDR-NPS
CHLN_SYNE7      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAQLNDYAELKRLCTQIKRDR-NPS
CHLN_PORPU      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDISAKLNDYGELRRLCLQIKKDR-NPS
CHLN_CYAPA      VIGTKTCGYFLQNSMGVMIFAEPRYAMAELEEGDISAQINDYEELKRLCTQIKNDR-NPS
CHLN_GLOVI      VIGTKTCGYFLQNAMGVMIFAEPRYAMAELEEGDVNAKLNAYDELQRLCLQVKKDR-NPS
BCHN_HELMO      IVGTHTCAHFIQTALDVMVYAHSRFGFAVLEESDLVSASPT-EELGKVVQQVVDEW-HPK
BCHN_CERS4      VVGSRTCAHLLQSAAGVMIFAEPRFGTAVLEEKDLAGLADANAELDREVDRLLARRPDIR
BCHN_RHOS1      VVGSRTCAHLLQSAAGVMIFAEPRFGTAVLEEKDLAGLADANAELDREVDRLLARRPDIR
BCHN_CERS5      VVGSRTCAHLLQSAAGVMIFAEPRFGTAILEEKDLAGLADANAELDREVERLLSRRPDIR
BCHN_DINSH      VVGSRTCAHLLQSAAGVMIFAEPRFGTAILEEKDLAGLADAQDEIDREVERLLSRRPDIK
BCHN_JANSC      VIGSRTCAHLLQSAAGVMIFAEPRFGTAILEETDLAGMADAHEELDREVERLLSRRPDIK
BCHN_ROSDO      VVGSRTCAHLLQSAAGVMIFAEPRFGTAILEETDLAGLADAQAELDKVVDQLLARRTDIK
BCHN_RHOCB      VVGSRTCAHLLQAAAGVMIFAEPRFGTAVLEEQDLAGLADAHKELDREVAKLLERRPDIR
BCHN_RHOPS      VVGSRTCAHLIQSAAGVMIFAEPRFGTAIMEEKDLAGLTDANIELDRIVTQLLTRRPDIK
BCHN_RHOP2      VVGSRTCAHLIQSAAGVMIFAEPRFGTAIMEEKDLAGLTDANDELDRIVTQLLTRRPDIK
BCHN_RHOPA      VVGSRTCAHLVQSAAGVMIFAEPRFGTAIMEEKDLAGLTDANDELDRVVTQLLARRPDIK
BCHN_RHOP5      VVGSRTCAHLIQSAAGVMIFAEPRFGTAIMEEKDLAGLTDANDELDRIVTQLIARRPDIK
BCHN_RHOPB      VVGSRTCAHLIQSAAGVMIFAEPRFATAIMEEKDLAGLTDANTELDRIVTQLLTRRPDIK
BCHN_BRASB      VVGSRTCAHLIQSAAGVMIFAEPRFATAIMEERDLAGLVDANDELDRIVTQLLARRPEIK
BCHN_BRASO      VVGSRTCAHLIQSAAGVMIFAEPRFATAIMEERDLAGLVDANDELDRIVAQLLARRPDIK
BCHN_RHORT      IIGSRTCAHLMQSAAGVMIFAEPRFATAVLEEQDLAGLADAQDEIDRVVARLLERRPDIR
CHLN_PROM1      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEERDLAGLADAHDELNRVVKNLLARRPEIK
CHLN_PROMT      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEERDLAGLADAHDELNRVVKNLLARRPEIK
CHLN_PROMA      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEERDLAGLADAHEELDRVVKSLLKRRPEIR
CHLN_PROMS      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEEKDLAGLADAHEELDRVVNDLIARRPEIK
CHLN_PROM0      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEEKDLAGLADAHEELDRVVNDLIERRPEIK
CHLN_PROM2      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEEKDLAGLADAHEELDRVVNDLISRRPEIK
CHLN_PROM9      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEEKDLAGLADAHEELDRVVNDLISRRPEIK
CHLN_PROMP      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEEKDLAGLADAHEELDRVVNDLISRRPEIK
CHLN_PROM5      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEEKDLAGLADAHEELDRVVNDLISRRPEIK
CHLN_PROM3      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILEERDLAGLADAHEELDRVVNDLLARRPEIR
CHLN_PROMM      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILGEKDLAGLADAHDELDRVVNDLLARRPEIR
CHLN_SYNSC      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILSERDLAGLADAHDELDRVCKELLQRRPEIR
CHLN_SYNPW      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILSERDLAGLADAHDELDRVARELLMRRPEIR
CHLN_SYNS9      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILNERDLAGLADAQEELDRVAKELLQRRPEIR
CHLN_SYNPX      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILSERDLAGLADAHEELDRVARELLQRRPEIR
CHLN_SYNS3      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILSERDLAGLADAQDELDRVARELLERRPEIR
CHLN_SYNR3      VVGSRTCAHLIQSAAGVMIFAEPRFGTAILGERDLAGLADANEELDRVVADLLQRRPEIR
BCHN_HALHL      VVGSRTCAHLLQSAAGVMIFAEPRFATAVLGERDLAGMADCNEELDRVVHELLARRPEIR
                ::*::**.:: *   .:*::*..*:. : : * *:                :     .  

BCHN_CHLPD      VIFLLSSCTPEVMKVDFKGLANQLSTD---EVPVLFVPASGLVYNFTQAEDSVLHALVPF
BCHN_CHLL3      VIFLLSSCTPEVMKVDFKGLADHLSTQ---QTPVLFVPASGLVYNFTQAEDSVLHALVPY
BCHN_CHLCH      VIFLLSSCTPEVMKVDFKGLADHLSTP---ETPVLFVPASGLVYNFTQAEDSILSALVPY
BCHN_CHLTE      VIFLLSSCTPEVMKVDFKGLAHHLSTD---KTPVLFVPASGLVFNFTQAEDSVLQALVPF
BCHN_CHLAA      VIFLLSSCTPEVMKVEFEGLAASVSTP---EVPVLFVPASGLDYTFSQSEDSVLQALIPF
BCHN_ROSS1      VIFLLSSCTPEVMKVEFDGLARAVSRP---NLPVLFVPASGLDYTFSQAEDSVLQALLPF
CHLN_ANTAG      VIIWIGTCTTEIIKMDLEGMAPKLEVEL--GVPIVVARANGLDYAFTQGEDTVLAAMAHR
CHLN_MARPO      VIIWIGTCTTEIIKMDLEGMAPKLENEI--EIPIVVARANGLDYAFTQGEDTVLAAMAHR
CHLN_PHYPA      VIIWIGTCTTEIIKMDLEGMAPKLENEL--GIPIVVARANGLDYAFTQGEDTVLAAMAHR
CHLN_PINKO      VIIWIGTCTTEIIKMDLEGMAPKLEYEI--GVPILVARANGLDYAFTQGEDTVLAVMAHR
CHLN_PINTH      VIIWIGTCTTEIIKMDLEGMAPKLEYEI--GVPILVARANGLDYAFTQGEDTVLAVMAHR
CHLN_CYCTA      VIIWIGTCTTEIIKMDLEGMAPKLESEI--GIPIIVARANGLDHAFTQGEDTVLAAMAHR
CHLN_HUPLU      VIIWIGTCTTEIIKMDLEGIAPKLEAEI--GVPIVVARANGLDYAFTQGEDTVLAAVTHR
CHLN_ANGEV      VIVWIGTCTTEIIKMDLEGIAPKVETEI--GIPIVVARANGLDYAFTQGEDTVLAAITHR
CHLN_ADICA      VIIWIGTCTTEIIKMDLEGIAPKLEKQI--GIPIIVARANGLDYAFTQGEDTVLAAMAHR
CHLN_CHAGL      VIVWIGTCTTEIIKMDLEGMAPRLEAEI--GIPIVVARANGLDYAFTQGEDTVLAAMAQR
CHLN_CHAVU      VIVWIGTCTTEIIKMDLEGMAPKLEAEI--GIPIVVARANGLDYAFTQGEDTVLAAIVHR
CHLN_CHLVU      VIVWIGTCTTEIIKMDLEGMAPRLEAEI--QTPIVVARANGLDYAFTQGEDTVLAAMVQR
CHLN_PLETE      VIVWIGTCTTEIIKMDLEGMAPRLESEI--DIPIVVARANGLDYAFTQGEDTVLAAMVNR
CHLN_MESVI      VIVWIGTCTTEIIKMDLEGMAPKIELEI--NTPIVVARANGLDYAFTQGEDTVLAAMVER
CHLN_CHLAT      VIVWIGTCTTEIIKMDLEGMAPKIEQEI--KIPIVVARANGLDYAFTQGEDTVLAAMVER
CHLN_STAPU      VIVWIGTCTTEIIKMDLEGMAPRLEAEI--DIPIVVARANGLDYAFTQGEDTVLAAMAHR
