CLUSTAL format seed alignment for MF_00354

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

IDI2_MYCGI      -----MTPDPAS-ALQHRKRRHIDVCLTDPVDYQ-TLT----TGFERYQLPYNALTQTDL
IDI2_MYCVP      -----MTSDPGS-ALQHRKRRHIDVCLTEAVDYQ-SLT----TGFERYRLPYNALTQTDL
IDI2_MYCUA      -----MTNDPA--EISSRKRRHIDVCLNDEVNYV-GVT----TGLERYRLPFNALTQTSL
IDI2_MYCMM      -----MTNDPA--EISSRKRRHIDVCLNDEVNYV-GVT----TGLERYRLPFNALTQTSL
IDI2_DEIRA      -----MSSDPTGRPIETRKLRHLEACLRPESQYQ-KVK----TGLDSVPWPYRALPESNL
IDI2_THET2      -----MN-------IRERKRKHLEACLEGEVAYQ-KTT----TGLEGFRLRYQALAGLAL
IDI2_TRIV2      ---MNSPATSNSAQTQSRKADHIRICLEEDVQFR-ATT----NGLERYRFNHSCLPEIDR
IDI2_NOSS1      ---MNPPTTSDSAQTQSRKADHIRICLEEDVQFR-DTT----NGLERYRFTHSCLPEIDR
IDI2_THEEB      MQSNLGTLLVNSPIEQ-RKAEHLKLCLQGDVNHQ-EIT----TGFEKYRFRHCALPELDF
IDI2_SYNP6      ---MNFPIAAESSLPQ-RKAEHLQLCLEAGVESP-EVT----TGLERYRFQHCALPNLSL
IDI2_SYNY3      -----------MDSTPHRKSDHIRIVLEEDVVGK-GIS----TGFERLMLEHCALPAVDL
IDI2_RICBR      ------------MLDIKRKQDHIEINLTKNVES--GLS----SGFESVQFVHNALPEINY
IDI2_RICB8      ------------MLDIKRKQDHIEINLTKNVES--GLS----SGFESVQFVHNALPEINY
IDI2_RICCN      -------MLKDQNLDIERKQDHIEINLTKNVES--TLK----SGFESIHFIHNALPEINY
IDI2_RICAE      -------MLKDQNLDIERKQDHIEINLTKNVES--TLK----SGFESIHFIHNALPEINY
IDI2_RICPU      -------MLKDQNLDIERKQDHIEINLTKNVES--TLK----SGFESIHFIHNALPEINY
IDI2_RICRO      -------MLKDQNLDIERKQDHIEINLTQNVES--TLK----SGFESIHFIHNALPELNY
IDI2_RICRS      -------MLKDQNLDIERKQDHIEINLTQNVES--TLK----SGFESIHFIHNALPELNY
IDI2_RICFE      ----MSKMPKNQNLDIERKQDHIEINLMKNVAS--TLT----SGFESMQFIHNALPEINY
IDI2_RICAH      -------MPKDQNLDIARKQDHIEINLTKNVES--TLK----SGFESIQFIHNALPEINY
IDI2_RICCK      -------MLKNQDLDIERKQEHIEINLTKNIES--TLK----SGFESIQFIHNALPEINY
IDI2_RICPR      -------MPKEQNLDIERKQEHIEINLKQNVNS--TLK----SGLESIKFIHNALPEINY
IDI2_RICTY      -------MLEEQNSDIERKQDHIEINLKQNVNS--TLK----SGLASIKFIHNALPEINY
IDI2_OCEIH      ---------MEKGINQ-RKTEHIRLCLTGNVEGV-NKS----TGLEGINFIHNALPEIDF
IDI2_CROS8      -------MKDKELSQ--RKNDHLDIVLHPERAKQ-TIR----TGFEQWRFEHCALPELAL
IDI2_PSEVU      -------MKDERLVQ--RKNDHLDIVLDPRRAVT-QAS----AGFERWRFTHCALPELNF
IDI2_PSEU5      -------MSKQSLVS--RKNDHLDIVLDPTRAIA-ATG----TGFGAFRFEHCALPELHL
IDI2_RHILO      -------MSDSDNIPSRRKDDHLDIVLDRRTAPA-TVA----AGWEYIRFEHCALPELDL
IDI2_XANP2      -------MDESGAGR--RKEDHIDIVLAGGRVAS-RLD----AGFDRVRFVHCALPELDL
IDI2_VIBCB      -------MAPQ--SN--RKDLHLDAVLHHDMNMK-SKT----AGFESVEFEHCALPECDF
IDI2_VIBPA      -------MAPQ--TN--RKDLHLDAVLHHDMSMK-KKT----AGFESVEFEHCALPECDF
IDI2_PARZE      ------MTDSKDHHVAGRKLDHLRALDD-DADID-RGD----SGFDRIALTHRALPEVDF
IDI2_HYDCU      ------MSDSP---ITQRKQDHIDWLLQ-DEKIE-RQQ----AGFDQIQLTHRGLPECDY
IDI2_CHLCH      -----MTNPSAGTLTIERKQSHVELCLHANVAFS-GKT----TGFERFYFEHNALPEIAF
IDI2_PELPB      ------MSETANSRTTERKQDHIEICLHGDVVFN-GKT----TGFERFAFEHAALPEISF
IDI2_CHLPD      ---MNEKLSTPSNITIERKLNHVEICLHGNVSFE-GTT----TGLERYAIEHQAVPEINY
IDI2_CHLL2      ------MSDSLSNITIERKHNHVEICLHEAVGFD-RKS----AGFDEIEFIHNALPEIRF
IDI2_CHLP8      ------MQETSATITAERKHSHVDVCLNRPVCFD-GQD----TGLDAWRFEHNAAPEIDF
IDI2_CHLTE      ------MQEASAAITAERKHSHVDICLNRPVCFD-GQD----TGLDSWRFEHNAAPEVDF
IDI2_CHLPM      ------MSTTITNSTAERKHSHVDICLRGDVAFS-TIT----TGLERYRLRHNALPELNY
IDI2_PELLD      ------MSTTITNSTAERKHSHVDICLNGDVAFS-TPT----TGFERYRLRHNALPEVSF
IDI2_SULIM      -----------MPDIVNRKVEHVEIAAFENVDGL-SSS----TFLNDVILVHQGFPGISF
IDI2_SULIK      -----------MPDIVNRKVEHVEIAAFENVDGL-SSS----TFLNDVILVHQGFPGISF
IDI2_SULIY      -----------MPDIVNRKVEHVEIAAFENVDGL-SSS----TFLNDVILVHQGFPGISF
IDI2_SULIN      -----------MPDIVNRKVEHVEIAAFENVDGL-SSS----TFLNDVILVHQGFPGISF
IDI2_SULIL      -----------MPDIVNRKVEHVEIAAFENVDGL-SSS----TFLNDVILVHQGFPGISF
IDI2_SULIA      -----------MPDIVNRKVEHVEIAAFENVDGL-SSS----TFLNDVILVHQGFPGISF
IDI2_SACSH      -----------MPDIVNRKVEHVEIAAFENVDGL-SSS----TFLNDVILVHQGFPGISF
IDI2_SACS2      -----------MPDIVNRKVEHVEIAAFENVDGL-SSS----TFLNDVILVHQGFPGISF
IDI2_SULTO      ---------MKNISITNRKIEHVEICLYENVE---FGS----TLFEDVTLIHQSLPGFSL
IDI2_METS5      ------------MSLINRKLEHVEICLYEDVQG--IVS----TLLEDVTLIHQAMPRMNF
IDI2_IGNH4      ------------METSNRKLDHLRITLLEDVE---AGD----TWLDFVKVPHRAVPELNL
IDI2_AERPE      ----------MTGDTSARKLEHLKMIVSSKVES--RES----TLLEYVRIVHNPTPEVNL
IDI2_METKA      --------------MRERKWEHVLACIWEDVES--EES----PLFDCVKIVHRALPELDF
IDI2_PYRAR      ------------MGIDKRKNDHIYLASSDLSQ---VGT----ALFEEVVLIHNALPEIDF
IDI2_PYRAE      ------------MGIDKRKDDHIYLASSELSQ---IGS----AWFEEVVLIHNALPEIDL
IDI2_PYRIL      ------------MAIDKRKNDHIYLASSEISQ---VGS----PWFDEVILLHNALPEIDL
IDI2_PYRNV      ------------MEIDRRKNDHIYLASSEISQ---VGS----PWFDEVILIHNALPELDL
IDI2_METMA      ----------MINTTSRRKIEHLKLCAESPVEARQVS-----AGFEDVTLIHRALPELNM
IDI2_METAC      ----------MINTTSRRKIEHLKLCAESPVEARGVS-----AGFEDVTLIHRALPELNM
IDI2_METBF      ----------MISTTSKRKIEHLKLCAESPVESRKVS-----AGFEDVTLIHRALPELDM
IDI2_METBU      ------------MSTSKRKIEHLELCAKRPVESRNVT-----SGFDDVMLIHKALPQIHM
IDI2_ARCFU      ------------MSTSKRKIDHLKICLEEEVESG--Y-----TGLEDVMLIHKALPEVDY
IDI2_NATPD      ------MPDSEPSETEDRKDDHVRIIREEDVESG--G-----TGLGDVRLVHEALPDVHY
IDI2_HALSA      ------MTAQDSTQTEDRKDDHLQIVQERDVETT--G-----TGFDDVHLVHNALPELDY
IDI2_METTP      ------------METVRRKLEHIEICLKKEVVSK--Y-----RPFDDLILLHRALPEIDE
IDI2_METB6      ------MAYNKKRFTSSRKLDHLRICAEEEVESG--D-----AGFGDVRLVHHALPECDM
IDI2_METMP      ---------MNNNSIEYRKLEHLIVCDHCDVEYKK--G----TLLEDVELIHSGISNCDL
IDI2_META3      ----------MSNDIEFRKLEHLFVCNYCDVEYKK--G----TLLEDVELIHSGISNCDL
IDI2_METJA      -------MVNNRNEIEVRKLEHIFLCSYCNVEYEK--T----TLLEDIELIHKGTCGINF
IDI2_THEVO      -------------MIEKRKEEHIRIAENENVSAFH-------NYWDDVYLMHEADPEVNY
IDI2_THEAC      -------------MIGKRKEEHIRIAENEDVSSFH-------NFWDDISLMHEADPEVNY
IDI2_PICTO      -------------MIENRKEEHIKIAENENVVSEH-------NFWDDIRIVHRAIPEVDF
IDI2_THEKO      -----MGEFDREELTIIRKFEHIEHCLKRNVQAHV--T----NGFEDVHFVHMSLPEIDK
IDI2_THEON      -----MKAFDKEELTIIRKFEHIEHCLKRNVQAHV--S----NGFEDVHFVHMSLPEIDK
IDI2_THESM      -----MVKVDKEELTVIRKFEHIEHCLKKQVEAHV--S----TQFENIHFVHTSLPEIDK
IDI2_PYRHO      ---------MKEELTILRKFEHIEHCLKRNVEAHV--S----NGFEDVYFVHKSLPEIDK
IDI2_PYRAB      ----------MEEQTILRKFEHIKHCLTKNVEAHV--T----NGFEDVHLIHKSLPEIDK
IDI2_PYRFU      --------MDEGTRTVLRKFEHIEHCLKRNVEAHA--T----NGFEDVHFVHMSLPEIDK
IDI2_METTH      -------------MISDRKLEHLILCASCDVEYRK--K----TGFEDIEIVHRAIPEINK
IDI2_LEGPA      -------MQNEYSQFEQRKRDHIELALMPANQSN--EL----NPFDHFSLVHEALPDLDF
IDI2_LEGPH      -------MQNEYSQFEQRKRDHIELALMPANQSS--EL----NPFDHFSLVHEALPDLDF
IDI2_LEGPC      -------MQNEYSQFEQRKRDHIELALMPANQSS--EL----NPFDHFSLVHEALPDLDF
IDI2_LEGPL      -------MQNEYSQFEQRKRDHIELALMPANQSS--EL----NPFDHFSLVHEALPDLDF
IDI2_BDEBA      -------MDESNSQFEKRKRDHIRIALDPRSQTD--GQ----NGLDSITLIHEALPDLNF
IDI2_BORBU      -------MGIEPNILENKKR-HIEICLNKNDVKG--GC----NFLKFIKLKHNALSDFNF
IDI2_BORAP      -------MGIEPNILENKKR-HIDICLNKNDVKS--GC----NFLRFVKLKHNALSDFNF
IDI2_BORBP      -------MGIEPNILENKKR-HIEICLNKNDVKG--GC----NFLKFIKLKHNALSDFNF
IDI2_BACSU      ------------MTRAERKRQHINHALSIGQKR--------ETGLDDITFVHVSLPDLAL
IDI2_BACVZ      ------------MTRAERKREHINHALSTGQNR--------ETGLDDITFVHVSLPNLAL
IDI2_BACLD      ------------MTRAKRKKEHIDHALSTGQKR--------QTGLDDITFVHVSLPETEL
IDI2_BACP2      ------------MTRAERKKQHIEHALSTGQHA--------ETGLKDVSFVHVGLPDLAT
IDI2_BACAN      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIEFVHQSLPNSSY
IDI2_BACAC      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIEFVHQSLPNSSY
IDI2_BACAA      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIEFVHQSLPNSSY
IDI2_BACC0      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIEFVHQSLPNSSY
IDI2_BACC3      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSSY
IDI2_BACAH      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSSY
IDI2_BACHK      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSSY
IDI2_BACCZ      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSSY
IDI2_BACC7      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSNY
IDI2_BACCQ      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSNY
IDI2_BACC1      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSNY
IDI2_BACCR      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSNY
IDI2_BACC4      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSNY
IDI2_BACC2      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSNY
IDI2_BACMK      ------------MVRAKRKLDHIEYALSTGQSR--------THGFHDIDFVHQSLPNSSY
IDI2_BACCN      ------------MAREKRKLEHIEYALSTGQSR--------THGFCDIEFVHKSLPNSSF
IDI2_GEOSW      ------------MSRAKRKIEHIQHALSTADQG--------ASGFDDITFVHQSLPDVRM
IDI2_MOOTA      -----------MNEREYIGRGRRKLEHLRFFQ----EDSKGSNGLEDVHLVHQALPELNW
IDI2_SYMTH      -----------MDLRQQRKRDHVRLAAAWQERRPPPAAAGPGAGWEDVHLVNHSLPELAL
IDI2_STRMU      --------------MTNRKDDHIKYALD---YRSPYNS------FDDIELIHHSLPDYDL
IDI2_STRGC      -------------MSQNRKDDHIKYALE---QRPGYNS------FDEMELVHRSLPKYDL
IDI2_STRPN      -------------MTTNRKDEHILYALE---QKSSYNS------FDEVELIHSSLPLYNL
IDI2_STRPS      -------------MTTNRKDEHILYALE---QKSSYNS------FDEVELIHSSLPLYNL
IDI2_STRPJ      -------------MTTNRKDEHILYALE---QKSSYNS------FDEVELIHSSLPLYNL
IDI2_STRP2      -------------MTTNRKDEHILYALE---QKSSYNS------FDEVELIHSSLPLYNL
IDI2_STRR6      -------------MTTNRKDEHILYALE---QKSSYNS------FDEVELIHSSLPLYNL
IDI2_STRP7      -------------MTTNRKDEHILYALE---QKSSYNS------FDEVELIHSSLPLYNL
IDI2_STRP1      --------------MTNRKDDHIKYALK---YQSPYNA------FDDIELIHHSLPSYDL
IDI2_STRPQ      --------------MTNRKDDHIKYALK---YQSPYNA------FDDIELIHHSLPSYDL
IDI2_STRPM      --------------MTNRKDDHIKYALK---YQSPYNA------FDDIELIHHSLPSYDL
IDI2_STRP6      --------------MTNRKDDHIKYALK---YQSPYNA------FDDIELIHHSLPSYDL
IDI2_STRP3      --------------MTNRKDDHIKYALK---YQSPYNA------FDDIELIHHSLPSYDL
IDI2_STRP8      --------------MTNRKDDHIKYALK---YQSPYNA------FDDIELIHHSLPSYDL
IDI2_STAA3      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAAC      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAA8      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAAE      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAAT      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAAB      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAAR      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAAU      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAAS      ---------MSDFQREQRKNEHVEIAMA-QSD-AMYSD------FDKMRFVHHSIPSINV
IDI2_STAAW      ---------MSDFQREQRKNEHVEIAMA-QSD-AMYSD------FDKMRFVHHSIPSINV
IDI2_STAA9      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAA2      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAA1      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAAM      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAAN      ---------MSDFQREQRKNEHVEIAMA-QSD-AMHSD------FDKMRFVHHSIPSINV
IDI2_STAHJ      ---------MSDFQREQRKNEHVEIAMA-QSD-APQSD------FDRVRFVHHSIPSINV
IDI2_STAEQ      ---------MSDSQREQRKNEHVEIAMS-QKD-ALVSD------FDKVRFVHHSIPSIDV
IDI2_STAES      ---------MSDSQREQRKNEHVEIAMS-QKD-ALVSD------FDKVRFVHHSIPSIDV
IDI2_STAS1      ---------MSDNKREQRKNEHVEIAMA-QGD-ATISD------FDEIRFVHHSIPSVDV
IDI2_ENTFA      ---------MN------RKDEHLSLAKA-FHK-EKSND------FDRVRFVHQSFAESAV
IDI2_LISMF      ------MQKNDDLLRERRKDEHVALGVK-QNEQLAPSS------LEDIQLIGTSIPRYNV
IDI2_LISMC      ------MQKNDDLLRERRKDEHVALGVK-QNEQLAPSS------LEDIQLIGTSIPRYNV
IDI2_LISMH      ------MQKNDDLLRERRKDEHVALGVK-QNEQLAPSS------LEDIQLIGTSIPRYNV
IDI2_LISMO      ------MQKNDDLLRERRKDEHVALGVK-QNEQLAPSS------LKDIQLIGTSIPRYNV
IDI2_LISIN      ------MQKNDDLLRERRKDEHVALGVK-QNENLAPSS------LEDIQLIGTSIPRYNV
IDI2_LISW6      ------MQKNDDLLRERRKDEHVALGVK-QNEQLAPSS------LDDIQLIGTSIPRYNV
IDI2_KITGR      ------------MSSAQRKDDHVRLATEQQRAHSGRNQ------FDDVSFVHHALAGIDR
IDI2_STRC1      ------------MTSAQRKDDHVRLAIEQHNAHSGRNQ------FDDVSFVHHALAGIDR
IDI2_NOCFA      -------------MSSNRKDDHVRHAVDQHRDRTPVND------FDAIGFQHHALAGIDA
IDI2_LACRJ      ---------MMESRHAQRKNEHLSLAAKYYDQVHQHHY------FDQVRLIHDSLPEMTT