CHLN_ZYGCR      VIVWIGTCTTEIIKMDLEGMAPRLEAEI--DIPIVVARANGLDYAFTQGEDTVLAAMANR
CHLN_NEPOL      VIVWIGTCTTEIIKMDLEGMAPTLQAEI--GIPIVVARANGLDYAFTQGEDTVLAAMAQR
CHLN_STIHE      VIVWIGTCTTEIIKMDLEGMAPRLETEI--GIPIVVARANGLDYAFTQGEDTVLAAMACR
CHLN_NOSS1      VIVWIGTCTTEIIKMDLEGLAPKLEGEI--GIPIVVARANGLDYAFTQGEDTVLAAMAHR
CHLN_TRIV2      VIVWIGTCTTEIIKMDLEGLAPKLEGEL--GIPIVVARANGLDYAFTQGEDTVLAAMAHR
CHLN_TRIEI      VIVWIGTCTTEIIKMDLEGLAPKLESEI--GIPIVVARANGLDYAFTQGEDTVLAAMAAR
CHLN_SYNY3      VIVWIGTCTTEIIKMDLEGLAPQLEAEI--GIPIVTARANGLDYAFTQGEDTVLASMAHK
CHLN_SYNJA      VIVWIGTCTTEIIKMDLEGLAQKLEAEI--GIPIVVARANGLDYAFTQGEDTVLASMAQR
CHLN_SYNJB      VIVWIGTCTTEIIKMDLEGLAQKLEGEI--GIPIVVARANGLDYAFTQGEDTVLASMAQR
CHLN_THEEB      VIVWIGTCTTEIIKMDLEGLAPKLEAEI--GIPIVVARANGLDYAFTQGEDTVLAAMAAR
CHLN_SYNP6      VIVWIGTCTTEIIKMDLEGLAPKLEAEI--GIPIVVARANGLDYAFTQGEDTVLAAMPAR
CHLN_SYNE7      VIVWIGTCTTEIIKMDLEGLAPKLEAEI--GIPIVVARANGLDYAFTQGEDTVLAAMAAR
CHLN_PORPU      VIFWIGTCTTEIIKMDLEGIAPKLEAEI--RVPIVVARANGLDYAFTQGEDTVLAAMAQR
CHLN_CYAPA      VIVFIGTCTTEIIKMDLEGIAPKLEAEI--GIPIVVARANGLDYTFTQGEDTVLASLIQR
CHLN_GLOVI      VIVWIGTCTTEIIKMDLEGIAPKLEDEI--GIPIVVARANGLDYAFTQGEDTVLAAMASR
BCHN_HELMO      VIFVLSTCSVDILKMDLEVSCKDLSTRF--GFPVLPASTSGIDRSFTQGEDAVLHALLPF
BCHN_CERS4      QLFLVGSCPSEVIKLDLHRAAERLSAHHGPAVRVYNFSGSGIETTFTQGEDACLASIVPT
BCHN_RHOS1      QLFLVGSCPSEVIKLDLHRAAERLSAHHGPAVRVYNFSGSGIETTFTQGEDACLASIVPT
BCHN_CERS5      QLFLVGSCPSEVIKLDLHRAAERLSAQHGPAVRVYNFTGSGIETTFTQGEDACLASIVPT
BCHN_DINSH      QLFLVGSCPSEVIKLDLGRAAERLTRKFAPHVRVLNYSGSGIETTFTQGEDACLESMVPV
BCHN_JANSC      QLFLVGSCPSEVIKLDLARAAERLTQVHAPHVRVLNYSGSGIETTFTQGEDACLTSMVPV
BCHN_ROSDO      QLFLVGSCPSEVIKLDLSRAAERMTEKYAPSVRVLNFSGSGIETTFTQGEDACLASMVPV
BCHN_RHOCB      QLFLVGSCPSEVLKLDLDRAAERLSGLHAPHVRVYSYTGSGLDTTFTQGEDTCLAAMVPT
BCHN_RHOPS      LLFLVGSCPSEVIKLDLSRAALRLSQRFSPGVRILNYSGSGIETTFTQGEDACLASLVPE
BCHN_RHOP2      LLFLVGSCPSEVIKLDLSRAALRLSQRFSPGVRILNYSGSGIETTFTQGEDSCLASLVPA
BCHN_RHOPA      LLFLVGSCPSEVIKLDLSRAALRLSQRFSPGVRILNYSGSGIETTFTQGEDACLASLVPE
BCHN_RHOP5      LLFLVGSCPSEVIKLDLSRAALRLSQRFSPAVRVLSYSGSGLETTFTQGEDACLASLVPV
BCHN_RHOPB      LLFLVGSCPSEVIKLDLSRAALRLSQTFSPGVRILSYSGSGIETTFTQGEDACLASLVPE
BCHN_BRASB      LLFLVGSCPSEVIKLDLSRAALRLSQRFSPGVRVLNYSGSGIETTFTQGEDACLASLVPV
BCHN_BRASO      LLFLVGSCPSEVIKLDLSRAALRLSQRFSPGVRVLNYSGSGIETTFTQGEDACLAALVPV
BCHN_RHORT      LLFLVGSCPSEVIKIDLQRAALRLSKVHGARTRVVSYSGSGLETTFTQGEDACLAALVPD
CHLN_PROM1      TLFLVGSCPSEVIKIDLSRVAENLNIELKGQVTVLNYSGSGIETTFTQGEDGALKALIPL
CHLN_PROMT      TLFLVGSCPSEVIKIDLSRVAENLNIELKGQVTVLNYSGSGIETTFTQGEDGALKALIPL
CHLN_PROMA      TLFLVGSCPSEVIKIDLSRAAERLSSQFNGQVRILNYSGSGIETTFTQGEDGALKALVPL
CHLN_PROMS      TLFLVGSCPSEVIKLDLATVAEKLNKRFLGQVRFVNYSGSGIETTFTQGEDGALKALIPL
CHLN_PROM0      TLFLVGSCPSEVIKLDLATVAEKLNKRFLGQVRFVNYSGSGIETTFTQGEDGALKALIPL
CHLN_PROM2      TLFLVGSCPSEVIKLDLATVAEKLNKRFLGKIKFVNYSGSGIETTFTQGEDGALKALIPL
CHLN_PROM9      TLFLVGSCPSEVIKLDLATVSEKLNKRFLGQVRFVNYSGSGIETTFTQGEDGALKALVPL
CHLN_PROMP      TLFLVGSCPSEVIKLDLATVAEKLNSRFLGQVRFVNYSGSGIETTFTQGEDGALKALVPL
CHLN_PROM5      TLFLVGSCPSEVIKLDLATVAEKLNLRFSGQVRFVNYSGSGIETTFTQGEDGALKALIPL
CHLN_PROM3      TLFLVGSCPSEVIKLDLARVAERLNGQLQGGVRVLNYSGSGIETTFTQGEDGALKAMVPL
CHLN_PROMM      TLFLVGSCPSEVIKLDLARVAERLNGELQGRVRVLNYSGSGIETTFTQGEDGALKAMVPL
CHLN_SYNSC      TLFLVGSCPSEVIKLDLARAAERLNEELSGQVRVVNYSGSGIETTFTQGEDGALAALVPL
CHLN_SYNPW      TLFLVGSCPSEVIKLDLARAAERLNEELQGRVRVVNYSGSGIETTFTQGEDGALAALVPL
CHLN_SYNS9      TLFLVGSCPSEVIKLDLSRAAERLTDELQGRVRVVNYSGSGIETTFTQGEDGALAALIPF
CHLN_SYNPX      TLFLVGSCPSEVIKLDLARAAERLNDELQGRVRVVNYSGSGIETTFTQGEDGALAALVPL
CHLN_SYNS3      TLFLVGSCPSEVIKLDLARAAERLNDELRGRVQVVNYSGSGIETTFTQGEDGALSALVPL
CHLN_SYNR3      TLFLVGSCPSEVIKLDLSKAAERLNQQHRGRVQVVNYSGSGIETTFTQGEDQALTALVPL
BCHN_HALHL      TLFLVGSCPSEVIKLDLGKAAERLTAAHEGRVRVLPYSGSGLETTFTQGEDQFLTTLAHE
                 :. :.:*. :::*:::   .  :         .     .*:   *:*.**  *  :   

BCHN_CHLPD      CPVAPAGQK----------------------------------------------NVVFL
BCHN_CHLL3      CPVAPAGEK----------------------------------------------SVVFL
BCHN_CHLCH      CPQAPAGEK----------------------------------------------KVVFL
BCHN_CHLTE      CPEAPAGEK----------------------------------------------KVVFV
BCHN_CHLAA      CPPAPPDDK----------------------------------------------RVVFL
BCHN_ROSS1      CPVAPPDDR----------------------------------------------RVVFL
CHLN_ANTAG      CPERDLLIDENKVI--------QNQ-TIQNIFSLFSQKKKEET--LKYLELKNHPPLVLF
CHLN_MARPO      CPEQKTEIE--KKI--------DDK-SIQELFSFLPLKTKEKS--NKSFTLKNTFSLVLF
CHLN_PHYPA      CPEQNTLLDNKKVI--------QQDSTIQDFFSFLSLEKKEETRNNSSIKSKKHPPLVLF
CHLN_PINKO      CPEQEFPIG-------------ESKETKTKTKLFPFPLLKEKK----LVEYANHPPLVIF
CHLN_PINTH      CPDQELPIG-------------ESK--ETKTKLFPFPLLKEKN----LVEYANHPPLVIF
CHLN_CYCTA      CLEQRLFVR-------------ERN---GTIQKFPPPLEKEGE----FIEYGDHPSLALF
CHLN_HUPLU      CPERKSSVGGQNQP--------VQDEELQEFFSFLPPNDENVKK--TVVGSQKNPPLVLF
CHLN_ANGEV      CPEYKSWVDEEDG----------TEKKVLSVYS------ERNRD--ETFKSPNHPPLVLF
CHLN_ADICA      CPEYKHCTT-------------NLKNRTDEMARIDNHTTNKSP---FEASKLTRFNLVLF
CHLN_CHAGL      CPEISVASK-----------------QNQPMGSAFSQTLK-------VSNQQDHPPLVLF
CHLN_CHAVU      CPDYKLQNKTDL---------TDNDIQEDATRFSFLKLRKNNIR--SISATNSHPPLVLF
CHLN_CHLVU      CPSNA-----------------------------PEQNQIEK------------KSLVLF
CHLN_PLETE      CPKKDQLTKPLQ----------------AVSFIDTDSLQKEKGP--KYDSINHDKDLVLF
CHLN_MESVI      CPAKISLDSNS----------------------NKESKNPESEQ----------APLVLF
CHLN_CHLAT      CPGETKLSEQSQDKGSSKQNFSSTKGLFSILNFNKKAAADTQPQ--EAEDYIDHPPLVLF
CHLN_STAPU      CPDINSVTQNIN----------IEDNGRERLLSFLPSKE-KASN--ERKNESTHPPLVLF
CHLN_ZYGCR      CPEWIQNAQNNN----------DQDQAIQGLMSFFPLKNTKLSS--EPTLLSNHPPLVLF
CHLN_NEPOL      CPDWTPDRT-------------------ATQSTSSP-------------------PLVIF
CHLN_STIHE      CPDKISTTS-------------------DSKNLETPMMIDNTQKNGQNSKALAHPPLVLF
CHLN_NOSS1      CPDKAPVAEAEKNE-------------RNAVQKLLNFGKKKELVAQEESEYVDHPPLVLF
CHLN_TRIV2      CPDKAPVAEAEKNE-------------RNAVQKLLNFGKKKELVAQEESEYVDHPPLVLF
CHLN_TRIEI      CPKQ--VLEVEKEA-------------KNGIQKLLSFGRKKEEVAAEKSEYVNHPPLILF
CHLN_SYNY3      CPTSAQVQGEDKEE-------------RNAIQKLLTFGRKAD-QEKVESEYVDHQPLVLF
CHLN_SYNJA      CPEQ--VQEEERET-------------RGGLQALFYGLRSGKKKEEEG--FHPHPPLVIF
CHLN_SYNJB      CPEQ--VRAEEQET-------------RGGLQALFYGLRSGKKKEEEG--FHKHPPLVIF
CHLN_THEEB      CPTS--TAISDPEE-------------RNPIQRLLNFGKKKEEVQAQSSQYHPHPPLVLF
CHLN_SYNP6      CPEAATSEADQQER-------------TNAIQRLLQFG--KSPAAEQQPASSKHPPLILF
CHLN_SYNE7      CPEAATSEADQQER-------------TNAIQRLLQFG--KSPAAEQQPASSKHPPLILF
CHLN_PORPU      CPSHHYIENTN-----------------------------------------PHVPLVLF
CHLN_CYAPA      CPSKDRETEKINKN-------------NSSLFPSLSIFSKNKNE-SNLSQDKPNLPLVLF
CHLN_GLOVI      CPAPQEVRSEEEKK----------ERTGGLRTLFSHGKKDEKKAGPAPSEYVDHQPLVLF
BCHN_HELMO      VPKEAPAVEPVE----------------EKKPRWFSFGKESEKE-----KAEPARNLVLI
BCHN_CERS4      LPATE---A---------------------------------------------RELLLV
BCHN_RHOS1      LPATE---A---------------------------------------------RELLLV
BCHN_CERS5      LPATE---A---------------------------------------------RELLLV
BCHN_DINSH      LPETE---A---------------------------------------------RELLLV
BCHN_JANSC      LPTTD---Q---------------------------------------------KELMLV
BCHN_ROSDO      LPKTD---T---------------------------------------------RQLLLV
BCHN_RHOCB      LDTTE---A---------------------------------------------AELIVV
BCHN_RHOPS      LPAAQ-DEK---------------------------------------------SSLLVV
BCHN_RHOP2      LPAAQ-DET---------------------------------------------SSLLVI
BCHN_RHOPA      LPAQT-DTK---------------------------------------------PSLLVV
BCHN_RHOP5      LPAST-GTE---------------------------------------------ASLLVV
BCHN_RHOPB      LPAAS-GKD---------------------------------------------ASLLVV
BCHN_BRASB      LPAADRSAR---------------------------------------------PSLLVV
BCHN_BRASO      LPSADRNAR---------------------------------------------PSLLVV
BCHN_RHORT      LPSAAADEA---------------------------------------------PDLLVV
CHLN_PROM1      MPKSDQ------------------------------------------------KKLLLV
CHLN_PROMT      MPKSDQ------------------------------------------------KKLLLV
CHLN_PROMA      MPSSQE------------------------------------------------EQLLLA
CHLN_PROMS      MESSNE------------------------------------------------EKLLLV
CHLN_PROM0      MESSNE------------------------------------------------EKLLLV
CHLN_PROM2      MEDSNE------------------------------------------------EKLLLV
CHLN_PROM9      MESTDD------------------------------------------------EKLLLV
CHLN_PROMP      MESTDD------------------------------------------------EKLLLV
CHLN_PROM5      MNSTDD------------------------------------------------EKLLLV
CHLN_PROM3      MPNSNE------------------------------------------------AQLLLV
CHLN_PROMM      MPNSNE------------------------------------------------AQLLLV
CHLN_SYNSC      LPASDE------------------------------------------------RQLLLV
CHLN_SYNPW      LPASES------------------------------------------------RQLLLV
CHLN_SYNS9      LPSSDE------------------------------------------------RQLLLV
CHLN_SYNPX      LPSSAE------------------------------------------------RQLLLV
CHLN_SYNS3      LPSTDQ------------------------------------------------RQLLMV
CHLN_SYNR3      MPQSTT------------------------------------------------PQLLLV
BCHN_HALHL      LPASPEG-A---------------------------------------------PSLIVL
                                                                        : . 

BCHN_CHLPD      GSVNDATADDLRAEAEALGIPVGGFLPESRFDKMPAIGPDT-VLAPVQPYLSRVAVKLER
BCHN_CHLL3      GSVNDATADDLRAEAEELGIKVGGFLPESRFDRMPAIGPDT-ILAPIQPYLSRVAVKLER
BCHN_CHLCH      GSVNDSTAADIRADAEELGIPVGGFLPESRFDKMPAIGPDT-VLAPIQPYLSRVALKLSR
BCHN_CHLTE      GSVNDITADDLRTEAEQLGIPVGGFLPESRFDKLPAIGPDT-VLAPIQPYLSRVCSRLNR
BCHN_CHLAA      GSVNDAIADDFSLEAARLGIPVAGFLPASHFTELPPIGPGT-VIAPLQPYLHKTATQLRN
BCHN_ROSS1      GSVNDAIADDFRTEAARLGIPVAGFLPESHFHDLPPIGPGT-VVAPLQPYLAKVAGRLAR
CHLN_ANTAG      GSLPSTVASQLSLELKRQSIQVSGWLPTQRYTDLPSLGDGV-YVCGVNPFLSRTATTLIR
CHLN_MARPO      GSLPSTVASQLSLELKRQSIHVSGWLPAQRYTDLPILGDKV-YVCGVNPFLSRTATTLMR
CHLN_PHYPA      GSLPSTVASQLSSELKRQSVQVSGWLPAQRYTDLPSLGDQV-YVCGVNPFLSRTATTLMR
CHLN_PINKO      GSLPSNLVSQLDTELRRQFIKVSGWLPAQRYADLPSLGDGV-YVCGVNPFLSRTATTLIR
CHLN_PINTH      GSLPSNLVSQLDTELRRQFIKVSGWLPAQRYADLPSLGDGV-YVCGVNPFLSRTATTLIR