IDI2_LACRD      ---------MMESRHAQRKNEHLSLAAKYYDQVHQHHY------FDQVRLIHDSLPEMTT
IDI2_LACP3      ---------MTQSQQSHRKDEHVFLAEKYFQSVAHAG-------FDQVRLLHRALPETTM
IDI2_LACCB      ---------MTQSQQSHRKDEHVFLAEKYFQSVAHAG-------FDQVRLLHRALPETTM
IDI2_LACPL      ---------MPQSQQSHRKDEHVSLAEKYFHGEQANA-------FDQVRIRHDALPETAV
IDI2_LACSS      ------MVRPKQSIQSHRKDEHVFLAEKFHQDDRQND-------FDGLRFIHQSLPELAI
IDI2_LACBA      ---------MDLSRHAHRKDEHLSLAEKFYTPTATSQ-------FDQLRFVHQSLPEISL
IDI2_LACLA      -------MKTEKEIHQHRKDEHLSLAYKYWREEKNQTSG---LTFSDSRIIPNSLPELST
                                     :                                      

IDI2_MYCGI      HSVDLGTEFMGS----RLRAPVLIGAMTGGAALS---GIINRNLAEAAQQLGVGMMLGSQ
IDI2_MYCVP      HSVDLSTEFLGS----HLRAPVLIGAMTGGAALS---GIINRNLAAAAQQLGIGMMLGSQ
IDI2_MYCUA      ADIDLSAEFFGA----PLRAPVLIGAMTGGAELS---AMINRNLATAAQRLGIGMMLGSQ
IDI2_MYCMM      ADIDLSAEFFGA----PLRAPVLIGAMTGGAELS---ATINRNLATAAQRLGIGMMLGSQ
IDI2_DEIRA      EEMRLDTVFLGR----RLKAPVLIGAMTGGAEKA---GVINRNLATAARNLGLGMMLGSQ
IDI2_THET2      GEVDLTTPFLGK----TLKAPFLIGAMTGGEENG---ERINLALAEAAEALGVGMMLGSG
IDI2_TRIV2      NDIDLSATFLGK----KLNAPLLISSMTGGTEQA---GIINQRLARLAQDYKFAMGVGSQ
IDI2_NOSS1      NDIDLSATFLGK----KLNAPLLISSMTGGTEEA---GIINQRLAGLAQHYKLAMGVGSQ
IDI2_THEEB      AEIDLRVEFLGW----RLAAPLLISSMTGGTPQA---GEINRRLARVAQQKGIVMGVGSQ
IDI2_SYNP6      QALDLGTQFLGR----SLGAPLLISSMTGGTETA---QRINCRLAIAAQKYRLAMGVGSQ
IDI2_SYNY3      DAVDLGLTLWGK----SLTYPWLISSMTGGTPEA---KQINLFLAEVAQALGIAMGLGSQ
IDI2_RICBR      SSIDTTTTFLNK----ILQAPILISSMTGGTPRA---RDINCRLAAAAQKAGIAMGLGSM
IDI2_RICB8      SSIDTTTTFLNK----ILQAPILISSMTGGTPRA---RDINCRLAAAAQKAGIAMGLGSM
IDI2_RICCN      DSVNTTTTFLGK----SLQAPILISSMTGGTTRA---RDINYRLAQVAQKAGIAMGLGSM
IDI2_RICAE      DSVNTTTTFLGK----SLQAPILISSMTGGTTRA---RDINYRLAQVAQKAGIAMGLGSM
IDI2_RICPU      DSVNTTTTFLGK----SLQAPILISSMTGGTTRA---RDINYRLAQVAQKAGIAMGLGSM
IDI2_RICRO      DSINTTTTFLGK----SLQAPILISSMTGGTTRA---RDINYRLAQVAQKAGIAMGLGSM
IDI2_RICRS      DSINTTTTFLGK----SLQAPILISSMTGGTTRA---RDINYRLAQVAQKAGIAMGLGSM
IDI2_RICFE      DSIDTTSTFLGK----SLQAPILISSMTGGTTRA---GDINYRLAQAAQKAGIAMGLGSM
IDI2_RICAH      DIIDTSTTFLGK----YLQAPILISSMTGGTARA---RDINYRLAQVAQKAGIAMGLGSM
IDI2_RICCK      DNIDTTTTFLGK----ALQAPILISSMTGGTARA---RDINYRLAEAAQKAGIAMGLGSM
IDI2_RICPR      DSIDTTTTFLGK----DMKAPILISSMTGGTARA---RDINYRLAQAAQKSGIAMGLGSM
IDI2_RICTY      DNIDTTTTFLGK----YMKAPILISSMTGGTTRA---KDINYRLAQAAQKSGIAMGLGSM
IDI2_OCEIH      ADISLESSFLGK----QLKAPFLVSSMTGGSELA---TKINQNLAIAAEEKGWALAIGST
IDI2_CROS8      DDIDLSTRLFGR----VMKAPLLISSMTGGARRA---SDINRHLAEAAQTLGLAMGVGSQ
IDI2_PSEVU      SDITLETTFLNR----QLQAPLLISSMTGGVERS---RHINRHLAEAAQVLKIAMGVGSQ
IDI2_PSEU5      DQIDLQTALFGR----RLRAPLLISSMTGGAARS---AAINAHLAEAAQQLGIAMAVGSQ
IDI2_RHILO      TQIDLRASLLGK----TMRAPLLISSMTGGVLRA---EAINRHLSEAAQALGIAMCVGSQ
IDI2_XANP2      DAIDLSTRFLGR----PLKAPFLISAMTGGPARA---ESINAHLAEAAQALGIALGVGSQ
IDI2_VIBCB      NAVDLSSEFLGH----SLALPFLISSMTGGAKDA---EIINCRLAEAASEMGIAMGVGSQ
IDI2_VIBPA      NTIDLSTEFLGH----RLALPFLISSMTGGARDA---ETINCRLAEAASELGIAMGVGSQ
IDI2_PARZE      DAIDTATSFLGR----ELSFPLLISSMTGGTGEEI--ERINRNLAAGAEEARVAMAVGSQ
IDI2_HYDCU      AQVDSGTTFLQH----SLSFPLLISSMTGGASNAL--NTINENLARAAEHCQVAMAVGSQ
IDI2_CHLCH      AEIDCSTTFLGR----HIGAPLMVSSMTGGYSEA---STLNRQLAEAAEHFQIPLGVGSM
IDI2_PELPB      SDIDLSTSFLGK----SIGAPLMISSMTGGYSEA---ATLNQRLAEAAERFGIPLGVGSM
IDI2_CHLPD      ADINLSATLLGR----TIGAPLMISSMTGGYHEA---ATLNRQFAQAAEHFRIPLGVGSM
IDI2_CHLL2      SDIDLSTTFLGR----KIGAPLMISSMTGGFEKA---SLLNRRFAEAAEHFGIPLGIGSM
IDI2_CHLP8      AEIDLTAEFLGH----AIGMPLMISSMTGGYGDA---LALNRTLAEAAERFRIPLGVGSM
IDI2_CHLTE      AQIDLSTEFLGH----AIGLPLMISSMTGGYGNA---LALNRALGEAAERFRIPLGVGSM
IDI2_CHLPM      DNLSTETDFLGK----RIGAPLMISSMTGGYSEA---AELNGKLAEAAERFQLPLGVGSM
IDI2_PELLD      ADITTESRFLGR----RIGAPLMISSMTGGYSEA---AELNRQLAETAERFQLPLGVGSM
IDI2_SULIM      SEINTKTKFFRK----EISVPIMVTGMTGGRNELG---RINKIIAEVTEKFGIPMGVGSQ
IDI2_SULIK      SEINTKTKFFRK----EISVPIMVTGMTGGRNELG---RINKIIAEVTEKFGIPMGVGSQ
IDI2_SULIY      SEINTKTKFFRK----EISVPIMVTGMTGGRNELG---RINKIIAEVTEKFGIPMGVGSQ
IDI2_SULIN      SEINTKTKFFRK----EISVPIMVTGMTGGRNELG---RINKIIAEVTEKFGIPMGVGSQ
IDI2_SULIL      SEINTKTKFFRK----EISVPIMVTGMTGGRNELG---RINKIIAEVTEKFGIPMGVGSQ
IDI2_SULIA      SEINTKTKFFRK----EISVPIMVTGMTGGRNELG---RINKIIAEVTEKFGIPMGVGSQ
IDI2_SACSH      SEINTKTKFFRK----EISVPVMVTGMTGGRNELG---RINKIIAEVAEKFGIPMGVGSQ
IDI2_SACS2      SEINTKTKFFRK----EISAPIMVTGMTGGRNELG---RINRIIAEVAEKFGIPMGVGSQ
IDI2_SULTO      ADVSTTTNFLGK----KMSAPIIITGMTGGLPELG---KINETIAEVIEELGLGMGVGSQ
IDI2_METS5      RDVDTRAEFLGK----TLSLPLMVTGMTGGHEELG---KVNAVIAEVVEELGLAMGVGSQ
IDI2_IGNH4      EEVVTEIEVFGK----KLSAPLIVTGMTGGNEHAA---KINAVIAEVVEELGLGMGVGSQ
IDI2_AERPE      GDVSLEIDFCGG----RLRAPLVITGMTGGHPDVE---WINRELASVAEELGIAIGVGSQ
IDI2_METKA      DDVDMEIELFGK----RLSFPLIIAGMTGGHPKTG---EINRKLARVARELEIGIGVGSQ
IDI2_PYRAR      SDIDLSTNFLGA----PVKAPFGIGAMTGGTELAG---KINAELAKAAEEFGIPMYVGSQ
IDI2_PYRAE      SEVDLTTRFLGA----PVKAPFGIGAMTGGTELAG---KINAELAKAAEEFGIPIYVGSQ
IDI2_PYRIL      SEVDITTRFLGV----KVNAPFGIGAMTGGTELAG---KINAELAKIAEEFGIPIYVGSQ
IDI2_PYRNV      SEVDTTAKFLGA----EVKAPFGIGAMTGGTELAG---KINAELAKAAEAFGIPIYVGSQ
IDI2_METMA      DELDLSVDFLGK----RIKAPFLIASITGGHPDTI---PVNAALAAAAEELGVGIGVGSQ
IDI2_METAC      DELDLTVDFLGK----RMQAPFLIASITGGHPDTL---PVNAALAAAAEELGVGIGVGSQ
IDI2_METBF      DKLNLSIDFLGK----RLQAPFLIASITGGHPDTT---PVNAALAAAAEELGIGMGVGSQ
IDI2_METBU      DEIDLSTDFLGK----SLKAPFLIASITGGHPDTT---PVNAALAEAAEELGVGIGVGSQ
IDI2_ARCFU      WKIDTEIEFFGK----KLSFPLLIASMTGGHPETK---EINARLGEAVEEAGIGMGVGSQ
IDI2_NATPD      DDIDTSIPFLGA----ELDAPIVIESMTGGHANTT---DINRALAAAAAETGIAMGVGSQ
IDI2_HALSA      DAIDPSIDFLGH----DLSAPIFIESMTGGHHNTT---EINRALARAASETGIAMGLGSQ
IDI2_METTP      SDVCTECTFLNR----RLSAPLIISAMTGGHPDAR---EINANLATAAQETGIAIGVGSQ
IDI2_METB6      RSIDLSTRFLGH----TLSSPLFVSAMTGGHPGTK---DANARLARIAERFGLGMGVGSQ
IDI2_METMP      DDIDTSIEIFGK----KLNAPLIVAAITGGHPKAK---EVNKNIAIAVEELNLGMGVGSQ
IDI2_META3      EDIDTSINLFGK----NLGAPIIVAAITGGHSKAK---EINKNIAIAIDELNLGMGVGSQ
IDI2_METJA      NDIETEIELFGK----KLSAPIIVSGMTGGHSKAK---EINKNIAKAVEELGLGMGVGSQ
IDI2_THEVO      DDIDTGVDFLGK----HLGFPMVISSMTGGAEIAK---KINYNLATVAEKYQLAMGVGSM
IDI2_THEAC      DEIDTSVDFLGK----KLKFPMIISSMTGGAEIAK---NINRNLAVAAERFGIGMGVGSM
IDI2_PICTO      NDIDTGVKFLGK----QFNYPILISSMTGGTETAK---IINKNLAMTAEHFKIGMGVGSM
IDI2_THEKO      DEIDLSVEFLGR----KFDYPIFIAGMTGGTKGSQLAGRINKTLAKAAQELNIPMGVGSQ
IDI2_THEON      DEIDLSVEFLGR----KFDYPIMIAGMTGGTKGSQLAGKINKTLAKAAQELNIPMGVGSQ
IDI2_THESM      DEIDLSVEVLGR----KFDYPIMIAGMTGGTKGSQLAGKINKTLAKAAQELNIPMGVGSQ
IDI2_PYRHO      DEIDLTVEFLGR----KFDYPIMITGMTGGTRREEIAGKINRTLAMAAEELNIPFGVGSQ
IDI2_PYRAB      DEIDLSVKFLGR----KFDYPIMITGMTGGTRKGEIAWRINRTLAQAAQELNIPLGLGSQ
IDI2_PYRFU      DEIDLSVKFLGR----KFDYPIMITGMTGGTRKGEVAWKINRTLAQAAEELNIPLGVGSQ
IDI2_METTH      EKIDISLDFLGR----ELSSPVMISAITGGHPAS---MKINRELARAAEKLGIALGLGSQ
IDI2_LEGPA      KDISIQSIRFKK----PVEKPFIISSMTAGHSNAL---EINSRLMEACSKTKWAMGVGSQ
IDI2_LEGPH      KDISIQSIRFKK----PVEKPFIISSMTAGHSNAL---EINYRLMEACSKTKWAMGVGSQ
IDI2_LEGPC      KDISIQSIRLKK----KVEKPFIISSMTAGHSNAL---EINYRLMEACSKTKWAMGVGSQ
IDI2_LEGPL      KDISIQSIRFNK----PVEKPFIISSMTAGHSNAI---EINYRLMEACSKTKWAMGVGSQ
IDI2_BDEBA      KEVDISTSFFFSGESIPLSSPIFISSMTAGHEKGR---EINEALARLSDRRQILMGVGSQ
IDI2_BORBU      SEINIKEEIFGY----NISMPVFISSMTGGSKEGN---DFNKSLVRIANYLKIPIGLGSF
IDI2_BORAP      SEIDIKEEIFGY----NISMPVFISSMTGGGKEGN---DFNKSLVKIANYLKIPIGLGSF
IDI2_BORBP      SEISLKEEIFGY----NINMPVFISSMTGGGKQGN---DFNKSLVKIANYLKIPIGLGSF
IDI2_BACSU      EQVDISTKIG-ELS---SSSPIFINAMTGG--GGKLTYEINKSLARAASQAGIPLAVGSQ
IDI2_BACVZ      EKVDISTKIG-GLT---SSSPIFINAMTGG--GGQLTYEINRSLARAARKAGMPLAVGSQ
IDI2_BACLD      SQVDTSTKIG-ELF---LSSPIFINAMTGG--GGKATFEINRALARAAAQTGIPVAVGSQ
IDI2_BACP2      SQIDTHTTIG-GLT---FGSPIFINAMTGG--GGKSTYEINRSLSIAAKETNIPVAVGSQ
IDI2_BACAN      ETITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACAC      ETITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACAA      ETITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACC0      ETITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACC3      ETITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACAH      ETITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACHK      ETITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACCZ      ETITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACC7      DTITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACCQ      DTITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACC1      DTITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACCR      DTITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACC4      DTITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACC2      DTITCETKIG-ELS---LSSPIFINAMTGG--GGEKTLHINEQLAYVAKQHNLAMAVGSQ
IDI2_BACMK      DTITCETKIG-ELS---LSSPIFINAMTGG--GGEQTLHINEQLAYVAKHHNLAMAVGSQ
IDI2_BACCN      ESVTCETKIG-ELS---LSSPIFINAMTGG--GGERTLHINEQLAYVAKHHHLAMAVGSQ
IDI2_GEOSW      NDIHLHTALG-ELS---LSSPFFINAMTGG--GGKQTFEINKGLAEAAKHCRIAMAVGSQ
IDI2_MOOTA      SDIDLTCRWL-GKT---LAAPFIINALTGG--PPE-TLAINAALARVARRTGIALAVGSQ
IDI2_SYMTH      AEIDLTTSVA-GVR---LAQPVVINAMTGG--ADD-VTAINRDLAAVAADLGLAMAVGSQ
IDI2_STRMU      AEIDLSTHFA-GQD---FDFPFYINAMTG---GSQKGKEVNEKLAQVADTCGLLFVTGSY
IDI2_STRGC      AEIDLSTHFA-GRD---WEFPFYINAMTG---GSQKGSQINEKLAQVAESCGLLFVTGSY
IDI2_STRPN      DEIDLSTEFA-GRK---WDFPFYINAMTG---GSNKGREINQKLAQVAESCGILFVTGSY
IDI2_STRPS      DEIDLSTEFA-GRK---WDFPFYINAMTG---GSNKGREINQKLAQVAESCGILFVTGSY
IDI2_STRPJ      DEIDLSTEFA-GRK---WDFPFYINAMTG---GSNKGREINQKLAQVAESCGILFVTGSY
IDI2_STRP2      DEIDLSTEFA-GRK---WDFPFYINAMTG---GSNKGREINQKLAQVAETCGILFVTGSY
IDI2_STRR6      DEIDLSTEFA-GRK---WDFPFYINAMTG---GSNKGREINQKLAQVAETCGILFVTGSY
IDI2_STRP7      DEIDLSTEFA-GRK---WDFPFYINAMTG---GSNKGREINQKLAQVAESCGILFVTGSY
IDI2_STRP1      SDIDLSTHFA-GQD---FDFPFYINAMTG---GSQKGKAVNEKLAKVAAATGIVMVTGSY
IDI2_STRPQ      SDIDLSTHFA-GQD---FDFPFYINAMTG---GSQKGKAVNEKLAKVAAATGIVMVTGSY
IDI2_STRPM      SDIDLSTHFA-GQD---FDFPFYINAMTG---GSQKGKAVNEKLAKVAAATGIVMVTGSY
IDI2_STRP6      SDIDLSTHFA-GQD---FDFPFYINAMTG---GSQKGKAVNEKLAKVAAATGIVMVTGSY
IDI2_STRP3      SDIDLSTHFA-GQD---FDFPFYINAMTG---GSQKGKAVNEKLAKVAAATGIVMVTGSY
IDI2_STRP8      SDIDLSTHFA-GQD---FDFPFYINAMTG---GSQKGKAVNEKLAKVAAATGIVMVTGSY
IDI2_STAA3      NDIDLTSQTP-DLT---MAYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAAC      NDIDLTSQTP-DLT---MAYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAA8      NDIDLTSQTP-DLT---MAYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAAE      NDIDLTSQTP-DLT---MAYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAAT      NDIDLTSQTP-DLT---MAYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAAB      NDIDLTSQTP-DLT---MAYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAAR      NDIDLTSQTP-DLT---MTYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAAU      NDIDLTSQTP-DLT---MTYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAAS      NDIDLTSQTP-DLT---MAYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAAW      NDIDLTSQTP-DLT---MAYPVYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAA9      NDIDLTSQTP-DLT---MAYPIYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAA2      NDIDLTSQTP-DLT---MAYPIYINAMTG---GSEWTKNINEKLAVVARETGLAMAVGST
IDI2_STAA1      NDIDLTSQTP-DLT---MAYPIYINAMTG---GSEWTKNINEKLAVVARETRLAMAVGST
IDI2_STAAM      NDIDLTSQTP-DLT---MAYPIYINAMTG---GSEWTKNINEKLAVVARETRLAMAVGST
IDI2_STAAN      NDIDLTSQTP-DLT---MAYPIYINAMTG---GSEWTKNINEKLAVVARETRLAMAVGST
IDI2_STAHJ      DEVDLTSRTT-DFD---MTYPIYINAMTG---GSEWTKQINEKLAVVARETGLAMAVGST
IDI2_STAEQ      SQVDMTSHTT-KFD---LAYPIYINAMTG---GSDWTKQINEKLAIVARETGIAMAVGST
IDI2_STAES      SQVDMTSHTT-KFD---LAYPIYINAMTG---GSDWTKQINEKLAIVARETGIAMAVGST
IDI2_STAS1      DDIDLTSQLK-DFT---LDQPLYINAMTG---GSEWTKQINEKLAVIARETGIAMAVGST
IDI2_ENTFA      NEVDISTSFL-SFQ---LPQPFYVNAMTG---GSQRAKEINQQLGIIAKETGLLVATGSV
IDI2_LISMF      KDIDLTTTIV-GTN---VPFPLYINAMTG---GSRHTKKINAELAEIAREVAIPMAVGSQ
IDI2_LISMC      KDIDLTTTIV-GTN---VPFPLYINAMTG---GSRHTKKINAELAEIAREAAIPMAVGSQ