CHLN_CYCTA      GSLPSNVASQLSPELRRQSVKVSGWLPAQRYTHLPSLGNGV-YVCGINPFLSRTAATLVR
CHLN_HUPLU      GSLPSAVAHQPSSELKRQSIQISGWIPTERYNNLPSLGDEV-YVCGVNPFLSRTATSLMR
CHLN_ANGEV      GSVPSTVASQLDSELKRQSIRVSGWLPAQRYTELPSLGEEV-YVCGVNPFLSRTATTLMR
CHLN_ADICA      GSLSSSIASQLNLELKRQSISVSGWLPSQKYEELPGLGEGI-YVCGVNPFLSRTATTLMR
CHLN_CHAGL      GSLPSTVASQLDLELKRQSIEVSGWLPSQRYTDLPLLGEGV-HVCGVNPFLSRTATTLMR
CHLN_CHAVU      GSLPTTVSSQLNLELKRNQIEVSGWLPTQRYTDLPSLGEGV-YVCGVNPFLSRTATTLMR
CHLN_CHLVU      GSLPTNVATQLNLELERCGIQVAGWLPSQRYADLPVLNQNV-YVCGINPFLSRTATTLMR
CHLN_PLETE      GSLPSTVVTQLNLELQRQDIKVSGWLPSQRYSDLPILDSGV-YVCGVNPFLSRTAATLMR
CHLN_MESVI      GSLPSTVASQLNLELKRQGINVSGWLPAQRYTDLPILEKGT-YVCGINPFLSRTATILMR
CHLN_CHLAT      GSLPGPVVSQLTLELKRQKIKVSGWLPSQRYTDLPAVGKGV-YVCGVNPFLSRTATILMR
CHLN_STAPU      GSLPSNVTSQLTLELKKQNIDVSGWLPSQRYAELPSVGEGV-YVCGVNPFLSRTATTLMR
CHLN_ZYGCR      GSLPSNVASQITLELKRQNIHVSGWLPAQRYSELPSVGEGV-YVCGVNPFLSRTATTLMR
CHLN_NEPOL      GSVPATVVSQLTFELQRQKVEVTGWLPSARYADLPAVGEDV-YACGVNPFLSRTAITLMR
CHLN_STIHE      GSLPSAVVNVLTLELNKQGITVDGWLPSSRYTDLPALGEDV-YVCGVNPFLSRTAMTLMR
CHLN_NOSS1      GSLPDPVVTQLTLELKKQGIKVSGWLPAKRFTELPVLEEGY-YVAGVNPFLSRTATTLMR
CHLN_TRIV2      GSLPDPVVTQLTLELKKQGIKVSGWLPAKRFTELPVLEEGY-YVAGVNPFLSRTATTLMR
CHLN_TRIEI      GSLPDPVVTQLTLELKKQGIKVSGWLPAKHYTELPVIEEGY-YVAGVNPFLSRTATTLMR
CHLN_SYNY3      GSLPDPVVTNLTLELKKQGVKVSGWLPAKRYTELPVIDEGY-YVAGVNPFLSRTATTLMR
CHLN_SYNJA      GSVPDPVVTQLTLELKKYGIRVSGWLPAKRYGELPAIEPGT-HVVGVNPFLSRTATTLVR
CHLN_SYNJB      GSVPDPVVTQLTLELKKHGIRVSGWLPAKRYGELPAIEPGT-YVVGVNPFLSRTATTLVR
CHLN_THEEB      GSLPDPVVTQLTLELKKQGIKVSGWLPAKRYTELPVIDEGY-YVAGVNPFLSRTATTLIR
CHLN_SYNP6      GSVPDPVATQLTIELAKQGITVSGWLPAKRYTELPVIAEGS-YAIGLNPFLSRTATTLMR
CHLN_SYNE7      GSVPDPVATQLTIELAKQGITVSGWLPAKRYTELPVIAEGS-YAIGLNPFLSRTATTLMR
CHLN_PORPU      GSLPDPVVTQLVMELKKQGIIVSGWLPSKRYTELPVIQEGY-YVAGVNPFLSRTATTLMR
CHLN_CYAPA      GSLPNSLTNQLEHELEKQNIKISGWLPTKNYKELPVIHEGD-YVCGVNPYLARTATNLIR
CHLN_GLOVI      GSLTDPVVNQLTLELKKQGIRVSGWLPAPRYTELPIVEQGVTYVAGVNPFLSRTASALQR
BCHN_HELMO      GAVTDSTIQQLQWELKQLGLPKVDVFPDGDIRKMPVINEQT-VVVPLQPYLNDTLATIRR
BCHN_CERS4      GALPDVVEDQAVSLLTQLGIGPVRCLPAHHAAEAPGVGPNT-VFALVQPFLGDTHGALTR
BCHN_RHOS1      GALPDVVEDQAVSLLTQLGIGPVRCLPAHHAAEAPGVGPNT-VFALVQPFLGDTHGALTR
BCHN_CERS5      GALPDVVEDQAVSLLTALGIGPIRVLPAHHAAEAPGVGPNT-VFALVQPFLGETHGALTR
BCHN_DINSH      GALPDVVEDQALGLLDKMGIGPVRVLPAPRADGTPGVGPNT-VYAVLQPFLGETCSALDR
BCHN_JANSC      GALPDVVEDQAVSLLSQMGIGPIRVLPAPRTAETPGVGPNT-VFACLQPFLGDTAAALTR
BCHN_ROSDO      GALPDVVEEQAVSLLEQMGIGPIKVLPAPRADTDLGIGENT-VFALTQPFLGDTHGALER
BCHN_RHOCB      GALPDVVEDQCLSLLTQLGVGPVRMLPARRSDIEPAVGPNT-RFILAQPFLGETTGALER
BCHN_RHOPS      GSLADVVEDQFMRMFDALGIGPVQFFPPRKSTALPSVGPNT-KILMAQPFLPDTVRALQE
BCHN_RHOP2      GSLADVVEDQFMRMFDALGIGPVQFFPPRKSTALPSVGPNT-KILMAQPFLPDTVRALQE
BCHN_RHOPA      GSLADVVEDQFARMFEALGVGNVAFFPPRKSTALPSVGPNT-KILMAQPFLPDTVRALEE
BCHN_RHOP5      GSLADVVEDQFIRLFDGLGIGSVQFFPPRNSGSMPSVGPNT-KFLLAQPFLPDTARELEH
BCHN_RHOPB      GSMADVVEDQFVRMFEALGIGPVQFLPPRNSATLPSVGPNT-KFLLAQPFLADTARELEN
BCHN_BRASB      GALADVVEDQFKRTFAALGIDQVAFLPPRRSSELPAIGPET-RVLLAQPFLGDTARALEE
BCHN_BRASO      GALADVVEDQFKRTFAALGIDNVAFLPPRRSSELPAIGPET-RVLLAQPFLGDTARALEE
BCHN_RHORT      GTLPDVVEDQFGRLFAEMGIARTAFLPPRRSTALPAIGPKT-RFLLAQPFLGDTARCLEA
CHLN_PROM1      GTLANAVEDRLVSIFNRLGIDNVESFPPRQSTELPSIGPET-KVLLTQPYLTDTARELKN
CHLN_PROMT      GTLANAVEDRLTSIFNRLGIDKVESFPPRQSTELPSIGPET-KVLLTQPYLTDTARELKN
CHLN_PROMA      GTLANPVEDRLKTIFNRLGIQKVESFPPRESTKLPAIGPGT-KVLLAQPYLTDTARELKD
CHLN_PROMS      GTLANNVEDRFKKIFKNLGISNIESFPPRQSTELPKIGKNT-KVLLTQPYLSDTVRDLKH
CHLN_PROM0      GTLANNVEDRFKKIFRNLGISNIESFPPRQSTELPKIGKNT-KVLLTQPYLSDTVRDLKH
CHLN_PROM2      GTLANNVEDRFKKIFRNLGISNVESFPPRQSTELPKIGKNT-KVLLTQPYLSDTVRDLKH
CHLN_PROM9      GTLANNVEDRFKKIFNHIGITNVESFPPRQSTELPKIGKNT-KVLLTQPYLSDTVRDLKH
CHLN_PROMP      GTLANNVEDRFKKIFNNIGITNVESFPPRQSTELPKIGKNT-KVLLAQPYLSDTVRDLKH
CHLN_PROM5      GTIANNVEDRFKKIFNSIGINNVESFPPRQSTELPKIGKNT-KVILTQPYLSDTVRDLKH
CHLN_PROM3      GTMANAVEDRLKHLFERLGIPSVSSLPPRQSTDLPSVGPGT-RVLLTQPYLTDTARELKD
CHLN_PROMM      GTMANAVEDRLIHLFERLGIPSVSSLPPRQSTDLPSVGPGT-RVLLTQPYLTDTARELKD
CHLN_SYNSC      GTLADAVEDRQMHLFQRMGIETIRSLPPRQSTDLPAVGAGT-TVLLTQPFLTETARLLGD
CHLN_SYNPW      GTLADAVEDRLIHLFSKLGIESVRSLPPRQSSELPPVGSGT-TVLLTQPFLTETARLLRD
CHLN_SYNS9      GTLADAVEDRLVHLFNKLNINAIKSLPPRQSTDLPAVGPGT-TVLLTQPYLTTTARLLKD
CHLN_SYNPX      GTLADAVEDRLIHLFGRLGIDRVRSLPPRQSTALPPVGPGT-TVLLTQPFLTDTARLLRN
CHLN_SYNS3      GTLADAVEDRLTHLFGRIGIDSVCSLPPRKSTELPAVGPGT-TVLLTQPYLTTTARLLRD
CHLN_SYNR3      GTLADGVEERFLTLFERLGIGPVASLPPRRSTELPAVGPGT-KLLLTQPFLGQTARALQA
BCHN_HALHL      GTLADVVEDQFRRLFDQLGIGPVHFLPPRTGADLPPVGPGT-RVLQAQPFTGEATRALIR
                *::                :     :*         :          :*:   .   :  

BCHN_CHLPD      ERGARVLHSLFPFGPDGTRVFWEDLAREFGIT-VDLRDREKA--AWD--KIQKQTALLRG
BCHN_CHLL3      ERGSRTLHSLFPFGPDGTRVFWEDLAREFGIE-VDLRDREKA--AWE--KISRQTAMLKG
BCHN_CHLCH      ERGSTVLHSLFPYGPDGSRVFWEDLAREFGIT-VDLREREAA--AWE--KIRKQTDKLKG
BCHN_CHLTE      ERGSQVLTSLFPFGPDGTKTFWEDLAAMFGIK-VDLSDRAEA--AWE--KIKPQTDLLKG
BCHN_CHLAA      ERGCTVLSSLFPFGPDGTRRFWEDLAAQFGMQ-VDLSEREAA--AWE--RIKHHTDLLRG
BCHN_ROSS1      ERGATVVSSLFPFGPDGTRAFWEDVAAAMGIA-VDLRERERQ--AWE--RLEPHLDVLRG
CHLN_ANTAG      RRKCKLIGAPFPIGPDGTRAWIEKISSVFGIKTKGLEEREQQ--VWQ--SLKNYLNLVRG
CHLN_MARPO      RRKCKLIGAPFPIGPDGTRAWIEKICSVFNIETQGLEEREQQ--VWE--SLKNYLNLVRG
CHLN_PHYPA      RRKCKLIGAPFPIGPDGTRAWIEKICSVFNIKTKDLEQREQQ--IWE--NLKDYLDLVRG
CHLN_PINKO      RKKCELIVAPFPIGPDGTRAWIERICPVFGIEAQSLEEREER--IWE--SLKDYLDLVRG
CHLN_PINTH      RKKCELIVAPFPIGPDGTRAWIERICPVFGIEAQSLEEREER--IWE--SLKDYLDLVRG
CHLN_CYCTA      RERCRLIGAPFPIGPDGTRAWIEKICPVFDIETQGLEEREKQ--IWE--SLKDYISLVHG
CHLN_HUPLU      RRKCQLIGAPFPIGPDGTRAWIEKICSVFGIEAQGLEKREKK--VWD--SLENYLDQVRG
CHLN_ANGEV      RRKCKLIGAPFPIGPDGTRAWIEKICSVFGIKPQGLEERETQ--IWN--NLKDYLDLLRG
CHLN_ADICA      RRKCKLVGAPFPIGPDGTRAWIEKICSVFDIKSYGLENRESE--IWE--NVKDYIQVING
CHLN_CHAGL      RRKCKLISAPFPIGPDGTRAWIEKICSVFGIQPQGLEERENQ--IWD--GLKDYIDLVRG
CHLN_CHAVU      RKKCKLISAPFPIGPDGTRAWIEKICNVFNIQPTGLEERENK--IWD--GLEDYLDLVRG
CHLN_CHLVU      RRKCKLISAPFPIGPDGTRAWLEKICSVFNVAPINLIERERL--IWD--SLEDYITLLRG
CHLN_PLETE      RRKCKLIGAPFPIGPDGTRAWVEKICSVFGKQPQGLEQREAE--IWK--GLEDYLQLVRG
CHLN_MESVI      RRKCKLIGAPFPIGPDGTRAWIEKICSVFNIQPQNLDERENQ--VWQ--SLEDYLQLVRG
CHLN_CHLAT      RRKCKLIGAPFPIGPDGTRAWVEKICSVFNVEPIGLAERENK--IWE--GLEDYLQLVRG
CHLN_STAPU      RRKCKLIGAPFPIGPDGTRAWIEKICSVFGIQPIGLEEREKQ--IWN--SLQDYLNLVRG
CHLN_ZYGCR      RRKCKLIGAPFPIGPDGTRAWIEKICSVFGIEPQGLEEREAQ--VWK--GLQDYLDLVRG
CHLN_NEPOL      RRRCKMIGSPFPIGPDGTRAWIEKICHVFGLETTGLAERERQ--VWS--QLEDYLSLVRG
CHLN_STIHE      RKKCKLINAPFPIGPDGTRAWIEKICNVLGVIPTGLEEREKK--IWQ--SLENYLPLVRG
CHLN_NOSS1      RRKCKLIGAPFPIGPDGTRAWIEKICSVFGITPKGLDEREAQ--IWA--GLEDYVKLIRG
CHLN_TRIV2      RRKCKLIGAPFPIGPDGTRAWIEKICSVFGITPQGLDEREAQ--IWA--GLEDYVKLIRG
CHLN_TRIEI      RRKCKLIGAPFPIGPDGSKAWIEKICSVFGIEPQGLVEREEQ--IWN--NLEDYIQLIRG
CHLN_SYNY3      RRKCKLIGAPFPIGPDGTRAWIEKICSVLGIEPQGLEEREAQ--IWA--SLEDYIQLIRG
CHLN_SYNJA      RKKAKLIPAPFPIGPDGTRAWIEAIARELGIPTPGLAEREAE--VWRHPQVQEYLGLLRG
CHLN_SYNJB      RKKAKLITAPFPIGPDGTRAWIEAIARELGIPTQGLAEREAE--VWNHPQVRDYRELLRG
CHLN_THEEB      RRKCQLITAPFPIGPDGTRTWIEQICATFGIQPQGLAEREAE--TWQ--KLSDYLELVRG
CHLN_SYNP6      RRKCKVIGAPFPIGPDGSRAWIEKICSVLEIEPQGLAEREAQ--VWD--SIEDYRQLVEG
CHLN_SYNE7      RRKCKVIGAPFPIGPDGSRAWIEKICSVLEIEPQGLAEREAQ--VWD--SIEDYRQLVEG
CHLN_PORPU      RRKTKLIGAPFPIGPDGTRAWIEKICSVFSIKPEGLAEREKD--IWD--SLEDYIALIRG
CHLN_CYAPA      RRKCKLISAPFPIGPDGTRAWIEKICSIFNIEPTGLDEREKA--VWD--SLENYLPLVKG
CHLN_GLOVI      RMRCNLITTPFPIGPDGTRGWIEAICQALGVIPKGLDEREQQ--IWD--ALRDDVEFLKG
BCHN_HELMO      ERRAKVLSTVFPIGPDGTARFLEAICLEFGLDTSRIKEKEAQ--AWR--DLEPQLQILRG
BCHN_CERS4      -RGARHIAAPFPFGEEGTTLWLKAIADEFGVSADTFEAVTAAPRARARKAVAAASEGLRG
BCHN_RHOS1      -RGARHIAAPFPFGHEGTTLWLKAIADEFGVSAETFEAVTAAPRARARKAVAAASEGLRG
BCHN_CERS5      -RGARHIAAPFPFGEEGTTLWLKAIADEFGVSPAKFEEVTAAPRARARKAVAAASETLKG
BCHN_DINSH      -RGARRIDAPFPFGEEGTTLWLRAIAREFGVSDETFEAVTAAPRARARKAIAAAAETLRD
BCHN_JANSC      -RGAHHIQAPFPFGEEGTTLWLRAIADEFGVDDDTFDRVTAAPRARARKAIANASEHLNG
BCHN_ROSDO      -RGARHLPAPFPFGEEGTTAWLRVIADEFGVDADTFERVTAAPRARARKAISQASEALRG
BCHN_RHOCB      -RGAKRIAAPFPFGEEGTTLWLKAVADAYGVSAEKFEAVTAAPRARAKKAIAAHLETLTG
BCHN_RHOPS      -RGAKRLAAPFPLGVEGTTGWLRAAADAFGVDPAHFDKVTGPNRARAERALAAYRTELAD
BCHN_RHOP2      -RGAKRLAAPFPLGVEGTTGWLRAAADAFGIDAATFDRVTEPNRVRAERALGAYKAELGG
BCHN_RHOPA      -RGAKRLAAPFPLGVEGTTGWLRAAADAFGVDPAKFEQVTAPNRARAERALSAFKSELGG
BCHN_RHOP5      -RGAKRLAAPFPLGVEGTTGWLRAAANAFGVDEALFDKVTQPARVRAERALDKFRKELSG
BCHN_RHOPB      -RGATRLRAPFPLGVEGTTAWLRAAANAFAIDPALFDKVTQPARARAERALDNYRKELAG
BCHN_BRASB      -RGCRRIAAPFPLGGEGTALWLAAAADAFGVSHAHVERTIAPLKARAERALARYRAQLAG
BCHN_BRASO      -RGCRRISAPFPLGGEGTALWLAAAADAFGVSRAHVERTLAPLKARAEKALARYRAQLAG
BCHN_RHORT      -RGARRLAAPFPFGVEGTTGWLAAAAQAFGVDDLTFRRVTAPGRERAARALERQRATLEG
CHLN_PROM1      -KGAEIIEAPFPLGVTGSTLWIQAAANSFGIDKSIVDSILNPLISRAKKALEPHVEKLSG
CHLN_PROMT      -KGAEIIEAPFPLGVTGSTLWIQAAADSFGIEKSLVDSILNPLISRAKQALIPHVEKLSG
CHLN_PROMA      -RGAEILQAPFPLGVEGSQLWIEAAANAFKIKKTLVDATLEPLITRAHKALKPYVEQLSG
CHLN_PROMS      -RGCEIISAPFPLGIEGSTEWFLAAAKAFKINELKVHEILSPLINRAKLALESHKEILKG
CHLN_PROM0      -RGCDIISAPFPLGIEGSTQWFLAAAKAFKIGELKVHEIISPLIKRAKLALESHKEILKG
CHLN_PROM2      -RGCEIISAPFPLGIEGSTKWFLAAAKAFKISALKVHEIISPLISRAKLALESHKDILKG
CHLN_PROM9      -RGCEIIYAPFPLGVEGSSKWFLAGADAFKINELKVHEVIAPLANRARQALEKHTEILRG
CHLN_PROMP      -RGCGIIQAPFPLGVEGSTKWVLAAAAAFKIHELKVHEVIAPLANRARQAIEKHKEILRG
CHLN_PROM5      -RGCEIIYAPFPLGVEGSTKWVLAAAAAFKIPELKVHEVIAPLANRARQALQKHTEILRG
CHLN_PROM3      -RGAEILQAPFPLGAEGSRLWMEAAAQAFGINGSHVATILEPLMVRAQKALSPYKEQLAG
CHLN_PROMM      -RGAEILQAPFPLGAEGSRLWMEAAAKAFGINNNHVANTLAPLIERAQKALSPYKEQLAG
CHLN_SYNSC      -RGARVLTAPFPLGAEGSRRWMEAAADAFHLPDERVAAVLDPLVERAQSALARHRAVLEG
CHLN_SYNPW      -RGATVLKAPFPLGAEGSRRWMEAAAADFHCPEASVRAVLDPLEARARIALAPHREVLAG
CHLN_SYNS9      -RGARVLTAPFPLGAEGSRRWMETAARDFEVDEAQIDSVLSPLMERAQIALAPHREVLKG
CHLN_SYNPX      -RGATVLTAPFPLGAEGSRRWMEAAAQAFEVAPSHVATVLDPLMERARIALEPHREVLAG
CHLN_SYNS3      -RGARVLTAPFPLGAEGSRSWMEAAAKDFQINADQVASVLDPLVARAQSALAPHREILNG
CHLN_SYNR3      -KGAELISSPYPLGVEGSELWFRAAARAFGISDEHTTSVLEPLVTRGRAALEPHRKALEG
BCHN_HALHL      -RGAERLDAPYPLGVEGTRSWLQAATRSFGVPDEQLEAVIEAPIARAQAALERQRGVLSG
                      : : :* *  *:  :                             :      : .