IDI2_LISMH      KDIDLTTTIV-GTN---VPFPFYINAMTG---GSRHTKKINAELAEIAREVAIPMAVGSQ
IDI2_LISMO      KDIDLTTTIF-GKN---VPFPFYINAMTG---GSRHTKKINAELAEIAREVAIPMAVGSQ
IDI2_LISIN      KDIDLTTTFL-GAT---VPFPFYINAMTG---GSRHTKRINAELAEIAREVAIPMAVGSQ
IDI2_LISW6      KDIDLTTTIF-GVN---VSLPFYINAMTG---GSRHTKKINADLAEIAREVAIPMAVGSQ
IDI2_KITGR      PDVRLATTFA-GIT---WRLPLYINAMTG---GSAKTGAINRDLAVAARETGAAIASGSM
IDI2_STRC1      PDVSLATSFA-GIS---WQVPIYINAMTG---GSEKTGLINRDLATAARETGVPIASGSM
IDI2_NOCFA      ADVDLGVDIA-GKR---WHTPLFINAMTG---GSAAATDINRGLAIAARETGLPVASGSL
IDI2_LACRJ      DDVDLHVQLADNLE---IECPFYIEAMTG---GSDQALKINRQLAQLAHKHHLAMATGSL
IDI2_LACRD      DDVDLHVQLADNLE---IECPFYIEAMTG---GSDQALKINRQLAQLAHKHHLAMATGSL
IDI2_LACP3      AAVDLKPDL--PFN---WQWPIYINAMTG---GSPQTGKLNAQLGQLAQALGVAIASGSQ
IDI2_LACCB      AAVDLKPDL--PFN---WQWPIYINAMTG---GSPQTGKLNAQLGQLAQALGVAIASGSQ
IDI2_LACPL      ADVDLATTVG-QWH---WDSPLYIEAMTG---GSQRTGEINARLGRIAAACGLPIATGSQ
IDI2_LACSS      ADVDISTQFA-GTT---WQSPFYINGMTG---GSQQTKKLNAQLAQVAQIAGLPMATGSQ
IDI2_LACBA      TDVDFSTQLG-PLS---LKVPLMIEAMTG---GSPRTGVVNAQLGRIAAATGMAVASGSQ
IDI2_LACLA      KKINFSSEVF-GQN---FEFPFYIEAMTG---GTERADKINAQLAEIAKNQHLAMAVGSQ
                  :                 *  : .:*.           *  :          .  ** 

IDI2_MYCGI      RVMIDDAV---AAESFDVRGVAPDVLVIGNIGLAQLQPSM----VPALAA-ALDRVGANG
IDI2_MYCVP      RVMIDDEA---AAASFEVRGVAPDILLIGNIGLAQLRSSM----VPGLAA-ALDRVGANG
IDI2_MYCUA      RIMLDDARGQRAASSFAVREVAPDVLLIGNIGLAQLTKAA----VPAVAA-ALRRVGANA
IDI2_MYCMM      RIMLDDARGQRAASSFAVREVAPDVLLIGNIGLAQLTKAA----VPAVAA-ALRRVGANA
IDI2_DEIRA      RVMLEHPD---AWESFNVREVAPEILLIGNLGAAQFMLGY----GAEQARRAVDEVMADA
IDI2_THET2      RILLERPE---ALRSFRVRKVAPKALLIANLGLAQLRRYG----RDDLLR-LVEALEADA
IDI2_TRIV2      RVALEKP---QVADTFAIRKYAPDVLLFANVGAVQLNYKY----GLDECLRIIDMLEADA
IDI2_NOSS1      RVAVEKP---QVADTFAIRKYAPDVLLFANVGAVQLNYKY----GLDECLRIIDMLEADA
IDI2_THEEB      RVLLEHP---EVATTFAIRREAPTIPLLANLGAVQLNYGC----GVSECQKIVDLLEANA
IDI2_SYNP6      RVMLRQP---ETTPTFDVRDLAPDILLLANLGAVQLNYGV----TPAEAQQLVDRLGADA
IDI2_SYNY3      RAAIENP---DLAFTYQVRSVAPDILLFANLGLVQLNYGY----GLEQAQRAVDMIEADA
IDI2_RICBR      RTLLTEP---STLDTFTVRNNAPDIVLLANIGAVQLNYGV----TPKQCQYLVDSVKADA
IDI2_RICB8      RTLLTEP---STLDTFTVRNNAPDIVLLANIGAVQLNYGV----TPKQCQYLVDSVKADA
IDI2_RICCN      RVLLTEP---DTIKTFAVRHIAPDIPLLANIGAVQLNYGV----TPKECQYLVDAIKADA
IDI2_RICAE      RVLLTEP---DTIKTFAVRHIAPDIPLLANIGAVQLNYGV----TPKECQYLVDAIKADA
IDI2_RICPU      RVLLTEP---DTIKTFAVRHIAPDIPLLANIGAVQLNYGV----TPKECQYLVDAIKADA
IDI2_RICRO      RVLLTEP---DTIKTFAVRHIAPDIPLLANIGAVQLNYGV----TPKECQYLVDAIKADA
IDI2_RICRS      RVLLTEP---DTIKTFAVRHIAPDIPLLANIGAVQLNYGV----TPKECQYLVDAIKADA
IDI2_RICFE      RVLLTKP---DTITTFAVRDVAPDIPLLANIGAVQLNYFV----TPKECQYLVDVVKADA
IDI2_RICAH      RVLLTKP---DTITTFAIRHIAPDIPLLANIGAVQLNYGV----TPKECQYLVDVVKADA
IDI2_RICCK      RVLLAAA---DTIKTFAVRHIAPDILLLANIGAVQLNYGV----TPKECQYLVDATKADA
IDI2_RICPR      RILLTKP---DTIKTFTVRHVAPDIPLLANIGAVQLNYGV----TPKECQYLIDTIKADA
IDI2_RICTY      RILLTKP---DTIKTFTVRHVAPDIPLLANIGAVQLNYGV----TPKECQYLIDTIKADA
IDI2_OCEIH      RAFLESD---QHKESFLIRNQAPTAPLIVNIGAVQLNYGY----GPEECQRIIDKTNADS
IDI2_CROS8      RVALESED--NWGLTGELRRYAPDIPLLANLGAAQIGSLQ----GLDYARRAVEMVEADA
IDI2_PSEVU      RVAIESDA--GLGLDKTLRQLAPDVPLLANLGAAQLTGRK----GIDYARRAVEMIEADA
IDI2_PSEU5      RVALETAG--DQGLTGQLRQLAPDILLLANFGAAQLVRGY----GVDEARRAVEMIEGDA
IDI2_RHILO      RVSLQSRN--SQGLTRALRRMAPDIPLLANIGAAQLREAD----GLDLACRAVDALEADG
IDI2_XANP2      RIAIEDGS--AGGLGADLRRRAPDIALFANLGAAQLLAAR----GLDAARRAVEMIGADV
IDI2_VIBCB      RVSLEDSL--HSGLGKTIRDLAKGVPLYSNLGAAQLMDKQ----RFDNAQRAVDFIQADA
IDI2_VIBPA      RISLEESQ--HSGLGKTIRELAKGVPLYSNLGAAQLRDKG----KLDNAQRAVEAIQADA
IDI2_PARZE      RVMFTDP---SARASFDLRAHAPTVPLLANIGAVQLNMGL----GLKECLAAIEVLQADG
IDI2_HYDCU      RTMILDR---KAEKSFQLRQFAPTVPLIANMGAIQLNYGF----GYDEAQRMVEVLEADA
IDI2_CHLCH      RQTLESPL--HRESFAVTRKYAPTTLLFANIGAPEVAQGL----SQSDVAMMLDLLRADG
IDI2_PELPB      RQALENRS--YRESFAVVRKYAPTVQIFANIGAPEVAKGL----TESEINTMLELLRADG
IDI2_CHLPD      RQALENNE--HRESFAVVRKAAPSVPVFANIGAPEVAAGL----ESSQIETMLDLIQADG
IDI2_CHLL2      RQALENST--QKESFAIVRKYAPSVPVFANIGAPEVARGL----SASDIGILLELIEADA
IDI2_CHLP8      RQALEGNS--HRESFSIVRSSAPSVPIFANIGAPEVAAGL----SREQLSTLVELIEADG
IDI2_CHLTE      RQALEGSS--HRESFSVVRSSAPSVPIFANIGAPEVAAGL----SRDQLSTLIDLIEANG
IDI2_CHLPM      RQALEESS--HRDSFAVVRRHAPTTQIFANIGAPEIAKGL----SSDDLQTMIEMIRADG
IDI2_PELLD      RQALEDDA--YRDSFSVVRRHAPTIQIFANIGAPEVAKGL----SDKDLHIMLEMIRADG
IDI2_SULIM      RVAIEKAE--ARESFAIVRKVAPTIPIIANLGMPQLVKGY----GLKEFQDAIQMIEADA
IDI2_SULIK      RVAIEKAE--ARESFAIVRKVAPTIPIIANLGMPQLVKGY----GLKEFQDAIQMIEADA
IDI2_SULIY      RVAIEKAE--ARESFAIVRKVAPTIPIIANLGMPQLVKGY----GLKEFQDAIQMIEADA
IDI2_SULIN      RVAIEKAE--ARESFAIVRKVAPTIPIIANLGMPQLVKGY----GLKEFQDAIQMIEADA
IDI2_SULIL      RVAIEKAE--ARESFAIVRKVAPTIPIIANLGMPQLVKGY----GLKEFQDAIQMIEADA
IDI2_SULIA      RVAIEKAE--ARESFAIVRKVAPTIPIIANLGMPQLVKGY----GLKEFQDAIQMIEADA
IDI2_SACSH      RVAIEKAE--ARESFAIVRKVAPTIPIIANLGMPQLVKGY----GLKEFQDAIQMIEADA
IDI2_SACS2      RVAIEKAE--ARESFTIVRKVAPTIPIIANLGMPQLVKGY----GLKEFQDAIQMIEADA
IDI2_SULTO      RIAIEKKE--TKETFSIVRKKAPNSPIIANLGAPQFVKGY----SLEQVEEAIQMIEADA
IDI2_METS5      RVAVERPE--TAESFKVTRRMAPTAPLVANLGLPQVTRGY----GVKQFMDAIQMIEANA
IDI2_IGNH4      RAAVERPE--LEWTFRIARERAPNALLIANLGAPQLLKGY----GLEEIKKAIDMIDADA
IDI2_AERPE      RAAIEDPS--LARTFRAAREAAPNAFLIANLGAPQLSLGY----SVREVRMAVEMIDADA
IDI2_METKA      RAGVKDPE--VRWTFEVVREEYPDGLVLANIGLPQLREN-----GPDLALEVVDMVDADA
IDI2_PYRAR      RIALVKPE--VRWTFEVVKQNAPSIPKIANLGAPQLAQLSE-KQLVDWVVQAVDMIDAYA
IDI2_PYRAE      RIALVKPE--VKWTFEVVKQNAPHVPKVANLGAPQLAELGE-RELEEWVVQAIDMIDAYA
IDI2_PYRIL      RVALMKPE--VRWTFEVVKKNAPSVPKVANLGAPQLAELSD-EKLAEWVSQAVDMIDAYA
IDI2_PYRNV      RIALVKPE--VRWTFEVVKKNAPTVPKVANLGAPQLVELDE-VKLAEWVSQAVDMVDAHA
IDI2_METMA      RAAIDDPS--QEDSFRVVRDEAPDAFVYGNVGAAQIR-----QYGVEGVEKLIEMIDADA
IDI2_METAC      RAAIDDPA--QEDSFRVVRDKAPNAFVYGNVGAAQIR-----QYGVEGVEKLIEMIDADA
IDI2_METBF      RAAIDDPT--QEESFRVVREKAPTAFIYGNVGAAQIR-----QYGVDGVEKLIEMIDADA
IDI2_METBU      RAAIEDPE--QESSFSVVRDKAPNAFVYGNVGAAQIK-----EYGIEAIEKLVDMLDADA
IDI2_ARCFU      RAAIEDES--LADSFTVVREKAPNAFVYANIGMPQVI-----ERGVEIVDRAVEMIDADA
IDI2_NATPD      RAGLELDDEGVLESYTVVREAAPDAFLYGNLGAAQLK-----EYDLETVERAVEMIDADA
IDI2_HALSA      RAGLELDDERVLESYTVVRDAAPDAFIYGNLGAAQLR-----EYDIEMVEQAVEMIDADA
IDI2_METTP      RAALEHPD--LEDTFSVVRELAPDVPVIGNIGAVQLH-----RYGPEVLDRVAEMVDADA
IDI2_METB6      RAALENPA--LADTFSVVRDEAPHAFLVANLGAVQLR-----EHGAAWAGQAIEMIGANA
IDI2_METMP      RAAISKSY--LEDTYSVVRDHT-SSLIIGNLGAVNFV---EDSWDEEIISKSVEMIDADA
IDI2_META3      RAALINEE--LMETYSVVRDYT-SSLVLGNLGAVNFI---EDGWDEETIHKAVEMIDADG
IDI2_METJA      RAAIVNDE--LIDTYSIVRDYT-NNLVIGNLGAVNFI---VDDWDEEIIDKAIEMIDADA
IDI2_THEVO      RAAIVNRS--LSDTYSVINERN-VPIKIANIGAPQLVPQGKEAIDEKDIAYIYDLIKADF
IDI2_THEAC      RAAIVDRS--IEDTYSVINESH-VPLKIANIGAPQLVRQDKDAVSNRDIAYIYDLIKADF
IDI2_PICTO      RVAVKNKN--TADTFSVINDYK-IPAKFANIGAPQLVRQDSDSLSDNDIEYIYNLINADF
IDI2_THEKO      RAMIRKPE--TWESYYV-RDVAPDVFLVGNLGAPQFSETIRERYGLEEALKAVETIQADA
IDI2_THEON      RAMIRKPE--TWESYYV-RDVAPDVFLVGNLGAPQFAETMPDRYGIEEALKAVETIQADA
IDI2_THESM      RAMIRKPE--TWESYYV-RDVAPDIFLVGNLGAPQFAENMPNRYGVEEALKAVETIQADA
IDI2_PYRHO      RAMIEKPE--TWESYYV-RDVAPDIFLIGNLGAPQFGKNAKKRYSVKEVLYAIEKIEADA
IDI2_PYRAB      RAMIEKPE--TWESYYV-RDVAPDVFLVGNLGAPQFGRNAKKRYSVDEVLYAIEKIEADA
IDI2_PYRFU      RAMIEKPE--TWESYYV-RDVAPNVFLVGNLGAPQFGRNAKRKYGVKEVLYAIEKIDADA
IDI2_METTH      RAGVEHPE--LEGTYTIAREEAPSAMLIGNIGSSH----------IEYAERAVEMIDADA
IDI2_LEGPA      RRELSDKQ--AAFEWAPLRRDFPMVSLFSNLGIAQLIDTP-----ISAIQRLIDTLQAEA
IDI2_LEGPH      RRELTDKQ--AAFEWTPLRRDFPMVSLFSNLGIAQLIDTP-----ISAIQRLIDTLQAEA
IDI2_LEGPC      RRELTDKQ--AAFEWAPLRRDFPMVSLFSNLGIAQLIDTP-----ISAIQRLIDTLQAEA
IDI2_LEGPL      RRELTDKQ--AAFEWEPLRRDFPMVSLFSNLGIAQLIDTP-----ISAIQRLIDTLHAEA
IDI2_BDEBA      RRELEDSN--AAEEWARVRKQAPKARLLGNIGIAQLIKSP-----IDKIRRLIDSTEAVA
IDI2_BORBU      KLLFKYPE--YIRDFT-LKRYAHNIPLFANVGAVQIVEFG-----ISKIAEMIKRLEVDA
IDI2_BORAP      KLLFKYPE--YIRDFA-LKRYAHSIPLFANIGAVQIVEFG-----ISRIVEMIKRLEVDA
IDI2_BORBP      KLLFKYPE--YIRDFS-LKRYAYDIPLFANIGAVQIVEFG-----ISRIAEMIKRLEVDA
IDI2_BACSU      MSALKDPS--ERLSYEIVRKENPNGLIFANLGSEATA---------AQAKEAVEMIGANA
IDI2_BACVZ      MSALKDPS--ERCSYEIVRKENPDGLIFANLGSEADA---------EQAKMAVDMIQADA
IDI2_BACLD      MSALKDPD--ERPSYEIVRKENMKGLVFANLGSEATV---------EQAKRAVDMIEADM
IDI2_BACP2      MAALKDKE--ERRTYEVVRKVNPNGIVFANLGSEATI---------KQAKEAVEMLEANM
IDI2_BACAN      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATV---------EQAERAVDMVGANA
IDI2_BACAC      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATV---------EQAERAVDMVGANA
IDI2_BACAA      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATV---------EQAERAVDMVGANA
IDI2_BACC0      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATV---------EQAERAVDMVGANA
IDI2_BACC3      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATV---------EQAELAVDMIEANA
IDI2_BACAH      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATV---------EQAELAVDMIEANA
IDI2_BACHK      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATV---------EQAERAVDMVEANA
IDI2_BACCZ      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATI---------EQAERAVDMIEANA
IDI2_BACC7      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATV---------EQAERAVDMVEANA
IDI2_BACCQ      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATV---------EQAERAVDMVEANA
IDI2_BACC1      MAALKDES--EAASYKIIRKVNPNGIFFANLGSEATI---------EQAERAVDMIEANA
IDI2_BACCR      MAALKDES--EAASYKVIRKVNPNGIFFANLGSEATI---------EQAERAVDMIEANA
IDI2_BACC4      MAALKDES--EAASYKVIRKVNPNGIFFANLGSEATI---------EQAERAVDMIEANA
IDI2_BACC2      MAALKDES--EAASYKVIRKVNPNGIFFANLGSEATI---------EQAERAVDMIEANA
IDI2_BACMK      MAALKDES--ESASYKVVRKVNPNGIFFANLGSEATV---------EQAERAVDMIEANA
IDI2_BACCN      MAALKEKR--EVDSYRIVRRVNPNGIVFANLGSEATV---------EQAKCAVDMIEANA
IDI2_GEOSW      TSALRDNK--QRGTFEIVRKVNKNGIIFANIGSEATV---------DDAKRAVDMIEADG
IDI2_MOOTA      RAGLENKE--WRESFTIVRRENANGLILANIGAGNSP---------ADAGEAVAMIAADG
IDI2_SYMTH      TAGLRDPA--VADSYRVVRRVNPKGIVLANVGSDATP---------EQARAAVEMVEADL
IDI2_STRMU      STALKNP----DDTSYQVKKSRPHLLLATNIGLDKPY---------QAGLQAVRDLQPLF
IDI2_STRGC      SAALKNP----SDTSYQVATGRPNLLLATNIGLDKPY---------QAAQQAVADLQPLF
IDI2_STRPN      SAALKNP----TDDSFSVKSSHPNLLLGTNIGLDKPV---------ELGLQTVEEMNPVL
IDI2_STRPS      SAALKNP----TDDSFSVKSSHPNLLLGTNIGLDKPV---------ELGLQTVEEMNPVL
IDI2_STRPJ      SAALKNP----TDDSFSVKSSHPNLLLGTNIGLDKPV---------ELGLQTVEEMNPVL
IDI2_STRP2      SAALKNP----TDDSFSVKSSHPNLLLGTNIGLDKPV---------ELGLQTVEEMNPVL
IDI2_STRR6      SAALKNP----TDDSFSVKSSHPNLLLGTNIGLDKPV---------ELGLQTVEEMNPVL
IDI2_STRP7      SAALKNP----TDDSFSVKSSHPNLLLGTNIGLDKPV---------ELGLQTVEEMNPVL
IDI2_STRP1      SAALKNP----NDDSYRLHEVADNLKLATNIGLDKPV---------ALGQQTVQEMQPLF
IDI2_STRPQ      SAALKNP----NDDSYRLHEVADNLKLATNIGLDKPV---------ALGQQTVQEMQPLF
IDI2_STRPM      SAALKNP----NDDSYRLHEVADNLKLATNIGLDKPV---------ALGQQTVQEMQPLF
IDI2_STRP6      SAALKNP----NDDSYRLHEVADNLKLATNIGLDKPV---------ALGQQTVQEMQPLF
IDI2_STRP3      SAALKNP----NDDSYRLHEVADNLKLATNIGLDKPV---------ALGQQTVQEMQPLF
IDI2_STRP8      SAALKNP----NDDSYRLHEVADNLKLATNIGLDKPV---------ALGQQTVQEMQPLF
IDI2_STAA3      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAC      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAA8      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAE      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAT      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAB      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAR      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAU      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAS      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAW      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAA9      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAA2      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAA1      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAM      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAAN      HAALRNPR--MAETFTIARKMNPEGMIFSNVGADVPV---------EKALEAVELLEAQA
IDI2_STAHJ      HAALRNPK--MAESFSIARQTNPEGIIFSNVGADVPV---------DKAVEAVSLLDAQA
IDI2_STAEQ      HAALRNPN--MIETFSIVRKTNPKGTIFSNVGADVPV---------DKALQAVELLDAQA
IDI2_STAES      HAALRNPN--MIETFSIVRKTNPKGTIFSNVGADVPV---------DKALQAVELLDAQA
IDI2_STAS1      HAALRNSK--MASSFSIVRDTNPNGIIFSNVGADVPV---------DKAVESVKLLDAQA
IDI2_ENTFA      SAALKDAS--LADTYQIMRKENPDGLIFANIGAGLGV---------EEAKRALDLFQANA
IDI2_LISMF      SAALKNSS--LIDTYKIVREINPNGMILANISPEVAL---------QEGLRAIEMLEANA
IDI2_LISMC      SAALKNSS--LIDTYKIVREINPNGMILANISPEVAL---------QEGLRAIEMLEANA
IDI2_LISMH      SAALKNSS--LIDTYKIVREINPNGMILANISPEVAL---------QEGLRAIEMLEADA
IDI2_LISMO      SAALKNSS--LIDTYNIVREINPNGMILANVSPEVAI---------QDGLQAIEMLEANA
IDI2_LISIN      SAALKNSS--LIDTYQVVREVNPKGIILANVSPEVDI---------QDGIRAIEMLEADA
IDI2_LISW6      SAALKNSS--LMDTYQIVREVNPSGIIMANVSPEVAV---------QDGLRAIEMLEANA
IDI2_KITGR      HAFFRDPS--CADTFRVLRTENPDGFVMANVNATASV---------DNARRAVDLIEANA
IDI2_STRC1      NAYIKDPS--CADTFRVLRDENPNGFVIANINATTTV---------DNAQRAIDLIEANA
IDI2_NOCFA      SAYFRDPG--LAGSFRVLREENPHGVVIANVNATATL---------DQARRAVDLLAADA
IDI2_LACRJ      SIISKDPQ--SFSSFEIIREENPDGIIFANLSANASL---------DQAINAISLLKANA
IDI2_LACRD      SIISKDPQ--SFSSFEIIREENPDGIIFANLSANASL---------DQAINAISLLKANA
IDI2_LACP3      SVALRDPQ--LVPTFATLRDHDPNGFILANVGAGHHA---------TAAEAAVAMLKANA
IDI2_LACCB      SVALRDPQ--LVPTFATLRDHDPNGFILANVGAGHHA---------TAAEAAVAMLKANA
IDI2_LACPL      SVAIKDPQ--VAPTFATMRDHNPNGLIFGNLGAGHPL---------SAAQTAIAMLQADA
IDI2_LACSS      SVAIKDPT--LVDTFSVIREFNPAGFILANIGAGNDL---------SVAQKAVAMTQANA
IDI2_LACBA      SIALKDEQ--AIPTFTSLRENNPDGLVFANIGAGHDV---------RAAKHAVQMLAANA
IDI2_LACLA      SIALKFPE--LAAGFSEVRKIHSSGFLFANIGAGHSL---------ENAKRAVDMIEANA
                                             *..                            

IDI2_MYCGI      LAVHTNPLQEAMQHNGD-TDFSGSMSRLREVVDSLGYP----------VMLKEVGHGIGA
IDI2_MYCVP      LAVHTNPLQEAMQHDGD-TDFSGSIGRLCDVAGAIGYP----------VVLKEVGHGIGA
IDI2_MYCUA      LAVHANSLQEAMQHGGD-TDFSGSLGRLRDAADLLDYP----------VLLKEVGHGIGA
IDI2_MYCMM      LAVHANSLQEAMQHGGD-TDFSGSLGRLRDAADLLDYP----------VLLKEVGHGIGA
IDI2_DEIRA      LAIHLNPLQEALQRGGD-TRWQGVTYRLKQVARELDFP----------VIIKEVGHGLDA
IDI2_THET2      LAFHVNPLQEAVQR-GD-TDFRGLVERLAELL-PLPFP----------VMVKEVGHGLSR
IDI2_TRIV2      LILHINPLQECIQPKGD-VNFQGLLDKISELCEELSVP----------VIAKEVGNGISG
IDI2_NOSS1      LILHINPLQECIQPRGD-VNFRGLLDKINQLCSKLPVP----------AIAKEVGNGISG
IDI2_THEEB      LILHLNPLQEAVQTGGD-RNFKGLLTKIGVLCRALPVP----------VIVKEVGNGISA
IDI2_SYNP6      LILHLNPLQECIQAEGD-TDFRGLLGRIGELCAALSVP----------VIVKEVGNGLSA
IDI2_SYNY3      LILHLNPLQEAVQPDGD-RLWSGLWSKLEALVEALEVP----------VIVKEVGNGISG
IDI2_RICBR      LILHLNVLQELTQPEGD-KNWENLLPKIKEVVNYLSVP----------VIIKEVGFGLSK
IDI2_RICB8      LILHLNVLQELTQPEGD-KNWENLLPKIKEVVNYLSVP----------VIIKEVGFGLSK
IDI2_RICCN      LILHLNVLQELTQPEGN-RNWEKLLPKIREVVNYLSIP----------VIVKEVGYGLSK
IDI2_RICAE      LILHLNVLQELTQPEGN-RNWEKLLPKIREVVNYLSIP----------VIVKEVGYGLSK
IDI2_RICPU      LILHLNVLQELTQPEGN-RNWEKLLPKIREVVHYLSIP----------VIVKEVGYGLSK
IDI2_RICRO      LILHLNVLQELTQPEGN-RNWEKLLPKIREVVHYLSIP----------VIVKEVGYGLSK
IDI2_RICRS      LILHLNVLQELTQPEGN-RNWEKLLPKIREVVHYLSIP----------VIVKEVGYGLSK
IDI2_RICFE      LILHLNVLQELTQPEGN-RNWENLLPKIKELVNYLSVP----------VIVKEVGYGLSK
IDI2_RICAH      LILHLNVLQELTQPEGN-RNWENLLPRIQELVNYLSVP----------VVVKEVGYGLSK
IDI2_RICCK      LILHLNVLQELTQPEGN-RNWANLLPKIREVINYLSVP----------VIVKEVGYGLSK
IDI2_RICPR      LILHLNVLHELTQPEGN-KNWENLLPKIKEVINYLSVP----------VIVKEVGYGLSK
IDI2_RICTY      LILHLNVLHELTQPEGN-RNWENLLPKIKEVINYLSVP----------VIIKEVGYGLSK
IDI2_OCEIH      IVLHLNSLQEAVQDGGD-LNFKDLLPKIEQVCKQVKAP----------VGVKEVGFGIDG
IDI2_CROS8      LIIHLNPLQEALQTGGD-RDWRGVLAAIKRVVNALSVP----------VVVKEVGAGLSV
IDI2_PSEVU      LIVHLNPLQEALQPGGD-RDWRGRLAAIETLVRELPVP----------LVVKEVGAGISR
IDI2_PSEU5      LIVHLNPLQEAVQTGGD-RDWRGVLQAIEALAARLPVP----------VVIKEVGAGISA
IDI2_RHILO      LIVHLNALQEAVQPEGD-RDWRGVLAQIARAARSVDVP----------IVAKEVGSGLSA
IDI2_XANP2      LVIHLNPLQEAIQQGGD-RDWRGVFDRIGSLCVSLSAP----------VVVKEVGFGLSG
IDI2_VIBCB      LFVHLNPMQEAFQQNGD-HDWIGVLKSIEQLKQRVDVP----------MIIKEVGFGISG
IDI2_VIBPA      LFVHVNPMQEAFQKNGD-HNWIGVLHAIEQLKPRVNVP----------IIIKEVGFGISG
IDI2_PARZE      LYLHLNPLQEAVQPEGD-RDFADLGSKIAAIARDVPVP----------VLLKEVGCGLSA
IDI2_HYDCU      LYLHLNPLQEVIQPEGD-TNFAKLAEKIAHLKNHLSVP----------IILKEVGCGLSE
IDI2_CHLCH      LIVHLNAAQELFQPEGN-TNFHRVLEEIHNLCATTNVP----------IIVKEVGNGIGA
IDI2_PELPB      LIVHLNAAQELFQPEGN-TDFRHVLEQLALLSAKIPVP----------VLVKEVGCGISA
IDI2_CHLPD      LIVHLNAAQELFQPEGN-TNFHGFLDQLASLTAKTPVP----------VIAKEVGSGISA
IDI2_CHLL2      LIVHLNAAQELFQPEGN-TDFRHVLDQLSHLCATVPVP----------VIVKEVGCGISG
IDI2_CHLP8      LIVHLNPAQELFQPEGS-TNFRGFLDRLHDITATINVP----------VIAKEVGCGISA
IDI2_CHLTE      LIVHLNPAQELFQPEGG-TDFSGFLDRLHDITATIGVP----------VIAKEVGCGISA
IDI2_CHLPM      LIIHLNAAQELFQPEGG-TDFRRVLDEVAAITAKLSVP----------VIAKEVGCGISA
IDI2_PELLD      LIIHLNAAQELFQPEGG-TDFRRVLDNIADIAAKLPVP----------VIAKEVGCGISG
IDI2_SULIM      IAVHLNPAQEVFQPEGEPEYQIYALEKLRDISKELSV----------PIIVKESGNGISM
IDI2_SULIK      IAVHLNPAQEVFQPEGEPEYQIYALEKLRDISKELSV----------PIIVKESGNGISM
IDI2_SULIY      IAVHLNPAQEVFQPEGEPEYQIYALEKLRDISKELSV----------PIIVKESGNGISM
IDI2_SULIN      IAVHLNPAQEVFQPEGEPEYQIYALEKLRDISKELSV----------PIIVKESGNGISM
IDI2_SULIL      IAVHLNPAQEVFQPEGEPEYQIYALEKLRDISKELSV----------PIIVKESGNGISM
IDI2_SULIA      IAVHLNPAQEVFQPEGEPEYQIYALEKLRDISKELSV----------PIIVKESGNGISM
IDI2_SACSH      IAVHLNPAQEVFQPEGEPEYQIYALEKLRDISKELSV----------PIIVKESGNGISM
IDI2_SACS2      IAVHLNPAQEVFQPEGEPEYQIYALERLRDISKELSV----------PIIVKESGNGISM
IDI2_SULTO      IAIHFNSAQEVFQPEGEPNYSIEILYKLIDISKSLKV----------PIIIKESGSGLSM
IDI2_METS5      IAVHLNPAQELFQPEGEPEYPLSALEALRDISKELNV----------PVIVKESGTGMSM
IDI2_IGNH4      IAIHLNAAQESFQPEGDVDYK-GLLNKLSELVDKVEK----------PIIIKETGAGLDY
IDI2_AERPE      IAIHLNPGQEAYQPEGDPFYR-GVVGKIAEAAEAAGV----------PVIVKETGNGLSR
IDI2_METKA      LAVHVNVLQEAVQLEGEADAA-GFVDVLAEVCETVDV----------PVVLKETGAGVSA
IDI2_PYRAR      VAVHLNAAQEVVQPEGEPSFR-GVLEKLKIVKRAAGR----------PLIVKEVGNGISK
IDI2_PYRAE      IAIHLNAAQEVVQPEGEPRFK-GVLEKLKIVKRAAGK----------PLIVKETGNGISK
IDI2_PYRIL      IAIHLNAAQEVIQPEGEPRFR-GVFEKIKVVRKAAGR----------PVIVKEVGNGISK
IDI2_PYRNV      VAIHLNAAQEAVQPEGEPRFR-GVLEKIKVVKRAAGR----------PLIVKEVGNGISR
IDI2_METMA      LAIHLNFLQEAVQPEGD-RDATGCLDMITEICSQIKT----------PVIVKETGAGISR
IDI2_METAC      LAIHLNFLQEAIQPEGD-RDATGCLDMIAEICSMVRI----------PVIAKETGAGISR
IDI2_METBF      LAIHLNFLQEAIQPEGD-RDATGCLDMIKEICSVLGK----------PVIIKETGAGISR
IDI2_METBU      LAVHLNFLQEAIQPEGD-RDATGVLEMIKEVCS-LNV----------PIIAKETGAGISK
IDI2_ARCFU      VAIHLNYLQEAIQPEGD-LNAEKGLEVLEEVCRSVKV----------PVIAKETGAGISR
IDI2_NATPD      LAVHLNFLQEAVQPEGD-VDARGCLPAIERVVDGLSV----------PVVVKETGNGFAA
IDI2_HALSA      LAVHLNFLQEATQPEGD-VDGRNCVAAIERVSEALSV----------PIIVKETGNGISG
IDI2_METTP      VAVHLNFLQESVQPEGE-RHAAGVLGSLREA--RFRL----------PIIIKETGCGIPF
IDI2_METB6      IAIHLNFLQEAIQPEGD-LSATGCIAAIADLCAETKI----------PVIVKETGCGISR
IDI2_METMP      MAIHFNPLQEAIQPEGD-VNFKG-LNILKEIISNYNKIHG-----KIPFIAKQVGEGFSK
IDI2_META3      MAIHFNPLQEAIQPEGD-YNFKG-IEILKDIMENYNKTYNNKSNKKIPFIAKQVGEGFSK
IDI2_METJA      IAIHFNPLQEIIQPEGD-LNFKN-LYKLKEIISNYKKSYK-----NIPFIAKQVGEGFSK
IDI2_THEVO      LAVHFNFLQEMVQPEGD-RNAEGVIKRIKELSGSFN------------IIAKETGSGFSK
IDI2_THEAC      LAVHFNFLQEMVQPEGD-RNSKGVIDRIKDLSGSFN------------IIAKETGSGFSR
IDI2_PICTO      LIVHFNFLQEMVQPEGD-RNSKGVIKRLKDIAGSYN------------VIAKETGSGFSK
IDI2_THEKO      LAIHMNPLQESVQPEGD-TQYRGVLKALAELKAEFP----------YPIIAKETGAGVSM
IDI2_THEON      LAIHMNPLQESVQPEGD-TQYRGVLKALAELKAEFP----------YPIIAKETGAGVSM
IDI2_THESM      LAIHMNPLQESVQPEGD-TQYKGVITALAELKGELS----------YPIIAKETGAGVSM
IDI2_PYRHO      IAIHMNPLQESVQPEGD-TTYAGVLEALAEIKSSIN----------YPVIAKETGAGVSK
IDI2_PYRAB      IAIHMNPLQESIQPEGD-TTFSGVLEALAEITSTID----------YPVIAKETGAGVSK
IDI2_PYRFU      IAIHMNPLQESVQPEGD-TTFSGVLEALAEITSSID----------YPVIAKETGAGVSK
IDI2_METTH      LAVHLNPLQESIQPGGD-VDSSGALESISAIVESVD----------VPVMVKETGAGICS
IDI2_LEGPA      LIIHCNPLQECIQPEGT-TNFQGCWTALEALVKKIASP----------VIIKETGCGFSK
IDI2_LEGPH      LIIHCNPLQECIQPEGT-TNFQGCWTALEALVKKIASP----------VIIKETGCGFSK
IDI2_LEGPC      LIVHCNPLQECIQPEGT-TNFQGCWTALEALVKKIASP----------VIIKETGCGFSK
IDI2_LEGPL      LIIHCNPLQECIQPEGT-TNFHGCWAALEALVKKINSP----------VIVKETGCGFSK
IDI2_BDEBA      LFVHLNPLQEALQPEGT-TDFKNGLAAIENLVKLAGVP----------VIVKETGCGFSV
IDI2_BORBU      IIVHLNAGQELMKVDGD-RNFKGIRESIAKLSDFLSVP----------LIVKETGFGISP
IDI2_BORAP      IIVHLNAGQELMNVNGD-RNFKGIKESIAKLSNFISVP----------LIVKETGFGISP
IDI2_BORBP      IVTHLNAGQELMNVNGD-RNFKGIKESIAKLADFLSVP----------LIVKETGFGISP
IDI2_BACSU      LQIHLNVIQEIVMPEGD-RSFSGALKRIEQICSRVSVP----------VIVKEVGFGMSK
IDI2_BACVZ      LQIHLNVIQEIVMPEGD-RSFTGALGRIERIAAEAGVP----------VFVKEVGFGMSR
IDI2_BACLD      LQIHLNVIQEIVMPEGD-RNFTGRLRRIEDICRSVSVP----------VAVKEVGFGMSR
IDI2_BACP2      LQIHLNVIQEIVMPEGD-RDFRGALERIAAIAESVGVP----------VVVKEVGFGMSK
IDI2_BACAN      LQIHLNVIQELTMPEGD-RDFTGVLQRIEEIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACAC      LQIHLNVIQELTMPEGD-RDFTGVLQRIEEIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACAA      LQIHLNVIQELTMPEGD-RDFTGVLQRIEEIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACC0      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACC3      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACAH      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACHK      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACCZ      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACC7      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACCQ      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACC1      LQIHLNVIQELTMPEGD-RDFTGVLRRIEKIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACCR      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------IIVKEVGFGMSK
IDI2_BACC4      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------IIVKEVGFGMSK
IDI2_BACC2      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLNSKVP----------VIVKEVGFGMSK
IDI2_BACMK      LQIHLNVIQELTMPEGD-RDFTGVLQRIEKIVLKSKVP----------VIVKEVGFGMSK
IDI2_BACCN      LQIHLNVIQELTMPEGD-RDFKGVLKRIENIVLTSEVP----------VIVKEVGFGMSK
IDI2_GEOSW      LQIHLNVVQELVMPEGD-RDFTGVLLRIEQIVQAVQVP----------VIVKEVGFGMSK
IDI2_MOOTA      LQVHLNAAQELIMPEGD-RAFRGWLENIRGMVNTLGVP----------VIAKEVGFGLSR
IDI2_SYMTH      LQIHLNAPQELRMPEGD-RDFRGRLEAIARMVEEAPVP----------VVVKECGFGVSR
IDI2_STRMU      LQVHINLMQELLMPEGE-REFRSWKKHLSDYAKKLQLP----------FILKEVGFGMDV
IDI2_STRGC      LQIHVNLMQELLMPEGE-REFRSWRQHLTDYSQRLDLP----------LILKEVGFGMDR
IDI2_STRPN      LQVHVNVMQELLMPEGE-RKFRSWQSHLADYSKQIPVP----------IVLKEVGFGMDA
IDI2_STRPS      LQVHVNVMQELLMPEGE-RKFRSWQSHLADYSKQIPVP----------IVLKEVGFGMDA
IDI2_STRPJ      LQVHVNVMQELLMPEGE-RKFRSWQSHLADYSKQIPVP----------IVLKEVGFGMDA
IDI2_STRP2      LQVHVNVMQELLMPEGE-RKFRSWQSHLADYSKQIPVP----------IVLKEVGFGMDA
IDI2_STRR6      LQVHVNVMQELLMPEGE-RKFRSWQSHLADYSKQIPVP----------IVLKEVGFGMDA
IDI2_STRP7      LQVHVNVMQELLMPEGE-RKFRSWQSHLADYSKQIPVP----------IVLKEVGFGMDA
IDI2_STRP1      LQVHVNVMQELLMPEGE-RVFHTWKKHLAEYASQIPVP----------VILKEVGFGMDV
IDI2_STRPQ      LQVHVNVMQELLMPEGE-RVFHTWKKHLAEYASQIPVP----------VILKEVGFGMDV
IDI2_STRPM      LQVHVNVMQELLMPEGE-RVFHTWKKHLAEYASQIPVP----------VILKEVGFGMDV
IDI2_STRP6      LQVHVNVMQELLMPEGE-RVFHTWKKHLAEYASQIPVP----------VILKEVGFGMDV
IDI2_STRP3      LQVHVNVMQELLMPEGE-RVFHTWKKHLAEYASQIPVP----------VILKEVGFGMDV
IDI2_STRP8      LQVHVNVMQELLMPEGE-RVFHTWKKHLAEYASQIPVP----------VILKEVGFGMDV
IDI2_STAA3      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAC      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAA8      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAE      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAT      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAB      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAR      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAU      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAS      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAW      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAA9      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAA2      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAA1      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAM      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAAN      LQIHVNSPQELVMPEGN-REFVTWLDNIASIVSRVSVP----------VIIKEVGFGMSK
IDI2_STAHJ      LQIHVNAPQELVMPEGN-REFSTWLDNVAAIVQRVDVP----------VIIKEVGFGMSK
IDI2_STAEQ      LQIHVNSPQELVMPEGN-REFASWMSNIESIVKRVDVP----------VIIKEVGFGMSK
IDI2_STAES      LQIHVNSPQELVMPEGN-REFASWMSNIESIVKRVDVP----------VIIKEVGFGMSK
IDI2_STAS1      LQVHVNAPQELVMPEGN-RTFSTWMENLAQIVSRVDVP----------VIVKEVGFGMSK
IDI2_ENTFA      LQIHVNVPQELVMPEGD-RDFTNWLTKIEAIVQAVEVP----------VIVKEVGFGMSQ
IDI2_LISMF      LQIHINPAQELVMQEGD-RSFSHWLTRIEEYVKLSPVP----------VVVKEVGFGMTR
IDI2_LISMC      LQIHINPAQELVMQEGD-RSFSHWLTRIEEYVKLSPVP----------VVVKEVGFGMTR
IDI2_LISMH      LQIHINPAQELVMQEGD-RSFSHWLTRIEKYVKLSPVP----------VVVKEVGFGMTR
IDI2_LISMO      LQIHINPAQELVMQEGD-RSFSHWLTRIEEYVKLSPVP----------IVVKEVGFGMTR
IDI2_LISIN      LQIHINPAQELVMQEGD-RSFSHWLSRIEAYVKNSPVP----------VVVKEVGFGMTR
IDI2_LISW6      LQIHINPAQELVMQEGD-RSFSHWLARIEEYVKRSPVP----------IIVKEVGFGMTR
IDI2_KITGR      LQIHLNTAQETPMPEGD-RSFGSWPAQIAKITAAVDVP----------VIVKEVGNGLSR
IDI2_STRC1      LQIHINTAQETPMPEGD-RSFASWVPQIEKIAAAVDIP----------VIVKEVGNGLSR
IDI2_NOCFA      LQIHLNAVQEIVMPEGD-RSFRSWPRRIEHLAAGVPVP----------VIVKEVGFGLSR
IDI2_LACRJ      LELHINAAQELIMPEGD-RDF-NWLDNIQYLVSELEVP----------VIVKEVGFGMSK
IDI2_LACRD      LELHINAAQELIMPEGD-RDF-NWLDNIQYLVSELEVP----------VIVKEVGFGMSK
IDI2_LACP3      LEIHLNAAQEVVMPEGD-RDF-MWQANIKSIIATSQVP----------IVVKEVGNGFIR
IDI2_LACCB      LEIHLNAAQEVIMPEGD-RDF-MWQANIKSIIATSQVP----------IVVKEVGNGFIR
IDI2_LACPL      LELHLNVVQEIVMPEGD-RDF-HWLTNISDLVQALTVP----------VIVKEVGFGISR
IDI2_LACSS      LEIHVNTAQEVVMPEGD-REF-YWLDQIGEIVANLDVP----------VIVKEVGFGMSA
IDI2_LACBA      LEIHVNTAQELVMPEGD-RDF-HWLDHIGNIVAALDVP----------VIVKEVGFGMAQ
IDI2_LACLA      LEIHVNTAQELPMDEGD-REF-YWLENINEIASQLEVP----------VVVKEVGFGISQ
                :  * *  :*     *           :                       *: * *.  

IDI2_MYCGI      SAAAQLV----DCPVAAVDVAGAGGTSWARIEQFVRYG----------EVRYPALAEWGI
IDI2_MYCVP      AAAAELV----GCPIAAIDVAGAGGTSWARIEQFVRYG----------DVRYPALAEWGV
IDI2_MYCUA      AAVAQLLRLPGGLPVSGIDVAGAGGTSWSRVEQLVRYG----------ELRYPELADWGI
IDI2_MYCMM      AAVAQLLRLPGGLPVSGIDVAGAGGTSWSRVEQLVRYG----------ELRYPELADWGI
IDI2_DEIRA      ATLRALA----DGPFAAYDVAGAGGTSWARVEQLVAHG----------QVHSPDLCELGV
IDI2_THET2      EAALALR----DLPLAAVDVAGAGGTSWARVEEWVRFG----------EVRHPELCEIGI
IDI2_TRIV2      AMAKKLI----AAGVQVIDVAGAGGTSWAKVEGERAEN-------SMQRRLGRTFADWGI
IDI2_NOSS1      AMAEKLI----AAGVQAIDVAGAGGTSWAKVEGERAEN-------AMQRRLGRTFADWGM
IDI2_THEEB      EVAKQLV----DVGVAAIDVAGAGGTSWAKVEAARAQD-------ASQRYLGDAFAEWGI
IDI2_SYNP6      MVAAQLL----SAGVAALDVAGAGGTSWSRVEGQRAVD-------PLLRRLGDRFGDWGI
IDI2_SYNY3      PVAKRLQ----ECGVGAIDVAGAGGTSWSEVEAHRQTD-------RQAKEVAHNFADWGL
IDI2_RICBR      KTAKQFI----DIGVKILDVAGSGGTSWSQVEAYRATN-------SLQNRIASSFINWGI
IDI2_RICB8      KTAKQFI----DIGVKILDVAGSGGTSWSQVEAYRATN-------SLQNRIASSFINWGI
IDI2_RICCN      KVAESLI----DAGVKVLDIAGSGGTSWSQVEAYRATN-------SLQNRIASSFINWGI
IDI2_RICAE      KVAESLI----DAGVKVLDIAGSGGTSWSQVEAYRATN-------SLQNRIASSFINWGI
IDI2_RICPU      KVAESLI----EAGVKVLDIAGSGGTSWSQVEAYRATN-------SLQNRIASSFINWGI
IDI2_RICRO      KVAESLI----DAGVKVLDIAGSGGTSWSQVEAYRATN-------SLQNRIASSFINWGI
IDI2_RICRS      KVAESLI----DAGVKVLDIAGSGGTSWSQVEAYRATN-------SLQNRIASSFINWGI
IDI2_RICFE      KVAESLI----GVGVKVLDIAGSGGTSWSQVEAYRATN-------SLQNRIASSFINWGI
IDI2_RICAH      KVAESLI----KVGVEVLDIAGSGGTSWSQVEAYRATN-------SLQNRIASSFISWGI
IDI2_RICCK      QVAKSLI----DVGVKTLDIAGSGGTSWSQVEAYRAKN-------SLQNRIASSFINWGI
IDI2_RICPR      QVAKKLI----KAGVKVLDIAGSGGTSWSQVEAYRAKN-------SMQNRIASSFINWGI
IDI2_RICTY      QVAKKLI----KVGVKVLDIAGSGGTSWSQVEAYRAKN-------SMQNRIASSFINWGI
IDI2_OCEIH      EVARRLY----DAGISYIDVAGAGGTSWSQVEKLRSKD-------PLNKAAAEAFNNWGT
IDI2_CROS8      PVARQLA----EAGVTMLDVAGAGGTSWAAVEGERAAS-------DHARSVAMAFADWGI
IDI2_PSEVU      TVAGQLI----DAGVTVIDVAGAGGTSWAAVEGERAAT-------EQQRSVANVFADWGI
IDI2_PSEU5      AVARRLV----DAGVAAIDVAGAGGTSWAAVEAARAAD-------ASQQAIAEAFADWGI
IDI2_RHILO      SVACALV----KAGVAVIDVAGAGGTSWAAVEGERARD-------AADRAVAMAFADWGI
IDI2_XANP2      AVARRLA----DCGVAALDVAGAGGTNWALVEGERGTG-------RS-RAVATAFADWGI
IDI2_VIBCB      VVAKQLV----EAGVDAIDVAGAGGTSWSAVEGYCQTD-------NKMQRAAELFRDWGI
IDI2_VIBPA      DVAQRLV----DAGVDAIDVAGAGGTSWSAVEGYCQDN-------PHMQRAAELFRDWGI
IDI2_PARZE      ADIAIGL----RAGIRHFDVAGRGGTSWSRIEYRRRQ--------RADDDLGLVFQDWGL
IDI2_HYDCU      KDIQLGL----DAGIEWFDLAGRGGTSWSRIEAHRTED-------SQQAELGKMFQDWGL
IDI2_CHLCH      AVAEQLM----EAGVQALDVAGAGGISWQKVEEYRFLQQF-GHEHRFSSNALDELLNWGI
IDI2_PELPB      SAARQLI----AAGVKAIDVAGAGGISWQKVEEIRYTRQF-GQERRFSLQALDELLNWGI
IDI2_CHLPD      EAARLLI----DAGVKVIDVAGAGGTSWQKVEEVRYIKRF-GNENRFSPEALNELLNWGI
IDI2_CHLL2      VCAQRVL----DAGVKVIDVAGAGGISWQKVEEIRYVRQR-ERENRFSPEALDDLLNWGI
IDI2_CHLP8      PLASKLA----DAGVKAIDVAGAGGISWQKVEECRYLDRF-GNEERFSPSALDEFLNWGI
IDI2_CHLTE      TVARKLA----DAGVRAIDVAGAGGISWQKVEECRYLDRF-GHEERFSPSALDEFLNWGI
IDI2_CHLPM      PVARQLL----NAGVRVIDVAGAGGISWQKVEEARYTRRF-GTDDRFSTRGLEELLNWGT
IDI2_PELLD      AVARKLL----EAGVQVIDVAGAGGISWQKVEEARYTRRF-GSDTRFSQEGIEELLNWGI
IDI2_SULIM      ETAKLLYSYG----IKNFDTSGQGGTNWIAIEMIRDIR----RGN-WKAESAKNFLDWGV
IDI2_SULIK      ETAKLLYSYG----IKNFDTSGQGGTNWIAIEMIRDIR----RGN-WKAESAKNFLDWGV
IDI2_SULIY      ETAKLLYSYG----IKNFDTSGQGGTNWIAIEMIRDIR----RGN-WKAESAKNFLDWGV
IDI2_SULIN      ETAKLLYSYG----IKNFDTSGQGGTNWIAIEMIRDIR----RGN-WKAESAKNFLDWGV
IDI2_SULIL      ETAKLLYSYG----IKNFDTSGQGGTNWIAIEMIRDIR----RGN-WKAESAKNFLDWGV
IDI2_SULIA      ETAKLLYSYG----IKNFDTSGQGGTNWIAIEMIRDIR----RGN-WKAESAKNFLNWGV
IDI2_SACSH      ETAKLLYSYG----IKNFDTSGQGGTNWIAIEMIRDIR----RGN-WKAESAKNFLDWGV
IDI2_SACS2      ETAKLLYSYG----IKNFDTSGQGGTNWIAIEMIRDIR----RGN-WKAESAKNFLDWGV
IDI2_SULTO      EVTKMFYENG----IKYFDTSGTGGTSWVSVEMYRGLR----RNN-WKAESAKLFLDWGI
IDI2_METS5      ETAKLLADHG----FKILDVSGQGGTSWIAVEMVRNRR----KGN-WKYESSQLFSGWGI
IDI2_IGNH4      ESVKALRELG----IKAFDVSGSGGTSWVRVEMYRARE----KGDEVLATVADWMSSWGI
IDI2_AERPE      EAVAQLRALG----VRCFDVAGLGGTNWIKIEVLRGRK----AGS--PLEAGPLQDFWGN
IDI2_METKA      EDAKLVRDI-----VDGIDVGGAGGTNWAVVEAVRSKA----HGE---IPLGYAFSDWGV
IDI2_PYRAR      EVAAKLAEV-----ADAIDVGGLGGTSFVAIEGARAAD----A--WLQRRVAETFKYWGI
IDI2_PYRAE      EVAARLSGI-----ADAIDVGGFGGTSFVAIEGARAKE----S--PLQKRLAETYKWWGI
IDI2_PYRIL      EVASRLVEV-----ADAIDVGGYGGTSFIAIEGARAAE----SGSSMRRRVAEVFKSWGI
IDI2_PYRNV      EVAARLAGV-----ADAIDVGGYGGTSFIAIEGARAAG----AGAQLRRRIAETFKLWGI
IDI2_METMA      EDAILFQKAG----VSAIDVGGAGGTSWAGVEVYRAKE----SRDSVSERLGELFWDFGI
IDI2_METAC      EDALLLHKAG----VSAIDVGGVGGTSWAGVEVYRAKE----SKDPVSERLGELFWDFGI
IDI2_METBF      EDSILLQKAG----VSAIDVGGAGGTSWAGVEVYRARK----SGDYASEHLGELFWDFGI
IDI2_METBU      EDAALLKEAG----VSAIDVGGVGGTSWSGVEVYRAHD----SGDAISEDLGNLYWDFGI
IDI2_ARCFU      EVAVMLKRAG----VSAIDVGGKGGTTFSGVEVYRVN-------DEVSKSVGIDFWDWGL
IDI2_NATPD      ETARRLADAG----VDAIDVAGKGGTTWSGVEAYRAAA----VGASRQERVGELFREWGV
IDI2_HALSA      ETARELTAAG----VDALDVAGKGGTTWSGIEAYRAAA----ANAPRQKQIGTLFREWGI
IDI2_METTP      EDARMLVDSG----IQLIDVAGTGGTSWSMVESYRAEL----RGDPESKEIGMLFAEWGI
IDI2_METB6      EVARLCWSAG----AAAIDIGGWGGTSWAAVESFRADRKD--AQGRALKTLGEDFAGWGI
IDI2_METMP      KDAIFLKEIG----FDAIDVGGSGGTSWAAVELYRIK-------DEEQKNFSNQYFNWGI
IDI2_META3      EDALLLNGLG----FDSIDVGGSGGTSWAAVEYYRIK-------DEESKKFSKKYLEWGI
IDI2_METJA      EDALILKDIG----FDAIDVQGSGGTSWAKVEIYRVK-------EEEIKRLAEKFANWGI
IDI2_THEVO      ATAQRLADAG----VKAIEVSGLSGTTFAAVEYYRAKN----EGNAEKMRIGETFWNWGI
IDI2_THEAC      RTAERLIDAG----VKAIEVSGVSGTTFAAVEYYRARK----ENNLEKMRIGETFWNWGI
IDI2_PICTO      EDALSLLDAG----VKAIDVGGLGGTSFAAIEYYRAQK----ANDEIKMHTGKAFWNWGI
IDI2_THEKO      EVAVRLESIG----IDAIDVGGLGGTSWSGVEYYRAK-------DEIGKDLALRFWDWGI
IDI2_THEON      EVAIRLESIG----IDAIDVGGLGGTSWSGVEYYRAK-------DELGRNLALKFWDWGI
IDI2_THESM      EVAIKLESIG----IDAIDVGGLGGTSWSSVEYYRAK-------DEKSKNLALKFWDWGI
IDI2_PYRHO      EVAIELESVG----IDAIDISGLGGTSWSAVEYYRAK-------DSEKRKIALKFWDWGI
IDI2_PYRAB      EVAVELEAVG----VDAIDISGLGGTSWSAVEYYRTK-------DGEKRNLALKFWDWGI
IDI2_PYRFU      EVAIKLESIG----VSAIDISGVGGTSWSGVEYYRAK-------DELGKRLALRFWDWGI
IDI2_METTH      EDAIELESCG----VSAIDVAGAGGTSWAAVETYRAD-------D---RYLGELFWDWGI
IDI2_LEGPA      NTLLRLNNIG----VAAVDVSGVGGTHWGRIEGHRANKD------PIRHRTADTFRNWGI
IDI2_LEGPH      NTLLRLNNIG----VAAVEISGVGGTHWGRIEGHRANKD------PIRQRTADTFRNWGI
IDI2_LEGPC      NTLLRLNNIG----VAAVDVSGVGGTHWGRIEGHRANKD------PIRHRTADTFRNWGI
IDI2_LEGPL      NTLLRLNNIG----VAAVDVSGVGGTHWGRIEGHRADKD------PIRHRTADTFRNWGI
IDI2_BDEBA      DTLKRLSSTG----IYGVDVSGKGGTHWGRVEGYRSEES------DMLYHVAQTFANWGI
IDI2_BORBU      KDVKELFSLG----ASYVDLAGSGGTNWILVEGMKSNN----------LNIASCFSDWGI
IDI2_BORAP      SDVKKLFQLG----VSYIDLAGSGGTNWVLVEGMKGNN----------LNIASCFSDWGI
IDI2_BORBP      NDVKELLKLG----VSYIDLAGSGGTNWVLVEGIRSNN----------LNVASCFSDWGI
IDI2_BACSU      ASAGKLYEAG----AAAVDIGGYGGTNFSKIENLRRQRQ------------ISFFNSWGI
IDI2_BACVZ      ESARQLFDAG----AAAVDAGGYGGTNFSKIENMRREKA------------LQFFNTWGI
IDI2_BACLD      DTAARLFNVG----VQAIDVGGFGGTNFSKIENLRRDKA------------VEFFDQWGI
IDI2_BACP2      ETAKKLFHAG----VAAVDIGGFGGTNFSKIENLRRQKA------------LHYFDQWGI
IDI2_BACAN      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACAC      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACAA      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACC0      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACC3      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACAH      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACHK      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACCZ      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACC7      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACCQ      ETMQQLASVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACC1      ETMQQLASIG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACCR      ETMQQLVNVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACC4      ETMQQLVNVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACC2      ETMQQLANVG----VTAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACMK      ETVQQLANIG----ITAIDIGGQGGTNFAAVENERRQRM------------LSYFNNWGI
IDI2_BACCN      ETVQQLANIG----VTAIDIGGQGGTNFAAVENERRNRM------------LSYFNDWGI
IDI2_GEOSW      ETASRLEEVG----VKIIDVGGLGGTNFARIENKRRSNI------------ITYFNDWGI
IDI2_MOOTA      ETALQLYQAG----VRIMDVGGRGGTNFAAIEERRRGRS------------VAALAGWGL
IDI2_SYMTH      DVAVLLHQAG----VRAVDVSGRGGTNFAWIEDRRAGLSDP----------DPGLQNWGI
IDI2_STRMU      KTIQTAIDLG----VKTVDISGRGGTSFAYIENRRGGNR-------------SYLNQWGQ
IDI2_STRGC      STVEEARSLG----IQTFDISGRGGTSFAYIENQRGGNR-------------DYLNDWGQ
IDI2_STRPN      KTIERAYEFG----VRTVDLSGRGGTSFAYIENRRSGQR-------------DYLNQWGQ
IDI2_STRPS      KTIERAYEFG----VRTVDLSGRGGTSFAYIENRRSGQR-------------DYLNQWGQ
IDI2_STRPJ      KTIERAYEFG----VRTVDLSGRGGTSFAYIENRRSGQR-------------DYLNQWGQ
IDI2_STRP2      KTIERAYEFG----VRTVDLSGRGGTSFAYIENRRSGQR-------------DYLNQWGQ
IDI2_STRR6      KTIERAYEFG----VRTVDLSGRGGTSFAYIENRRSGQR-------------DYLNQWGQ
IDI2_STRP7      KTIERAYEFG----VRTVDLSGRGGTSFAYIENRRSGQR-------------DYLNQWGQ
IDI2_STRP1      NSIKLAHDLG----IQTFDISGRGGTSFAYIENQRGGDR-------------SYLNDWGQ
IDI2_STRPQ      NSIKLAHDLG----IQTFDISGRGGTSFAYIENQRGGDR-------------SYLNDWGQ
IDI2_STRPM      NSIKLAHDLG----IQTFDISGRGGTSFAYIENQRGGDR-------------SYLNDWGQ
IDI2_STRP6      NSIKLAHDLG----IQTFDISGRGGTSFAYIENQRGGDR-------------SYLNDWGQ
IDI2_STRP3      NSIKLAHDLG----IQTFDISGRGGTSFAYIENQRGGDR-------------SYLNDWGQ
IDI2_STRP8      NSIKLAHDLG----IQTFDISGRGGTSFAYIENQRGGDR-------------SYLNDWGQ
IDI2_STAA3      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAC      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAA8      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAE      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAT      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAB      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAR      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAU      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAS      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAW      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAA9      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAA2      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAA1      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAM      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAAN      ELMHDLQQIG----VKYVDVSGKGGTNFVDIENERRANKD-----------MDYLSSWGQ
IDI2_STAHJ      ELYKDLIDVG----VTYVDVSGKGGTNFVTIENERRSNKD-----------MDYLANWGQ
IDI2_STAEQ      ETLQALYDIG----VNYVDVSGRGGTNFVDIENERRSNKD-----------MNYLSQWGQ
IDI2_STAES      ETLQALYDIG----VNYVDVSGRGGTNFVDIENERRSNKD-----------MNYLSQWGQ
IDI2_STAS1      ETIKSLNEIG----VRYVDVSGRGGTNFVDIENERRTYKD-----------MDYLGLWGQ
IDI2_ENTFA      ETLEKLTSIG----VQAADVSGQGGTSFTQIENARRKKRE-----------LSFLDDWGQ
IDI2_LISMF      ETVKTLADIG----VQTVDLAGKGGTNFAQIENDRRRDQA-----------YDFLLDWGI
IDI2_LISMC      ETVKTLADIG----VQTVDLAGKGGTNFAQIENDRRRDQA-----------YDFLLDWGI
IDI2_LISMH      ETVATLASVG----VQSVDLAGKGGTNFAQIENDRRRDQA-----------YDFLLDWGI
IDI2_LISMO      ETVKTLADIG----VQTVDLAGKGGTNFAQIENDRRRDQA-----------YDFLLDWGI
IDI2_LISIN      ETVKTLAEIG----VTTVDLAGKGGTNFAQIENDRRRDQA-----------YNFLLDWGI
IDI2_LISW6      ETVKTLREVG----VETVDLAGKGGTNFAQIENDRRRDQA-----------YDFLLDWGI
IDI2_KITGR      QTLLALPDLG----VRVADVSGRGGTDFARIENSRRPLGD-----------YAFLHGWGQ
IDI2_STRC1      QTILLLADLG----VQAADVSGRGGTDFARIENGRRELGD-----------YAFLHGWGQ
IDI2_NOCFA      PTVAWLRDAG----VAVADVGGRGGTNFARIENDRRPAAD-----------FSFLDTWGQ
IDI2_LACRJ      TTIAKLQTHD----VHLINVSGRGGTNFAAIENRRNHDIN-----------FESLLDWGQ
IDI2_LACRD      TTIAKLQTHD----VHLINVSGRGGTNFAAIENRRNHDIN-----------FESLLDWGQ
IDI2_LACP3      EDLQSLQQLG----VQFVDVGGRGGTNFATIENARRSGHD-----------FAYLQDWGQ
IDI2_LACCB      EDLQSLQQLG----VQFVDVGGRGGTNFATIENARRSGHD-----------FAYLQDWGQ
IDI2_LACPL      PTMQQLYAAG----VRYLDLGGHGGTNFVDIENRRRANRD-----------MAYLHDFGL
IDI2_LACSS      ETIAKLQSVG----VTNIDVSGKGGTNFVTIENERRRDKA-----------YDYLSDWGQ
IDI2_LACBA      ETLQKLQHVG----VKLVDLGGRGGTNFVDIENFRRHQKE-----------LNYLDTWGQ
IDI2_LACLA      KTFKALAKTS----VSGINIGGAGGTNFAWIE--RKRSKN-----------GFNLDEFGL
                                  :  * .*  :  :*                          * 

IDI2_MYCGI      PTAQALTEVRG------ILPDVPLVASGGIRTGMDAAKALAMGAEVVAIARPLLAPAVE-
IDI2_MYCVP      PTAQALTEVRQ------MLPDVPLVASGGIRTGMDAAKALAMGARVVAVARPLLAPAVE-
IDI2_MYCUA      PTAEAIVEVRQ------ALPAVPLVASGGIRTGMDAAKSIALGADVVAIARPLLAPAIE-
IDI2_MYCMM      PTAEAIVEVRQ------ALPAVPLVASGGIRTGMDAAKAIALGADVVAIARPLLAPAIE-
IDI2_DEIRA      PTAQALRQARK------TLPGAQLIASGGIRSGLDAARALSLGAEVVAVARPLLEPALD-
IDI2_THET2      PTARAILEVRE------VLPHLPLVASGGVYTGTDGAKALALGADLLAVARPLLRPALE-
IDI2_TRIV2      PTAECITSVRA------IAPHIPLIASGGLRDGLDIAKAIALGADIAGLAMPFLQAAVE-
IDI2_NOSS1      PTAECITSVRA------IAPHIPLIASGGLRDGLDVAKAIALGADIAGLAMPFLQAAVE-
IDI2_THEEB      PTAHCLEQVHT------ALPDTPLIASGGLKDGIDVAKALALGAGLAGLARPFLQAAHQ-
IDI2_SYNP6      PTAESLQQVRQ------VSATVPLIASGGIRHGLDAAKAIALGADLVGLARPFLVAADQ-
IDI2_SYNY3      PTAWSLQQVVQ------NTEQILVFASGGIRSGIDGAKAIALGATLVGSAAPVLAEAKI-
IDI2_RICBR      PTLDSLKMVRE------ASKDISVIASGGLKSGIDGAKAIRMGADIFGLAGPFLKAADV-
IDI2_RICB8      PTLDSLKMVRE------ASKDISVIASGGLKSGIDGAKAIRMGADIFGLAGPFLKAADV-
IDI2_RICCN      PTLDSLKMVRE------VSKDIPIITSGGFKSGIDGAKAIRIGANIFGLAGQFLKAADT-
IDI2_RICAE      PTLDSLKMVRE------VSKDIPIITSGGLKSGIDGAKAIRIGANIFGLAGQFLKAADT-
IDI2_RICPU      PTLDSLKMVRE------VSKDIPIITSGGLKSGIDGAKAIRIGANIFGLAGQFLKAADT-
IDI2_RICRO      PTLDSLKMVRE------VSKDIPIITSGGLKSGIDGAKAIRIGANIFGLAGQFLKAADT-
IDI2_RICRS      PTLDSLKMVRE------VSKDIPIITSGGLKSGIDGAKAIRIGANIFGLAGQFLKAADT-
IDI2_RICFE      PTLDSLKMVRE------VSGDIPIIASGGLKSGIDGAKAIRMGANIFGLAGQFLKAADT-
IDI2_RICAH      PTLDSLKMVRE------VSGNIAIIASGGLKSGIDGAKAIRMGASIFGLAGQLLKAADI-
IDI2_RICCK      PTLDSLKMVRE------ISKNVSIIASGGLKSGIDGAKAIRMGANIFGLAGQLLKAVDN-
IDI2_RICPR      TTLDSLKMLQE------ISKDITIIASGGLQSGIDGAKAIRMGANIFGLAGKLLKAADI-
IDI2_RICTY      TTLDSLKMLRE------VSKDITLIASGGLQSGIDGAKAIRMGANIFGLAGQLLKAADI-
IDI2_OCEIH      PTKDCLVSVRG------ELPEAPLVASGGMKTGVDAAKAITIGADVVGFARHLLKAAME-
IDI2_CROS8      PTAQALRQIHQ------AFPSMPLIASGGIRDGIDTAKALAMGASLVGQAAAVLGSATT-
IDI2_PSEVU      PTAEALVDIAE------AWPQMPLIASGGIKNGVDAAKALRLGACMVGQAAAVLGSAGV-
IDI2_PSEU5      PTAQALLAVRD------ACPNTPLIASGGIRDGVEAAKAICLGADLVGQAAGVLQAAMH-
IDI2_RHILO      PTPASVQAVRR------ALPTVKLIASGGIRDGVDVAKAIRLGADIAGQAAGVLRAATV-
IDI2_XANP2      PTAQAVVEVRA------ACPDLPLIASGGVRHGVDAAKAIRLGADLVGQAAGTLKAAIT-
IDI2_VIBCB      PTAKCLEQIRG------QYPDLPLIASGGVYNGLEAAKAVHLGANLVGQAGAVLKAATI-
IDI2_VIBPA      PTATCLAQIRA------QHPKLPLIASGGIHNGLEAAKAIHLGANLVGQAGAVLKAATI-
IDI2_PARZE      QTVDALREARPALA--AHDGTSVLIASGGIRNGVDMAKCVILGADMCGVAAPLLKAAQN-
IDI2_HYDCU      TTPQALKQARP------FQSQAQFIASGGIRNGIDMVKSVIMGAQICGVAAPLLKPAMA-
IDI2_CHLCH      PTTNCLLDIAELKRLQPQFQQIEIIASGGVSSGMDVAKSLAMGAQLAASARHLLHALHA-
IDI2_PELPB      PTAQCLIDIGALKKESPGLNGIEIVASGGVGSGMDVAKSLALGAQLAASARALLKALHD-
IDI2_CHLPD      PTATCLEEIGRLKKNHPQYQPIEIIASGGIQSGIDVAKTILLGASVAASAGRLLKALHE-
IDI2_CHLL2      PTARCIAEVSDLKK-HTVHTDFEIIASGGIRSGLDIAKSLALGARIGASAGQLLNAAHE-
IDI2_CHLP8      PTAECLTGIAALKEKSPEYGSLAVISSGGIRNGLDVAKSIALGADIAASAQHLLKALRA-
IDI2_CHLTE      PTAECLTSIQTLKRQNPEYDALSVISSGGIRNGLDIAKSIALGANIAASAQHLLKALHS-
IDI2_CHLPM      PTAECLVAVNALRENPT--PPFSLIASGGIQSGIDIAKSIALGADLAASAGALLRSLHS-
IDI2_PELLD      PTAACVVEVDALRPRTAGGRPFSIIASGGIHSGLDIAKSIALGADLAASAGALLRALHH-
IDI2_SULIM      PTAASIMEVRYSV------PDSFLVGSGGIRSGLDAAKAIALGADIAGMALPVLKSAIEG
IDI2_SULIK      PTAASIMEVRYSV------PDSFLVGSGGIRSGLDAAKAIALGADIAGMALPVLKSAIEG
IDI2_SULIY      PTAASIMEVRYSV------PDSFLVGSGGIRSGLDAAKAIALGADIAGMALPVLKSAIEG
IDI2_SULIN      PTAASIMEVRYSV------PDSFLVGSGGIRSGLDAAKAIALGADIAGMALPVLKSAIEG
IDI2_SULIL      PTAASIMEVRYSV------PDSFLVGSGGIRSGLDAAKAIALGADIAGMALPVLKSAIEG
IDI2_SULIA      PTAASIMEVRYSV------PDSFLVGSGGIRSGLDAAKAIALGADIAGMALPVLKSAIEG
IDI2_SACSH      PTAASIMEVRYSV------PDSFLVGSGGIRSGLDAAKAIALGADIAGMALPVLKSAIEG
IDI2_SACS2      PTAASIIEVRYSI------PDAFLVGSGGIRSGLDAAKAIALGADIAGMALPVLKSAIEG
IDI2_SULTO      PTAASIVEVRSIA------QDGTIIGSGGVRNGLEVAKAIALGADIGGFALPALKAAVKG
IDI2_METS5      PTAASIVETRYSV------PDSYIIASGGIRNGLDVAKSISLGANIAGMANPVLHHAVRG
IDI2_IGNH4      PTAASIMEARAAA------PDALVIASGGIRDGLHAVKSLALGADLVGVALPALKAAYEG
IDI2_AERPE      PTAAALMEARTAA------PDAYIIASGGVRNGLDAARAIALGADAAGVALPAIRSLLSG
IDI2_METKA      PTAASILEVRSVVG-----NDLAIIGTGGVRTGMDVAKVLALGADCAGMALPVLRKVLAE
IDI2_PYRAR      PTAASICEVKSVY-------RGFVIASGGIRSGLDGARALALGAHFFTMSQPLLKATLEG
IDI2_PYRAE      PTAASICEVKSAY-------AGYLIASGGIRSGLDGAKAIALGANFFTMSQPLLKAALDG
IDI2_PYRIL      PTAASICEARSGY-------RGYIIASGGIRSGLDGAKALALGADFFTMSQPFLKAALEG
IDI2_PYRNV      PTAASICEAKSGY-------GGYIIASGGIRSGLDGVKALALGASFFTMSQPLLKAALEG
IDI2_METMA      PTVASLIES-RVS-------LPLIA-TGGIRNGLDIAKSIALGASAASAALPFVGPSLE-
IDI2_METAC      PTVASLIES-RVS-------LPLIA-TGGVRTGLDIAKSIALGASAASAALPFVGPSLE-
IDI2_METBF      PTVASIIES-RVS-------LPIIA-TGGIRTGIDIAKSIALGASAASAALPFVGPALE-
IDI2_METBU      PTVSSVLEC-RSF-------VPVVA-TGGVRTGLDIAKSLSLGAYAASAALPFVGPALI-
IDI2_ARCFU      PTAFSIVDC-RGI-------LPVIA-TGGLRSGLDVAKSIAIGAELGSAALPFLRAAVE-
IDI2_NATPD      PTAVSTLECAAEH-------DCVVA-SGGVRTGLDVAKAIALGARAGGLAKPFLEPAAS-
IDI2_HALSA      PTAASTIECVAEH-------DCVIA-SGGVRTGLDVAKAIALGARAGGLAKPFLKPATD-
IDI2_METTP      PTPVSVIECSRAG-------AQVIS-SGGVRSGIDVARSIALGAFMAGAALPLLAPATR-
IDI2_METB6      PTVVSLAEVAGTG-------SPVIA-SGGIRSGIDMAKCLALGADLCGMALPLLKPALE-
IDI2_METMP      PTAASILEVNSAF-------SGPIIATGGIRTGIDIAKSISIGANCCGTALPILKAALK-
IDI2_META3      PTAASILEVKQNF-------DKPIIATGGIRSGMDIAKSMAIGAQCCGVALPVLKAALR-
IDI2_METJA      PTAASIFEVKSVY-------DGIVIGSGGIRGGLDIAKCIAIGCDCCSVALPILKASLK-
IDI2_THEVO      PSPASVYYCSDV---------LPVIGSGGLRNGLDLAKAISLGASLGGFARTLLKDADQ-
IDI2_THEAC      PSPASVYYCSDL---------APVIGSGGLRNGLDLAKAIAMGATAGGFARSLLKDADT-
IDI2_PICTO      PSPASIKYCSLG---------EPVIGSGGLRNGLDLAKAIMFGATLGGFARELLKDANT-
IDI2_THEKO      KTAISVAEVRYAT-------ELPIIATGGMRDGIAMAKALAMGATFAGVALPLLKPAVKG
IDI2_THEON      KTAISVAEVRYAT-------ELPIIATGGMRDGIAMAKALAMGATFAGVALPLLRPAVKG
IDI2_THESM      PTALSVAEVRYAT-------GLPIIATGGIRDGIMIAKALALGANLAGVALPLLKPAVNG
IDI2_PYRHO      KTAISLAEVRWAT-------NLPIIASGGMRDGVMMAKALAMGASLVGIALPVLRPAARG
IDI2_PYRAB      KTAISLAEVRWAT-------NLPIIASGGMRDGITMAKALAMGASMVGIALPVLRPAAKG
IDI2_PYRFU      KTAISLAEVRFST-------NLPIIASGGMRDGITMAKALAMGASLVGIALPVLKPAAKG
IDI2_METTH      PTAASTVEVVESV-------SIPVIASGGIRSGIDAAKAISLGAEMVGIALPVLEAAGHG
IDI2_LEGPA      DTLQSTRNAISLN------PSFEVWGSGGVRNGLDAAKLFALGATTVGFAKPMLEAALD-
IDI2_LEGPH      DTLQSTRNAISLN------PSFEIWGSGGVRNGLDAAKLFALGATTVGFAKPMLEAALG-
IDI2_LEGPC      DTLQSIRNAISLN------PSFEIWGSGGVRNGLDAAKLFALGATTVGFAKPMLEAALD-
IDI2_LEGPL      DTLQSTHNAISLN------PSFEIWGSGGVRNGLDAAKLFALGATTVGFAKPMLEAALD-
IDI2_BDEBA      STKQSMLNAIDAR------VEYQLWASGGVRNGLEIGKLMALGASKVGVAKPFLEAALQ-
IDI2_BORBU      PSVFTLL-SIDDS------LKANIFASGGYETGMDIAKGIALGARLIGVAAVVLRAFYDS
IDI2_BORAP      PSIFTLL-SINDS------LKANIFASGGYETGMDIAKGIALGAKLIGVAAVVLRAFYDS
IDI2_BORBP      PSIFTLL-GIDDS------LKANVFASGGYETGMDIAKGIALGAKLIGVAAVVLRAFYNS
IDI2_BACSU      STAASLAEIRSEFPA------STMIASGGLQDALDVAKAIALGASCTGMAGHFLKALT-D
IDI2_BACVZ      STAASLAEIHSLSAD------QSIIASGGLQSALDVAKSIALGASGAGMAGTFLKALT-S
IDI2_BACLD      STAASLAEVSSISGD------RPIIASGGIQDALDLAKSIALGASAAGMAGYFLKVLT-A
IDI2_BACP2      PTAASLAEVHTSFPD------QTVLASGGIQDALDVTKSIALGASAAGLAGFFLKSLT-D
IDI2_BACAN      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-E
IDI2_BACAC      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-E
IDI2_BACAA      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-E
IDI2_BACC0      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-E
IDI2_BACC3      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-E
IDI2_BACAH      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-E
IDI2_BACHK      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-E
IDI2_BACCZ      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-E
IDI2_BACC7      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-Q
IDI2_BACCQ      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-Q
IDI2_BACC1      QTATSIVEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-Q
IDI2_BACCR      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-Q
IDI2_BACC4      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-Q
IDI2_BACC2      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-Q
IDI2_BACMK      QTATSIIEATSTNNN------LSFIASGGIQTALDVAKAIALGANTTAFAGYFLRILM-Q
IDI2_BACCN      QTASSIIEASSTNNT------LSLIASGGIQTALDVAKAIALGAQATAFAGYFLRILM-N
IDI2_GEOSW      PTAASIVEVAQTSPS------LVVIGSGGVRTALDAAKAIALGASAVGMAGPLLRTLV-E
IDI2_MOOTA      STAVSILEIRELGLP------VEVVATGGIRSALDAARALALGAKIVGAAGYFLKILL-E
IDI2_SYMTH      PTACALAEVAALGLP-----ELDLIASGGIRHGSDAAKALALGARAAAVAGPVLLRQQ-R
IDI2_STRMU      TTAQVLLNAQP-LMD-----KVEILASGGIRHPLDIIKALVLGAKAVGLSRTMLELVE-Q
IDI2_STRGC      STLQSLLALQP-MRD-----EVELLASGGVRHPLDMIKALVLGAKAVGLSRAMLDLVK-N
IDI2_STRPN      STMQALLNAQE-WKD-----KVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELVE-T
IDI2_STRPS      STMQALLNAQE-WKD-----KVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELVE-T
IDI2_STRPJ      STMQALLNAQE-WKD-----KVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELVE-T
IDI2_STRP2      STMQALLNAQE-WKD-----KVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELVE-T
IDI2_STRR6      STMQALLNAQE-WKD-----KVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELVE-T
IDI2_STRP7      STMQALLNAQE-WKD-----KVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELVE-T
IDI2_STRP1      TTVQCLLNAQG-LMD-----QVEILASGGVRHPLDMIKCFVLGARAVGLSRTVLELVE-K
IDI2_STRPQ      TTVQCLLNAQG-LMD-----QVEILASGGVRHPLDMIKCFVLGARAVGLSRTVLELVE-K
IDI2_STRPM      TTVQCLLNAQG-LMD-----QVEILASGGVRHPLDMIKCFVLGARAVGLSRTVLELVE-K
IDI2_STRP6      TTVQCLLNAQG-LMD-----QVEILASGGVRHPLDMIKCFVLGARAVGLSRTVLELVE-K
IDI2_STRP3      TTVQCLLNAQG-LMD-----QVEILASGGVRHPLDMIKCFVLGARAVGLSRTVLELVE-K
IDI2_STRP8      TTVQCLLNAQG-LMD-----QVEILASGGVRHPLDMIKCFVLGARAVGLSRTVLELVE-K
IDI2_STAA3      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAC      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAA8      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAE      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAT      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAB      STVESLLETTA-YQS-----KISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAR      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAU      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAS      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAW      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAA9      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAA2      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAA1      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAM      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAAN      STVESLLETTA-YQS-----EISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVE-N
IDI2_STAHJ      STVESLLESSA-YQD-----SLNVFASGGVRTPLDVVKSLALGAKAVGMSRPFLNQVE-N
IDI2_STAEQ      STVESLLESTE-FQD-----RLNIFASGGLRTPLDAVKCLALGAKAIGMSRPFLNQVE-Q
IDI2_STAES      STVESLLESTE-FQD-----RLNIFASGGLRTPLDAVKCLALGAKAIGMSRPFLNQVE-Q
IDI2_STAS1      TTVESLLESAS-YQQ-----DMDILASGGVRTPLDAVKCLALGASAVGMSRPFLNQVE-N
IDI2_ENTFA      STVISLLESQN-WQK-----KLTILGSGGVRNSLDIVKGLALGAKSMGVAGTILASLMSK
IDI2_LISMF      STGQALIDMQHQDAP-----KIAYLASGGIRNPLDIVKALALGADSVGMAGQIIYSLK-K
IDI2_LISMC      STGQALIDMQHQDAP-----KIAYLASGGIRNPLDIVKALALGADSVGMAGQIIYSLK-K
IDI2_LISMH      STGQALIDMQHQDAP-----KIAYLASGGIRNPLDIVKALALGADSVGMAGQIIYSLK-K
IDI2_LISMO      STGQALIDMQHQDAP-----KIAYLASGGIRNPLDIIKALALGADSVGMAGQIIYSLK-K
IDI2_LISIN      STGQALIDMQHADAP-----KIAYLASGGIRNPLDIVKALALGADSVGMAGQIISSLK-K
IDI2_LISW6      STGQSLIDMQHIDAP-----KIAYLASGGIRNPLDIVKSLALGADSVGMAGQIIYSLK-K
IDI2_KITGR      STPACLL--DAQDV------GFPLLASGGIRNPLDVARALALGAGAVGSSGVFLRTLI-D
IDI2_STRC1      STAACLL--DAQDI------SLPVLASGGVRHPLDVVRALALGARAVGSSAGFLRTLM-D
IDI2_NOCFA      STPACLL--DSAEVT-----GIALVASGGIRSPLDVAKALALGADATGVAGRFLATLL-D
IDI2_LACRJ      TTPESLLEAHSIRRG-----KTEIIASGGITSPLDVIKAGVLGARAVGVAGYFLNILQ-N
IDI2_LACRD      TTPESLLEAHSIRRG-----KTEIIASGGITSPLDVIKAGVLGARAVGVAGYFLNILQ-N
IDI2_LACP3      TTVESLLEARGL--------GLTMLATGGVRSPLDVVKALRLGAHAVGMSGMVLHHLI-Q
IDI2_LACCB      TTVESLLEARGL--------GLAMLATGGVRSPLDVVKALRLGAHAVGMSGLVLHHLI-Q
IDI2_LACPL      TTVESLLGVQNRPD------DLTVLAAGGVRQPLDILKALMLGADAVGMAGTVLHALL-H
IDI2_LACSS      STVESLFESQAFQT------ELTILASGGIRNPLDIVKALRLGASAVGISGQILHMLI-K
IDI2_LACBA      STVESLFEARQ-QP------DLQVIATGGIRQPLDAAKALALGARVVGSAGQILHSLI-K
IDI2_LACLA      STLESLLEAKMADN------RKSLIATGGITSAQEIFKSLILGADLSSSAGFILKNLM-Q
                 :                        :**        :   :*.     :   :      

IDI2_MYCGI      SVG-AVVDWLQRFIDELLVCLHGSGAANLSALRERGV---TELP----------------
IDI2_MYCVP      SVE-AVVDWLQRFIDELLVCLHGCGAANLSALRGRGV---TELP----------------
IDI2_MYCUA      SAT-AVQDWLQLFLDELRVCLHCCGAPDLTSLRDIGV---TAIR----------------
IDI2_MYCMM      SAT-AVQGWLQLFLDELRVCLHCCGARDLTSLRDIGV---TAIR----------------
IDI2_DEIRA      SSE-AAEAWLRNFIQELRVALFVGGYRDVREVRGG-------------------------
IDI2_THET2      GAE-RVAAWIGDYLEELRTALFAIGAKNPKEARGRVE---RV------------------
IDI2_TRIV2      SEA-ALQELAEVLIAEITTVLFCTGNATLHQLKHSGS---LQRLQ---------------
IDI2_NOSS1      SEA-ALQDLTEVLIAEITTVLFCTGNANLDQLKHSGS---LQRLQ---------------
IDI2_THEEB      SEE-ALAQRIDLLLEELKTVLFCTGSATPQALYQRRC---LERI----------------
IDI2_SYNP6      SEE-VLDQWITELLAELRIVRFCTDSGDWAALRRPGV---LRPC----------------
IDI2_SYNY3      NAQ-RVYDHYQARLRELQIAAFCCDAANLTQLAQVPL---WDRQSGQRLTKP--------
IDI2_RICBR      SEN-LVSEEIQLIIEQLKITMMCTGSRTINNLKKAEL---RMNHIPL-------------
IDI2_RICB8      SEN-LVSEEIQLIIEQLKITMMCTGSHTINNLKKAEL---RMNHIPLY------------
IDI2_RICCN      SES-LLSEEIQLIIEQLKITMLCTGSRTLKDLAKAEI---RL------------------
IDI2_RICAE      SES-LLSEEIQLIIEQLKITMLCTGSRTLKDLAKAEI---RL------------------
IDI2_RICPU      SES-LLFEEIQLIIEQLKITMLCTGSRTLKDLAKAEI---RL------------------
IDI2_RICRO      SES-LLFEEIQLIIEQLKITMLCTGSRTLKDLAKAEI---RL------------------
IDI2_RICRS      SES-LLFEEIQLIIEQLKITMLCTGSRTLKDLAKAEI---RL------------------
IDI2_RICFE      SES-LLSEEVQLIIEQLKITMLCTGSRTLKDLAKAEI---RL------------------
IDI2_RICAH      SEN-LVSEEIQLIIEQLKITMICTGSRTLKDLAKAEI---RL------------------
IDI2_RICCK      SEY-LVSEEIQLIIKQLKITMLCTGSRTLKDLTKAEI---KL------------------
IDI2_RICPR      AES-LVLEEIQVIIEQLKITMLCTGSCTLKDLAKAEI---MW------------------
IDI2_RICTY      AES-LVSEEIQLIIEQLKITMLCTGSCTLKDLAKAEI---ML------------------
IDI2_OCEIH      TPE-DVIRTMEQLELELKMTMFGIGAVNLEELKNTSR---VSIMGQSLMDK---------
IDI2_CROS8      STS-AVLDHFAVVIEQLRVACFCTGSASLSALREARL---ARVGDEE-------------
IDI2_PSEVU      STE-KVIDHFNVIIEQLRVACFCTGSRSLSDLKQADI---RYVRDTP-------------
IDI2_PSEU5      SSE-AVVSHFEVLIEQLRIACFCTGSADLAGLRQARL---LQLSAC--------------
IDI2_RHILO      STE-AVVAHFEIVIRQLAVACFCTGSADLAALRQARL---LPSAHLPAG-----------
IDI2_XANP2      STE-AVVEHFSQMTDQLRIACFATGAADLDALRRVPL---ATMD----------------
IDI2_VIBCB      STE-SIVEHFEQMALELRLACFGTGSANLRALTQARR---L-------------------
IDI2_VIBPA      STQ-LVVDHFEQMALELRLACFGTGSAKVNALTKARR---L-------------------
IDI2_PARZE      SRE-AVVSAIRKLHLEFRTAMFLLGCGTLADLKDNSS---LIRQ----------------
IDI2_HYDCU      STN-ATIGTIEQLQQEFRTAQFLLGMPKMADLFLNDS---LIVP----------------
IDI2_CHLCH      GT---LTATIEQWLNDLKAAMFLTGAATVDALRTKSL---LNH-----------------
IDI2_PELPB      GV---LEETITSWLNDLRAVMFLTGTATIAELRHKTL---ITKP----------------
IDI2_CHLPD      GK---LLQTIEMWLNDLKAVMFLTGSLSLEQLQKKRM---TLKHLPT-------------
IDI2_CHLL2      ER---LEETIETWLNDLRAVLFLTGTTSPDKLQKQHL---ILKHRPIL------------
IDI2_CHLP8      GT---LEETIRTWANDLRAAMFLTGSATTAQLKHAPI---YRKP----------------
IDI2_CHLTE      GT---LEETIRTWANDLRAAMFLTGSATIEQLKHARI---YRKP----------------
IDI2_CHLPM      GT---LEETLTTWMNDLRAAMFLTGSATIAELQNNRP---ISKQ----------------
IDI2_PELLD      GT---LEATITAWLQDLRASMFLTGSANVAELQNNRP---IGDTAKQP------------
IDI2_SULIM      -KE-SLEQFFRKIIFELKAAMMLTGSKDVNALKKTS----IVILGKLKEWAEYRGINLST
IDI2_SULIK      -KE-SLEQFFRKIIFELKAAMMLTGSKDVNALKKTS----IVILGKLKEWAEYRGINLST
IDI2_SULIY      -KE-SLEQFFRKIIFELKAAMMLTGSKDVNALKKTS----IVILGKLKEWAEYRGINLST
IDI2_SULIN      -KE-SLEQFFRKIIFELKAAMMLTGSKDVNALKKTS----IVILGKLKEWAEYRGINLST
IDI2_SULIL      -KE-SLEQFFRKIIFELKAAMMLTGSKDVNALKKTS----IVILGKLKEWAEYRGINLST
IDI2_SULIA      -KE-SLEQFFRKIIFELKAAMMLTGSKDVNALKKTS----IVILGKLKEWAEYRGINLST
IDI2_SACSH      -KE-SLEQFFRKIIFELKAAMMLTGSKDVDALKKTS----IVILGKLKEWAEYRGINLSI
IDI2_SACS2      -KE-SLEQFFRKIIFELKATMMLTGSKNVEALKRSS----IVILGKLKEWAEYRGINLSI
IDI2_SULTO      -KE-SLMNFLKKVIFELKVAMFLSGNKTIGELKKTP----IVIGKELRNWLDSRGINLSY
IDI2_METS5      -KE-QLKKFFEEVAFQLRAAMFLTGSRDVKTLRHAP----LVISGKLKDWLESRGLTLSV
IDI2_IGNH4      -KE-ELKKFLKSMMLSIKIGLFLTGSPAPEHIKGKA----IVL-GPLKEWALERGI----
IDI2_AERPE      GRQ-ATLKLLKAIEYQLKTAVYMVGETRVRGLWRAP----IVVWGRLAEEAEARGIDPRW
IDI2_METKA      GVR-GCVRFLKSIAREVKIAMLMAGCSSVEEMSSVP----IVVYGKLREWLECRGVPLDL
IDI2_PYRAR      ----RLREEIEAVITEVKIAMFLTGVRRPQELAQVP----RVYGPRLRAWLEQRGTTC--
IDI2_PYRAE      ----RLREEIAMIIAELKTAMFLTGARTVQELALVP----RVYGPRLRNWIEQRRLTC--
IDI2_PYRIL      ----RLREEIETVIAEVKIAMFLTGSRTIEDLKSAP----RVYGPRLRNWIEQRKLVC--
IDI2_PYRNV      ----RLKEEIETVVAEVKTAMFLIGARTVKDIASAP----RVYGPRLRSWLEQRGLTC--
IDI2_METMA      GKE-SVVRVLSCMLEEFKAAMFLCGCGNIKDLHNSP----VVVTGWTREYLEQRGFNVKD
IDI2_METAC      GKE-SVVKVLSCMLDEFRAAMFLCGCANIQALHNSP----VVVTGWTLKYLEQRGFNVKD
IDI2_METBF      GKE-SVVRVLSRMLDEFRIAMFLCGCANIQDLRNAP----VVVTGWTLEYLGQRGFNVKD
IDI2_METBU      GAD-EVVSSLSKMLNELRVAMFLCGCGNINELRTSSK---VTVTGWTKEYITQRGFDPKD
IDI2_ARCFU      SAE-KVREEIEYFRRGLKTAMFLTGCKNVEELKGLK----VFVSGRLKEWIDFRG-----
IDI2_NATPD      GTE-AVVERIEDLKTELRTAMFVTGSPTVADLQETD----YVLLGGTRQYVEQRGD----
IDI2_HALSA      GPD-AVIERVGDLIAELRTAMFVTGSGSIDELQQVE----YVLHGKTREYVEQRTSSE--
IDI2_METTP      GSV-DVVRVLQRFVRELRISMFLTGSRSLQELSRAP----VIITGRTREILEQRGIDTKI
IDI2_METB6      SDE-ALAARVETIHRELVASMFLCGAARIRDMRRAR----LFITGRTRQMMDDGNPA---
IDI2_METMP      SSE-AVTTVLERMIKELKTTMFLTGCNNINELKSAR----YILKGDLKNWKDQI------
IDI2_META3      GSE-DVIKLIENYIEELKTTMFLMGCDNVNELMNSR----YIIKNELKEWI---------
IDI2_METJA      GWE-EVVKVLESYIKELKIAMFLVGAENIEELKKTS----YIVKGTLKEWISQRLK----
IDI2_THEVO      SVE-AVSRNVEMIEREFKVAMFLTGNKNVYELRKTK----KVIGEPLKEWMEV-------
IDI2_THEAC      DPE-MLMKNIELIQREFRVALFLTGNKNVYELKFTK----KVIVDPLRSWLEAK------
IDI2_PICTO      SFD-DVKRQMEMIINDLKITMMLTSSRNIDELKHAR----YITLEPLRSWLEVYK-----
IDI2_THEKO      DVE-GVIKILRRYIEEIRNAMFLVGARNVEELRKVP----LVITGFTREWLEQR-IDLPS
IDI2_THEON      DVE-GVIKVLERYIEEIRNTMFLVGARNVEELRKVP----LVITGFTREWLEQR-IDLPV
IDI2_THESM      DVE-GVIKILQQYIDELRNVMFLVGAGSVKELKKVP----IVVTGFAREWLEQR-IDLWE
IDI2_PYRHO      DVE-GVVRIIRGYAEEIKNVMFLVGARNIRELRRVP----LVITGFVREWLLQR-IDLNS
IDI2_PYRAB      DVE-GVIRIIKGYAEEIRNVMFLVGARNIKELRKVP----LVITGFVREWLLQR-IDLNS
IDI2_PYRFU      DVE-GVIKVIKGYVEEIKNAMFLVGARNVEELRKVP----IVFTGFVREWLEQR-IDLQE
IDI2_METTH      YRE--VIKVIEGFNEALRTAMYLAGAETLDDLKKSP----VIITGHTGEWLNQRGFETKK
IDI2_LEGPA      STG-QVLTQMNIIEYELKTAMFCTGSRVLDDLKEKAC---P-------------------
IDI2_LEGPH      STG-QVLTQMNTIEYELKTAMFCTGSRVLDDLKEKAC---P-------------------
IDI2_LEGPC      STG-QVLTQMNTIEYELKTAMFCTGSRVLDDLKEKAC---P-------------------
IDI2_LEGPL      STD-QVLTQMNTIEYELKTAMFCTGSLVLDDLKEKAC---P-------------------
IDI2_BDEBA      GDE-ALEKLLTQLETELKVTMFCTGSRNLKDLQSKKV---IQ------------------
IDI2_BORBU      GED-AVFGLFSDYEHILKMSMFLSGSKSLLEFRNNKY---FLSSYLLDELGVFKQFYGT-
IDI2_BORAP      GED-AVFSLFSDYEHVLKMSMFLSGSKSLSDFRNNKY---FLSSYLLAEFGVFKQFYGT-
IDI2_BORBP      GED-AVLSLFSDYEHVLKMSMFLSGSKSLSELRKNKY---FLSSYLLAELGVFKQFYET-
IDI2_BACSU      SGEEGLLEEIQLILEELKLIMTVLGARTIADLQKA----PLVIKGETHHWLTERGVNTSS
IDI2_BACVZ      KGEEGLFDEMTALLQELKMIMTALGCQSVSQLQKA----PLVIKGDTHHWLSERGIDTSR
IDI2_BACLD      SGEEALAAEIESLIEDFKRIMTVLGCRTIEQLKKA----PLVIKGDTYHWLKARGVDPFV
IDI2_BACP2      GGEKGLIADMIDLQEDVKMMMTVLGAKTIEELRQT----QVVISGDTSHWLKERGIDTTY
IDI2_BACAN      DGIEKLVDEIDLLHTDLKFIMTALGAKTIEELQSV----PLVIKGETYHWLTQRGIDTTH
IDI2_BACAC      DGIEKLVDEIDLLHTDLKFIMTALGAKTIEELQSV----PLVIKGETYHWLTQRGIDTTH
IDI2_BACAA      DGIEKLVDEIDLLHTDLKFIMTALGAKTIEELQSV----PLVIKGETYHWLTQRGIDTTH
IDI2_BACC0      DGIEKLVDEIDLLHTDLKFIMTALGAKTIEELQSV----PLVIKGETYHWLTQRGIDTTH
IDI2_BACC3      DGIEKLVDEIDLLHTDLKFIMTALGAKTIEELQSV----PLVVKGETYHWLTQRGIDTTH
IDI2_BACAH      DGIEKLVDEIDLLHTDLKFIMTALGAKTIEELQSV----PLVVKGETYHWLTQRGIDTTH
IDI2_BACHK      DGIEKLVDEIDLLHTDLKFIMTALGAKTIEELQSV----PLVIKGETYHWLTQRGIDTTH
IDI2_BACCZ      DGIEKLVDEIDLLHTDLKFIMTALGAKTIEELQSV----PLVIKGETYHWLTQRGIDTTH
IDI2_BACC7      DGIEKLVDEIDLLHADLKFIMTALGAKTIEELQSV----PLVVKGETYHWLTQRGIDTTH
IDI2_BACCQ      DGIEKLVDEIDLLHADLKFIMTALGAKTIEELQSV----PLVVKGETYHWLTQRGIDTTH
IDI2_BACC1      DGIEKLVDEIDLLHTDLKFIMTALGAKTIEELQSV----PLVVKGETYHWLTQRGIDTTH
IDI2_BACCR      DGIEKLVDEIELLHTDLKFIMTALGAKTIEELQSV----PLVVKGETYHWLMQRGIDTAH
IDI2_BACC4      DGIEKLLDEIELLHTDLKFIMTALGAKTIEELQSV----PLVVKGETYHWLMQRGIDTAH
IDI2_BACC2      DGIEKLVDEIELLHTDLKFIMTALGAKTIEELQSV----PLVVKGETYHWLMQRGIDTAH
IDI2_BACMK      DGVENLVDEIDLLHTDLKFIMTALGVKTIEELQSV----PLVVKGETYHWLAQRGIDTAH
IDI2_BACCN      EGMDTLIEEVELLHTDLRFIMTALGAKNILELQQV----PLVVKGDTYHWLTQRGIDTMY
IDI2_GEOSW      QGVEALVASIEELHHDLTLIMGALGAKTIDKLQRV----PLVIRGDTHHWLTERGFDTKV
IDI2_MOOTA      QGEDALTEEILQWQEDLKRICLLTGCTTPAELATK----PVVITGQTRAWLEGRQRH---
IDI2_SYMTH      EGARGVMAYLQQFLTDLRAAMLLAGAGSVAAMGQV----PVVVTGFTGEWCRLRGVDLMA
IDI2_STRMU      HSVHEVIAIVNGWKEDLRLIMCALNCQTIAELRNV----DYLLYGRLREGQRQ-------
IDI2_STRGC      YSVEEVIDIVEGWKSDLRLIMCALSCRNLQELKNV----PYLLYGRLKEAQEQIK-----
IDI2_STRPN      YTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKV----DYLLYGKLKEAKDQMKKA---
IDI2_STRPS      YTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKV----DYLLYGKLKEAKDQMKKA---
IDI2_STRPJ      YTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKV----DYLLYGKLKEAKDQMKKA---
IDI2_STRP2      YTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKV----DYLLYGKLKEANDQMKKA---
IDI2_STRR6      YTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKV----DYLLYGKLKEANDQMKKA---
IDI2_STRP7      YTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKV----DYLLYGKLKEANDQMKKA---
IDI2_STRP1      YPTERVIAIVNGWKEELKIIMCALDCKTIKELKGV----DYLLYGRLQQVN---------
IDI2_STRPQ      YPTERVIAIVNGWKEELKIIMCALDCKTIKELKGV----DYLLYGRLQQVN---------
IDI2_STRPM      YPTERVIAIVNGWKEELKIIMCALDCKTIKELKGV----DYLLYGRLQQVN---------
IDI2_STRP6      YPTERVIAIVNGWKEELKIIMCALDCKTIKELKGV----DYLLYGRLQQVN---------
IDI2_STRP3      YPTERVIAIVNGWKEELKIIMCALDCKTIKELKGV----DYLLYGRLQQVN---------
IDI2_STRP8      YPTERVIAIVNGWKEELKIIMCALDCKTIKELKGV----DYLLYGRLQQVN---------
IDI2_STAA3      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRNLNIHR
IDI2_STAAC      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRNLNIHR
IDI2_STAA8      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRNLNIHR
IDI2_STAAE      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRNLNIHR
IDI2_STAAT      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRNLNIHR
IDI2_STAAB      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRNLNIHR
IDI2_STAAR      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRSLNIHR
IDI2_STAAU      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRNLNIHR
IDI2_STAAS      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRSLNIHR
IDI2_STAAW      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEILSWIEQRSLNIHR
IDI2_STAA9      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEIMSWIEQRSLNIHR
IDI2_STAA2      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEIMSWIEQRSLNIHR
IDI2_STAA1      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEIMSWIEQRSLNIHR
IDI2_STAAM      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEIMSWIEQRSLNIHR
IDI2_STAAN      NGIAHTVAYVESFIEHMKSIMTMLDAKNIDDLTQK----QIVFSPEIMSWIEQRSLNIHR
IDI2_STAHJ      GGITTTIEYVESFIEHTKSIMTMLNARDISELKQS----KFVFDHKLMSWIEQRGLDIHR
IDI2_STAEQ      SGITNTVDYVESFIQHMKKIMTMLDAPNIERLRQA----DIVMSPELISWINQRGLHLNR
IDI2_STAES      SGITNTVDYVESFIQHMKKIMTMLDAPNIERLRQA----DIVMSPELISWINQRGLHLNR
IDI2_STAS1      YGITETLNYTEQFTDHMKKIMTMLDVKTIKDLKQT----QMVFSPKLQSWIEQRGLDIR-
IDI2_ENTFA      NGLENTLALVQQWQEEVKMLYTLLGKKTTEELTST----ALVLDPVLVNWCHNRGIDSTV
IDI2_LISMF      EGVTKTIEKLELWKEQLRGLFVLANAKNISELKTT----PLIISGELAKWGALREIDLVK
IDI2_LISMC      EGVTKTIEKLELWKEQLRGLFVLANAKNISELKTT----PLIISGELAKWGALREIDLVK
IDI2_LISMH      EGLTKTIEKLELWKEQLRSLFVLADAKNISELKTT----PLIISGELAKWGTLREIDLVK
IDI2_LISMO      EGVTKTIEKLELWKEQLRGLFVLANAKNIAELKTT----PLIVSGELAKWGTLREINLVK
IDI2_LISIN      DGVSKTIEKLELWKEQLRGLFVLANAKNIAELKET----PLIVSGELAKWGSLREIDLVQ
IDI2_LISW6      DGVSNTIEKLELWKEQLRGLFVLADAKNIAELKET----SLIVNGKLAEWGNVRGIDLVQ
IDI2_KITGR      GGVSALVAQISTWLDQLAALQTMLGARTPADLTRC----DVLIHGPLRSFCTDRGIDIGR
IDI2_STRC1      DGVDALITKLTTWLDQLAALQTMLGARTPADLTRC----DVLLHGELRDFCADRGIDTRR
IDI2_NOCFA      RGAEGLIETIRAWLDQLRSIATVLGAATPADLRRC----DLLITGEVAAFCRLRGIDAAA
IDI2_LACRJ      EGYEALDQTLGEWQVIVKRLLALLGCSSFTELSRV----EYVLGTDLLSYARQRHLR---
IDI2_LACRD      EGYEALDQTLGEWQVIVKRLLALLGCSSFTVLSRV----EYVLGTDLLSYARQRHLR---
IDI2_LACP3      TGYEATLAYFQNFLHQLRQLYALLGVTNWQELQEA----PIVLSADLEHYRQARGLPGI-
IDI2_LACCB      TGYEATLAYFQNFLHQLRQLYALLGVTNWQELQEA----PIVLSADLEHYRQARGLPGI-
IDI2_LACPL      HTDDEVIAMLTDWQSQLKRLFALVGVTRVDQFKSSRIQDKILLSPELVNYKQSIKD----
IDI2_LACSS      TGPTETAEQLLAWQAQIQSIMAILGARNLTALQSA----PMILSPNLRHYLNERHLSL--
IDI2_LACBA      TDEATTTAMLLDWQVGLRTIMTLLGTTDLTQLRQQ----RLLLSPELINYCQQRQLTY--
IDI2_LACLA      TGPEKVEEVIEQWKQDLNKLFVLTGSKNIEECRKV----ELLYSINMLNFIQQRK-----
                                        .                                   

IDI2_MYCGI      ------------------------------
IDI2_MYCVP      ------------------------------
IDI2_MYCUA      ------------------------------
IDI2_MYCMM      ------------------------------
IDI2_DEIRA      ------------------------------
IDI2_THET2      ------------------------------
IDI2_TRIV2      ------------------------------
IDI2_NOSS1      ------------------------------
IDI2_THEEB      ------------------------------
IDI2_SYNP6      ------------------------------
IDI2_SYNY3      ------------------------------
IDI2_RICBR      ------------------------------
IDI2_RICB8      ------------------------------
IDI2_RICCN      ------------------------------
IDI2_RICAE      ------------------------------
IDI2_RICPU      ------------------------------
IDI2_RICRO      ------------------------------
IDI2_RICRS      ------------------------------
IDI2_RICFE      ------------------------------
IDI2_RICAH      ------------------------------
IDI2_RICCK      ------------------------------
IDI2_RICPR      ------------------------------
IDI2_RICTY      ------------------------------
IDI2_OCEIH      ------------------------------
IDI2_CROS8      ------------------------------
IDI2_PSEVU      ------------------------------
IDI2_PSEU5      ------------------------------
IDI2_RHILO      ------------------------------
IDI2_XANP2      ------------------------------
IDI2_VIBCB      ------------------------------
IDI2_VIBPA      ------------------------------
IDI2_PARZE      ------------------------------
IDI2_HYDCU      ------------------------------
IDI2_CHLCH      ------------------------------
IDI2_PELPB      ------------------------------
IDI2_CHLPD      ------------------------------
IDI2_CHLL2      ------------------------------
IDI2_CHLP8      ------------------------------
IDI2_CHLTE      ------------------------------
IDI2_CHLPM      ------------------------------
IDI2_PELLD      ------------------------------
IDI2_SULIM      YDKVRKRE----------------------
IDI2_SULIK      YDKVRKRE----------------------
IDI2_SULIY      YDKVRKRE----------------------
IDI2_SULIN      YDKVRKRE----------------------
IDI2_SULIL      YDKVRKRE----------------------
IDI2_SULIA      YDKVRKRE----------------------
IDI2_SACSH      YEKVRKRE----------------------
IDI2_SACS2      YEKVRKRE----------------------
IDI2_SULTO      YDSVRKRRV---------------------
IDI2_METS5      YESIRKGA----------------------
IDI2_IGNH4      YEEWLRAR----------------------
IDI2_AERPE      YTNTLRLEALVYKDVK--------------
IDI2_METKA      VCTGDRRTGWNR------------------
IDI2_PYRAR      ------------------------------
IDI2_PYRAE      ------------------------------
IDI2_PYRIL      ------------------------------
IDI2_PYRNV      ------------------------------
IDI2_METMA      LSLPGNAL----------------------
IDI2_METAC      YSLPKNAL----------------------
IDI2_METBF      YAIAGDSF----------------------
IDI2_METBU      LDIRSDL-----------------------
IDI2_ARCFU      ------------------------------
IDI2_NATPD      ------------------------------
IDI2_HALSA      ------------------------------
IDI2_METTP      FSSKR-------------------------
IDI2_METB6      ------------------------------
IDI2_METMP      ------------------------------
IDI2_META3      ------------------------------
IDI2_METJA      ------------------------------
IDI2_THEVO      ------------------------------
IDI2_THEAC      ------------------------------
IDI2_PICTO      ------------------------------
IDI2_THEKO      YLRNRGI-----------------------
IDI2_THEON      YLRDRRI-----------------------
IDI2_THESM      FLRDRRL-----------------------
IDI2_PYRHO      YLRSRFKH----------------------
IDI2_PYRAB      YLRARFKM----------------------
IDI2_PYRFU      FVKKRAKLRFEFWNVGFYSYPYTSSSTHLF
IDI2_METTH      YARRS-------------------------
IDI2_LEGPA      ------------------------------
IDI2_LEGPH      ------------------------------
IDI2_LEGPC      ------------------------------
IDI2_LEGPL      ------------------------------
IDI2_BDEBA      ------------------------------
IDI2_BORBU      ------------------------------
IDI2_BORAP      ------------------------------
IDI2_BORBP      ------------------------------
IDI2_BACSU      YSVR--------------------------
IDI2_BACVZ      FSRR--------------------------
IDI2_BACLD      YSMR--------------------------
IDI2_BACP2      YSVRTNKKKG--------------------
IDI2_BACAN      YSRR--------------------------
IDI2_BACAC      YSRR--------------------------
IDI2_BACAA      YSRR--------------------------
IDI2_BACC0      YSRR--------------------------
IDI2_BACC3      YSRR--------------------------
IDI2_BACAH      YSRR--------------------------
IDI2_BACHK      YSRR--------------------------
IDI2_BACCZ      YSRR--------------------------
IDI2_BACC7      YSRR--------------------------
IDI2_BACCQ      YSRR--------------------------
IDI2_BACC1      YSRR--------------------------
IDI2_BACCR      YSRR--------------------------
IDI2_BACC4      YSRR--------------------------
IDI2_BACC2      YSRR--------------------------
IDI2_BACMK      YSRR--------------------------
IDI2_BACCN      YSQR--------------------------
IDI2_GEOSW      YSCR--------------------------
IDI2_MOOTA      ------------------------------
IDI2_SYMTH      LANRSER-----------------------
IDI2_STRMU      ------------------------------
IDI2_STRGC      ------------------------------
IDI2_STRPN      ------------------------------
IDI2_STRPS      ------------------------------
IDI2_STRPJ      ------------------------------
IDI2_STRP2      ------------------------------
IDI2_STRR6      ------------------------------
IDI2_STRP7      ------------------------------
IDI2_STRP1      ------------------------------
IDI2_STRPQ      ------------------------------
IDI2_STRPM      ------------------------------
IDI2_STRP6      ------------------------------
IDI2_STRP3      ------------------------------
IDI2_STRP8      ------------------------------
IDI2_STAA3      G-----------------------------
IDI2_STAAC      G-----------------------------
IDI2_STAA8      G-----------------------------
IDI2_STAAE      G-----------------------------
IDI2_STAAT      G-----------------------------
IDI2_STAAB      G-----------------------------
IDI2_STAAR      G-----------------------------
IDI2_STAAU      G-----------------------------
IDI2_STAAS      G-----------------------------
IDI2_STAAW      G-----------------------------
IDI2_STAA9      G-----------------------------
IDI2_STAA2      G-----------------------------
IDI2_STAA1      G-----------------------------
IDI2_STAAM      G-----------------------------
IDI2_STAAN      G-----------------------------
IDI2_STAHJ      G-----------------------------
IDI2_STAEQ      K-----------------------------
IDI2_STAES      K-----------------------------
IDI2_STAS1      ------------------------------
IDI2_ENTFA      FAKR--------------------------
IDI2_LISMF      LANRK-------------------------
IDI2_LISMC      LANRK-------------------------
IDI2_LISMH      LANRK-------------------------
IDI2_LISMO      LANRK-------------------------
IDI2_LISIN      LANRK-------------------------
IDI2_LISW6      LANRK-------------------------
IDI2_KITGR      FARRSSSADIRSEMTGSTR-----------
IDI2_STRC1      LAQRSSSIE-ALQTTGSTR-----------
IDI2_NOCFA      YAHRSHWWHPSERRSLL-------------
IDI2_LACRJ      ------------------------------
IDI2_LACRD      ------------------------------
IDI2_LACP3      ------------------------------
IDI2_LACCB      ------------------------------
IDI2_LACPL      ------------------------------
IDI2_LACSS      ------------------------------
IDI2_LACBA      ------------------------------
IDI2_LACLA      ------------------------------