BCHN_CHLPD      KKVFLTADTMMELPLARFLKN-AGAEVVECSSAYINKKFHAHELEALQGV---------R
BCHN_CHLL3      KKVFLTADTMMELPLGRFLRS-AGAEVVECSSAYINKKFLAKELKALEGV---------R
BCHN_CHLCH      KKVFLTADTMLELPLARFLRH-AGADIMECSSAYIIKKFHAKELEALQGV---------R
BCHN_CHLTE      KKIFLTADTMMELPLARFLKN-AGAEVVECSSAYINKKFHARELEALEGV---------K
BCHN_CHLAA      KKIFFASDTLMELPLARFLKA-CGAEVVECSTPYINRRFHAAELAALDGV---------R
BCHN_ROSS1      KKVFFTADNLMELPLARFLRH-AGCTILECSSPYINRKFHARELEALDGV---------R
CHLN_ANTAG      KSVFFMGDNLLEISLARFLIR-CGMIVYEIGIPYMDKRYQAAELALLRNTCREMCTPMPR
CHLN_MARPO      KSVFFMGDNLLEISLARFLIR-CGMIVYEIGIPYMDKRYQAAELTLLQETCKKMCIPMPR
CHLN_PHYPA      KSVFFMGDNLLEISLARFLIR-CGMIVYEIGIPYLDKRYQAAELLFLQNTCKSMGIPMPR
CHLN_PINKO      KSVFFMGDNLLEISLARFLIR-CGMIVYEIGIPYMDKRYQAAELALLKDTCIRMCIPIPR
CHLN_PINTH      KSVFFMGDNLIEISIARFLIR-CGMIVYEIGIPYMDKRYQAAELALLQNTCIRMCMPIPR
CHLN_CYCTA      KSVFFMGDNLLEISLARFLIR-CGMIVYEIGIPYMDKRYQAAELALLRDTCIKMCVPIPR
CHLN_HUPLU      KSVFFMGDNPLEISLARFLIR-CGMTVYEIGIPYMDKRYQAAELYFLQNTCRDMRIPMPR
CHLN_ANGEV      KSVFFMGDNLLEVSLARFLIR-CGMIVYEIGIPYMDKRYQAAELSLLQDTCKKMHIPMPR
CHLN_ADICA      KSVFFMGDNLLEISLARFLIR-CGMIVYEVGIPYMDRRYQAAELLFLQHTCRKMKTPLPR
CHLN_CHAGL      KSVFFMGDNLLEVSLARFLIR-CGMVVYEIGIPYMDKRYQAAELALLQKTCQDMNVPMPR
CHLN_CHAVU      KSVFFMGDNLLEISLARFLIR-CGMIVYEIGIPYMDKRYQAAELMLLQKTCEMMNVPLPR
CHLN_CHLVU      KSVFFMGDNLLEISLARFLVR-CGMIVYEIGIPYLDKRFQSAELQLLEKTCSEMNVAMPR
CHLN_PLETE      KSVFFMGDNLLEVSLARFLIR-CGMIVYEIGIPYMDKRFQAAELAFLEKTCHDMNVPMPR
CHLN_MESVI      KSVFFMGDNLLEISLARFLIK-CGMIVYEIGIPYMDKRYQAAELALLEKHCNDMNVPMPR
CHLN_CHLAT      KSVFFMGDNLLEVSLARFLTR-CGMIVYEIGIPYMDKRYQAAELALLEKTCQEMGVPMPR
CHLN_STAPU      KSVFFMGDNLLEISLARFLIR-CGMIVYEIGIPYMDKRYQAAELALLEKTCQEMNVSLPR
CHLN_ZYGCR      KSVFFMGDNLLEVSLARFLIR-CGMIVYEIGIPYMDKRYQAAELALLQQTCEQMGTPMPR
CHLN_NEPOL      KSAFLMGDNLLEISLARFLIR-CGMIVHEVGIPYMDARFQAAELHLLMRTCEAAHVPMPR
CHLN_STIHE      KSVFFMGDNLLEISLARFLTR-CGMIVYECGVPYLDKRYQASELLLLEQTCLEKNVPMPR
CHLN_NOSS1      KSVFFMGDNLLEVSLARFLVR-CGMTVQEVGIPYMDKRYQAAELAMLEKACQEMGVPSPK
CHLN_TRIV2      KSVFFMGDNLLEVSLARFLVR-CGMTVQEVGIPYMDKRYQAAELAMLEKACQEMGVPSPK
CHLN_TRIEI      KSVFFMGDNLLEISLARFLIR-CGMTCPEIGIPYMDKRYQKAELEMLEKTCQEMGVRLPK
CHLN_SYNY3      KSVFFMGDNLLEVSLARFLIR-CGMTCPEIGIPYMDKRYQAAELALLEKTCSDMGVPLPN
CHLN_SYNJA      KSVFFMGDNLLEVSLARFLVR-CGMTVQEIGIPYLDKRYQAAELALLERTCEEMGVPKPT
CHLN_SYNJB      KSVFFMGDNLLEISLARFLVR-CGMTVQEIGIPYMDKRYQAAELALLERTCEEMGVPKPT
CHLN_THEEB      KSVFFMGDNLLEISLARFLIR-CGMRVLEIGIPYMDKRYQAAELALLSQTCAEMGHPLPT
CHLN_SYNP6      KQVFFMGDNLWEISLARFLVR-CGMRCPEIGIPYLDRRYLGAELAMLEATCQSMGVPLPR
CHLN_SYNE7      KQVFFMGDNLWEISLARFLVR-CGMRCPEIGIPYLDRRYLGAELAMLEATCQSMGVPLPR
CHLN_PORPU      KSVFFMGDNLLEVSLARFLTR-CGMTVYEIGIPYMDKRYQAAELALLKSTCDDMNVMMPT
CHLN_CYAPA      KSVFFMGDNLLELSIARFLIR-CGMIVPEIGIPYLHKRYQEAEIKLLEDTCRKMQVPTPL
CHLN_GLOVI      RSVFFMGDNLLEVSMARFLIR-CGMIVHEVGIPYMDKRYQQAELELLDRTCRELGHPPVR
BCHN_HELMO      KKIMFLGDNLLELPLARFLTS-CDVQVVEAGTPYIHSKDLQQELELLKER-------DVR
BCHN_CERS4      KSVFFLPDSQLEPSLARFLTRECGMSAVEVGTPFLHRGILGPDLDLIAEG--------PV
BCHN_RHOS1      KSVFFLPDSQLEPSLARFLTRECGMSAVEVGTPFLHRGILGPDLDLIAEG--------PV
BCHN_CERS5      KSLFFFPDSQLEPSLARFLTRECGMSAIEVGTPFLHRGILGPDLDLLAEG--------PV
BCHN_DINSH      KSIFFFPDSQLEIPLARFLTRECGMAAIEVGAPYIHKGLVGPDLDLLAAG--------PT
BCHN_JANSC      KSVFFMPDSQLEIPLARFLTRECGMEAIEIGQPFIHKGLVGPDLDLMPAG--------PT
BCHN_ROSDO      KTIFFFPDSQLEIPLARFLTRECGMEAIEVGSPFVHKGIIGSDLEMLAQG--------PV
BCHN_RHOCB      KSLFMFPDSQLEIPLARFLARECGMKTTEIATPFLHKAIMAPDLALLPSN--------TA
BCHN_RHOPS      RRIFFFPDSQLEIPLARFLSRELSMKLVEVGTPYLHREHLAEELKLLPAG--------VA
BCHN_RHOP2      RRIFFFPDSQLEIPLARFLARELSMQLVEVGTPYLHREHLAEELKLLPAG--------VA
BCHN_RHOPA      RRIFFFPDSQLEIPLARFLSRELDMQLVEVATPYLHREHLAEELKLLPIE--------VA
BCHN_RHOP5      RRLFFFPDSQLEIPLARFLSRELSMELVEVGTPYLHREHLAEELKLLPAD--------AA
BCHN_RHOPB      RRIFLFPDSQLEIPLARFLSRELGMQLVEVGTPYLHREHLAEELKLLPPD--------VQ
BCHN_BRASB      KRVFLFPDSQIEIPLARFLSREIGMELVEVGTPYLHRDHLASELALLPGG--------TQ
BCHN_BRASO      KRVFLFPDSQIEIPLARFLAREIGMELVEVGTPYLHRDHLAAELPMLPAG--------TL
BCHN_RHORT      KRVFFFPESQLEIPLARFLVRELGMEAIEIGTPYLHRAHLAEELALLPAT--------AL
CHLN_PROM1      KKLFLLPESQLEIPLARFLSNECGMEIVEIGTPYLNRDLMKAEIDLLPPD--------CR
CHLN_PROMT      KKLFLLPESQLEIPLARFLSNECGMEIIEIGTPYLNRDLMKAEIDLLPPD--------CR
CHLN_PROMA      KKLFLLPESQLEIPLARFLSNECGMKLIEVGVPYLNREMMGPELDLLPQN--------TR
CHLN_PROMS      KRLFLLPESQLEISLARFLHNECEMDLVEVGTPYLNKDLMKEEINLLPDN--------TK
CHLN_PROM0      KRLFLLPESQLEISLARFLHNECEMDLIEVGTPYLNKDLMKEEINLLPDN--------TK
CHLN_PROM2      KRLFLLPESQLEISLARFLHNECEMDLIEIGTPYLNKDLMKEEINLLPDN--------TK
CHLN_PROM9      KKLFLLPESQLEISLARFLHNECGMELIEVGTPYLNKDLMDEELNLLPDD--------TK
CHLN_PROMP      KKLFLLPESQLEISLARFLHNECEMELIEVGTPYLNRDLMEEELNLLPDD--------TK
CHLN_PROM5      KKLFLLPESQLEISLARFLHNECEMELIEVGTPYLNKDLMEEELNLLPDD--------TK
CHLN_PROM3      KRIFLMPESQLEIPLARFLHRECGMELVEVGVPYLNRDMMQSELELLPPN--------TQ
CHLN_PROMM      KRIFLMPESQLEIPLARFLHRECGMELVEVGVPYLNREMMQSELELLPQN--------TP
CHLN_SYNSC      KRIFLLPESQLELPLARFLHRECGMQLVEVGTPYLNREQMAAELDLLPDD--------VP
CHLN_SYNPW      KRIFLLPESQLELPLARFLHRECGMDLVEVGVPYLNREQMAEELALLPDG--------TT
CHLN_SYNS9      KRIFLLPESQLELPLARFLQRECGMELVEVGTPYLNRDQMAEEIALLPEG--------TP
CHLN_SYNPX      KRIFLLPESQLELPLARFLQRECGMELVEVGTPYLNREQMAEELALLPEG--------TP
CHLN_SYNS3      KRIFLLPESQLELPLARFLQRECGMELVEVGTPYLNREQMAEELALLPEG--------TS
CHLN_SYNR3      KRLFLLPDSQMELALGRFLQRECGMELVEVGTPYLDRALQQEELDLLPAD--------VQ
BCHN_HALHL      KRITFLPDSQLELPLARFLSEECGMQPVEVATPYFDREFHGRERDALGEE--------VR
                :   :  :.  * .:.***         * . .:.       :   :             

BCHN_CHLPD      VVEQPNFHRQLEDVTRIQPDLIITSLMTANPFAGHGFVVKWSMEFMLMPIHSWSGVIPLA
BCHN_CHLL3      VVEQPNFHRQLEDIKRLRPDLVVTSLMTANPFVGHGFIVKWSMEFMLMPIHGWSGVITLA
BCHN_CHLCH      VVEQPNFHRQLEDIRRERPDLIVTSLMTANPFVGNGFVVKWSMEFMLMPIHSWSGVVSLA
BCHN_CHLTE      VVEQPNFHRQLEEIRATRPDMIVTSLMTANPFVGNGFIVKWSMEFTLMSIHSWSGVFTLA
BCHN_CHLAA      LVEQANFHRQLRTITETKPDLIISNIITTNPLVGQGTVAKWGTEYCFLPIHGWAGVNNLV
BCHN_ROSS1      VVEQPNFDRQLRDIQELRPDLVISNLATTNPLVGHGVVAKWSTEFSFMPIHGWSGAATLA
CHLN_ANTAG      IVEKPDNYNQIQRMRELQPDLAITGMAHANPLEARGINTKWSVEFTFAQIHGFTNAKDVL
CHLN_MARPO      IVEKPDNYNQIQRMRELQPDLAITGMAHANPLEARGINTKWSVEFTFAQIHGFTNAKDVL
CHLN_PHYPA      IVEKPDNYNQIQRMRELQPDLAITGMAHANPLEARGINTKWSVEFTFAQIHGFTNARDVL
CHLN_PINKO      IVEKPDNSNQIRRMRELQPDLAITGMAHANPLGARGIGTKWSVEFTFAQIHGFANARDVL
CHLN_PINTH      IVEKPDNSNQIRRMRELQPDLAITGMAHANPLGARGIGTKWSVEFTFAQIHGFANARDVL
CHLN_CYCTA      IVEKPDNYNQLRRIRELQPDLAITGMAHADPLEARGMNTKWSVEFTFAQIHGFANARNVL
CHLN_HUPLU      IVEKPDNYNQLQRMYELQPDLVFTGMAHANPLQARGINTRWSIEFTFAQIHGFTNAKEIL
CHLN_ANGEV      IVEKPDNYNQIQRMRELQPDLAITGMAHANPLEARGINTKWSVEFTFAQIHGFTNAKDVL
CHLN_ADICA      IVEKPDNYGQIQRMHELKPHLAITGMAHANPLEARNIDTKWSVEFTFAQIHGFSSVRDIL
CHLN_CHAGL      IVEKPDNYNQVQRMRELQPDLAITGMAHANPLEARGISTKWSVEFTFAQIHGFTNARDIL
CHLN_CHAVU      IVEKPDNYNQIQRIRELKPDLAITGMAHANPLEARGISTKWSVEFTFAQIHGFTNARDIL
CHLN_CHLVU      IVEKPDNYNQIQRIRELQPDLAITGMAHANPLEARGINTKWSVEFTFAQIHGFTNARDIL
CHLN_PLETE      IVEKPDNYNQIQRIKELQPDLAITGMAHANPLEARGISTKWSVEFTFAQIHGFTNSRDIL
CHLN_MESVI      IVEKPDNYNQIQRIKELQPDLAITGMAHANPLEARGISTKWSVEFTFAQIHGFTNARDIL
CHLN_CHLAT      IVEKPDNYNQIQRIRELQPDLAITGMAHANPLEARGISTKWSVEFTFAQIHGFTNARDIL
CHLN_STAPU      IVEKPDNYNQVQRMRELQPDLAITGMAHANPLEARGISTKWSVEFTFAQIHGFTNARDIL
CHLN_ZYGCR      IVEKPDNYNQVQRMRELQPDLAITGMAHANPLEARGISTKWSVEFTFAQIHGFTNARDIL
CHLN_NEPOL      IVTKPDNFYQVQRMRDVQPDLAITGMAHANPLEARGTGTKWSVELTFWQLHGFASAKDLL
CHLN_STIHE      IVEKPDNYYQIQRIRELQPDLVITGMALSNPLEARGINTKWSVEFTFAQIHGFANSKDVL
CHLN_NOSS1      MVEKPDNYNQVQRIYDLKPDLVITGMAHANPLEARGINTKWSVEFTFAQIHGFTNARDIL
CHLN_TRIV2      MVEKPDNYNQVQRIYDLKPDLVITGMAHANPLEARGINTKWSVEFTFAQIHGFTNARDIL
CHLN_TRIEI      IIEKPDNYNQIQRIYELQPDLVITGMAHANPLEARGINTKWSVEFTFAQIHGFTNARDIL
CHLN_SYNY3      IVEKPDNYNQIQRIKALQPDLVITGMAHANPLEAQGINTKWSVEFTFAQIHGFTNARDIL
CHLN_SYNJA      LVEKPDNYHQLQRIKALQPDLVITGMAHANPLEARGITTKWSVEFTFAPIHGFGNTQALL
CHLN_SYNJB      IVEKPDNYNQIQRIKALQPDLVITGMAHANPLEARGITTKWSVEFTFAQIHGFGNTQALL
CHLN_THEEB      IVEKPDNYNQLQRIKALQPDLVITGMAHANPLEARGISTKWSVEFTFAQIHGFGNARDIL
CHLN_SYNP6      LVEKPDNYNQLQRIEALQPDLVITGMAHANPLEARGISTKWSVEFTFAQIHGFGNARAIL
CHLN_SYNE7      LVEKPDNYNQLQRIEALQPDLVITGMAHANPLEARGISTKWSVEFTFAQIHGFGNARAIL
CHLN_PORPU      IVEKPDNYNQLDRIRDLKPDLVITGMAHANPLEARGINTKWSVEFTFAQIHGFTNARDIL
CHLN_CYAPA      IIEKPDNYEELKRIEQYRPDLVITGMANANPLEARGINTKWSVEFTFAQIHGFSNARDIL
CHLN_GLOVI      IVEKPDNYNQIQRIYACKPDLVITGMAHANPLEARGITTKWSVEFTFAMIHGFTNAHDML
BCHN_HELMO      IVESPDFTKQLQRMQEYKPDLVVAGLGICNPLEAMGFTTAWSIEFTFAQIHGFVNAIDLI
BCHN_CERS4      LSEGQDVERQLDRVRAARPDLTVCGLGLANPLEAEGFTTKWAIELVFTPVHFYEQAGDLA
BCHN_RHOS1      LSEGQDVERQLDRVRAARPDLTVCGLGLANPLEAEGFTTKWAIELVFTPVHFYEQAGDLA
BCHN_CERS5      ISEGQDVERQIDRVRATNPDLTVCGLGLANPLEAEGFTTKWAIELVFTPVHFYEQAGDLA
BCHN_DINSH      LSEGQDVDMQLDRCRAARPDLTVCGLGLANPLEAEGLTTKWAIELVFTPVHFYEQAGDLA
BCHN_JANSC      ISEGQDVDKQLDRVRAAQPDLTVCGLGLANPLEAEGLTTKWAIELVFTPVHFYEQAGDLA
BCHN_ROSDO      ISEGQDVDLQLDRCRAARPDLTVCGLGLANPLEAEGLATKWAIELVFTPVHFYEQAGDLA
BCHN_RHOCB      LTEGQDLEAQLDRHEAINPDLTVCGLGLANPLEAKGHATKWAIELVFTPVHFYEQAGDLA
BCHN_RHOPS      ITEGQDVDLQLDRCRLARPDIVVCGLGLANPLEAEGITTKWSIELVFTPIQGYEQAADLA
BCHN_RHOP2      LTEGQDVDLQLDRCRLARPDIAVCGLGLANPLEAEGITTKWSIELVFTPIQGYEQAADLA
BCHN_RHOPA      LTEGQDVDDQLDRCRIARPDIVVCGLGLANPLEAEGITTKWSIELVFTPIQGYEQAADLA
BCHN_RHOP5      ITEGQDVDLQLDRCREARPDIVVCGLGLANPLEAEGMTTKWAIELVFTPIQGYDQASDLA
BCHN_RHOPB      ITEGQDVDLQLDRCRLARPDLVVCGLGLANPLEAEGMTTKWAIELVFTPIQGYEQASDLA
BCHN_BRASB      LSEGQDVERQLDRCRDARPDLVVCGLGLANPLEAEGLTTKWSIELIFTPIQGFEQAGDLA
BCHN_BRASO      LSEGQDVERQLDRCREARPDLVVCGLGLANPLEAEGLTTKWSIELIFTPIQGFEQAGDLA
BCHN_RHORT      LSEGQDVDRQLDRCRAARPDLVVCGLGLANPLEAEGITTKWSIELVFSPIHGYEQAGDLA
CHLN_PROM1      IVEGQHVEKQLDRVRDSSPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQASDLA
CHLN_PROMT      IVEGQHVERQLDRVRDSSPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQASDLA
CHLN_PROMA      IVEGQHVEKQLDRVREHHPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQASDLA
CHLN_PROMS      IVEGQHVEKQLDRVRESNPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQAADLA
CHLN_PROM0      IVEGQHVEKQLDRVRNSNPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQAADLA
CHLN_PROM2      IVEGQHVEKQLDRVREANPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQAADLA
CHLN_PROM9      IVEGQHVEKQLDRVRATSPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQAADLA
CHLN_PROMP      IVEGQHVEKQLDRVRASNPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQAADLA
CHLN_PROM5      IVEGQHVEKQLDRVRASCPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQAADLA
CHLN_PROM3      VMEGQHVEKQLDRVREQRPDLVVCGMGLANPLEAEEIATKWSIELIFSPIHGIDQAADLA
CHLN_PROMM      VMEGQHVEKQLDRVREQRPDLVVCGMGLANPLEAEEIATKWSIELIFSPIHGIDQAADLA
CHLN_SYNSC      VMEGQHVEQQLDRVRASQPDLVVCGMGLANPLEAEGIATKWSIELVFSPIHGIDQAGDLA
CHLN_SYNPW      VVEGQHVERQLDRVRAGHPDLVVCGMGLANPLEAEGITTKWSIELVFSPIHGIDQAGDLA
CHLN_SYNS9      VMEGQHVELQLDRVRDSKPDLVVCGMGLANPLEAEGIATKWSIELVFSPIHGIDQAGELA
CHLN_SYNPX      VMEGQHVELQLDRVRDSAPDLVVCGMGLANPLEAEGIATKWSIELVFSPIHGIDQAGDLA
CHLN_SYNS3      VMEGQHVENQLDRVRATQPDLVVCGMGLANPLEAEGIATKWSIELVFSPIHGIDQAGELA
CHLN_SYNR3      LSEGQNVEEQLQRVRQSHPDLVVCGMGLANPLEAEGITTKWSIELVFSPIHGCDQAGDLA
BCHN_HALHL      LVEGQDVDAQLDRLRADRPDLTVCGLGLANPLEAEGLRTKWSIELVFSPIQGFEQAGDLA
                :    .   ::       *.: . .:   :*: .    . *. *  :  ::       : 

BCHN_CHLPD      NLFVSPLQRRSKLPAF-DKDVWIEGVMPSAE--------
BCHN_CHLL3      NLFVSPLDRRSKLPAF-DKAVWLEGVMPAAE--------
BCHN_CHLCH      NLFVAPLQRRSMLPAF-DESVWLEGAMPSAEVHA-----
BCHN_CHLTE      NLFVSPLLRRESLPEF-DESVWLEGVMPSAQ--------
BCHN_CHLAA      TSFTRALQRHARLDPLGSDPIWLTGMMPGSSGGVISLQS
BCHN_ROSS1      GMFTRPLKRHAQLDPLMDDPLWVAGLMPAR---------
CHLN_ANTAG      ELVTRPLRRNNSLE-DLGWTNLIKKDNKIKVI-------
CHLN_MARPO      ELVTRPLRRNNNLE-NLGWTNLIKIQKR-----------
CHLN_PHYPA      ELVTRPLRRNNNLE-NLGWNDLTKKEKQIKFN-------
CHLN_PINKO      ELVTRPLRRNENLD-NLDRTTLVRNNNEFYTSTPTPR--
CHLN_PINTH      ELVTRPLRRNENLD-NLDRTTLVRKNNELYTSTPVK---
CHLN_CYCTA      ELVTRPLRCNDNLE-DLGRTTLVK---------------
CHLN_HUPLU      KLIIRPLKDNNDFK-NFDWTNLVRKDNNSLN--------
CHLN_ANGEV      ELVTRPLRRNNSLE-HLGWTNLLQPTII-----------
CHLN_ADICA      ELVTRPLRRR-GVI-TPGFRSLSKQTTGD----------
CHLN_CHAGL      ELVTRPLRRNHSLQ-GLGWSSLVKEQNQLIPS-------
CHLN_CHAVU      ELVTRPLRRNQSLH-ELGWNNLVKVNSQ-----------
CHLN_CHLVU      ELVTRPLRRNKALE-NLGWNQLVKM--------------
CHLN_PLETE      ELVTRPLRRNNSLEGSLGWTQLVKSTV------------
CHLN_MESVI      ELVTRPLRRNNSLE-GLGWNSLVKENIK-----------
CHLN_CHLAT      ELVTRPLRRNNSLE-GLGWTSLVKEGVLSN---------
CHLN_STAPU      ELVTRPLRRNLSLE-QLGWTGLVKRNKLTA---------
CHLN_ZYGCR      ELVTRPLRRNLSLE-DLGWSALVKRDKINLV--------
CHLN_NEPOL      ELVTRPLRRTH----------------------------
CHLN_STIHE      ELVTRPLRRNMMQQ--VSNKTLVKPAK------------
CHLN_NOSS1      ELVTRPLRRNNNLK-DLGWDKLVREEAKI----------
CHLN_TRIV2      ELVTRPLRRNNNLK-DLGWDKLVREEAKI----------
CHLN_TRIEI      ELVTRPLRRNNALK-DLGWDKLVKEEAKV----------
CHLN_SYNY3      ELATRPLRRNSQLG-ELGWDKLIAKDVPAQV--------
CHLN_SYNJA      ELVTRPLRRNAALK-GLGWEQLVREEASV----------
CHLN_SYNJB      ELVTRPLRRNAALK-GLGWERLVREEAPI----------
CHLN_THEEB      ELVTRPLRRNQALA-GLGWQKLVAH--------------
CHLN_SYNP6      ELVTRPLRRNLALG-TLGGSQWVSEAVTSR---------
CHLN_SYNE7      ELVTRPLRRNLALG-TLGGSQWVSEAVTSR---------
CHLN_PORPU      ELVTRPLRRNLSLS-ELGWDIYSKQG-------------
CHLN_CYAPA      ELVTRSLRRKNYIQ-QLGWKELVE---------------
CHLN_GLOVI      KMVRKPLDRNNALK-SLGWEKLIQEV-------------
BCHN_HELMO      KLFTKPLLKRQALM-EHGWAEAGWLE-------------
BCHN_CERS4      GLFSRPVRRRAILRREAAE--------------------
BCHN_RHOS1      GLFSRPVRRRAILRREAAE--------------------
BCHN_CERS5      GLFARPLRRRAILRREAAE--------------------
BCHN_DINSH      GLFARPIRRREKLRLEVAE--------------------
BCHN_JANSC      GLFSRPVRRRAVLKLEAAE--------------------
BCHN_ROSDO      GLFSRPVRRAGLLKVEAAE--------------------
BCHN_RHOCB      GLFSRPLRRRALLNGGAA---------------------
BCHN_RHOPS      ELFARPLVRRAKLVA------------------------
BCHN_RHOP2      ELFARPLVRRAKLVA------------------------
BCHN_RHOPA      ELFARPLVRRAKLVA------------------------
BCHN_RHOP5      ELFARPLVRRAKLVA------------------------
BCHN_RHOPB      ELFARPLVRRAKLVA------------------------
BCHN_BRASB      ELFARPLLRQTRLAV------------------------
BCHN_BRASO      ELFARPLLRQTRLAV------------------------
BCHN_RHORT      ELFARPLLRRALLKV------------------------
CHLN_PROM1      ELFSRPLRRHDILNPTKTLTSN-----------------
CHLN_PROMT      ELFSRPLRRHDILNP-KTLTSN-----------------
CHLN_PROMA      ELFARPLHRQNLLNK-KTLEAV-----------------
CHLN_PROMS      GLFSKPLRRNQILTT-KTLVTH-----------------
CHLN_PROM0      GLFSKPLKRNQILTS-KTLVTH-----------------
CHLN_PROM2      GLFSKPLRRNQILTS-KTLVTN-----------------
CHLN_PROM9      GLFSRPLKRNQILTS-KTLATH-----------------
CHLN_PROMP      GLFSRPLTRNQILTS-KSLATH-----------------
CHLN_PROM5      ELFSRPLTRNQILTS-KTLATY-----------------
CHLN_PROM3      ELFARPLHRRDLLNNQLLVSV------------------
CHLN_PROMM      ELFARPLHRRNLLNNQLLVSV------------------
CHLN_SYNSC      ELFSRPLRRRQLIRPGLHPSS----LDPTVHA-------
CHLN_SYNPW      ELFSRPLHRRQLIHSALHPQA----SDHPVHA-------
CHLN_SYNS9      ELFSRPLRRHQLLAH------------------------
CHLN_SYNPX      ELFSRPLRRRQLIHPGLHPTQ----PDQPVHA-------
CHLN_SYNS3      ELFSRPLRRRELIRQALNPPSSALIDSDPVHA-------
CHLN_SYNR3      ELFARPLRRRGALTFA-----------------------
BCHN_HALHL      ELFARPLVRHETLKV------------------------
                     .: