CLUSTAL format seed alignment for MF_00355

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BCHL_CHLCH      ----------------------------------------------MSLVIAVYGKGGIG
BCHL_CHLTE      ----------------------------------------------MSLVLAVYGKGGIG
BCHL_CHLPD      ----------------------------------------------MSLVLAVYGKGGIG
BCHL_PELLD      ----------------------------------------------MSLVLAVYGKGGIG
BCHL_CHLAA      ----------------------------------------------MSLILAIYGKGGIG
BCHL_ROSS1      ----------------------------------------------MSLTLAIYGKGGIG
CHLL_MESVI      ------------------------------------------------MKIAVYGKGGIG
CHLL_CHLAT      ------------------------------------------------MKIAVYGKGGIG
CHLL_CHAVU      ------------------------------------------------MKIAVYGKGGIG
CHLL_MARPO      ------------------------------------------------MKIAVYGKGGIG
CHLL_PHYPA      ------------------------------------------------MKIAVYGKGGIG
CHLL_HUPLU      ------------------------------------------------MKLAIYGKGGIG
CHLL_ANTAG      ------------------------------------------------MKIAVYGKGGIG
CHLL_ANGEV      ------------------------------------------------MKIAVYGKGGIG
CHLL_PINKO      ------------------------------------------------MKIAVYGKGGIG
CHLL_PINTH      ------------------------------------------------MKIAVYGKGGIG
CHLL_CYCTA      ------------------------------------------------MKIAVYGKGGIG
CHLL_ADICA      ------------------------------------------------MKVAVYGKGGIG
CHLL_CHAGL      ------------------------------------------------MKIAVYGKGGIG
CHLL_ZYGCR      ------------------------------------------------MKIAVYGKGGIG
CHLL_STAPU      ------------------------------------------------MKIAVYGKGGIG
CHLL_PLETE      ------------------------------------------------MKLAVYGKGGIG
CHLL_NOSS1      ------------------------------------------------MKLAVYGKGGIG
CHLL_TRIV2      ------------------------------------------------MKLAVYGKGGIG
CHLL_TRIEI      ------------------------------------------------MKLSVYGKGGIG
CHLL_SYNY3      ----------------------------------------------MTLTLAVYGKGGIG
CHLL_THEEB      ------------------------------------------------MKLAVYGKGGIG
CHLL_SYNP6      ------------------------------------------------MKLSVYGKGGIG
CHLL_SYNE7      ------------------------------------------------MKLSVYGKGGIG
CHLL_PORPU      ------------------------------------------------MKLAVYGKGGIG
CHLL_PYRYE      ------------------------------------------------MKLAVYGKGGIG
CHLL_SYNJB      -------------------------------------------MEERAVKLAVYGKGGIG
CHLL_SYNJA      -------------------------------------------MEERAVKLAVYGKGGIG
CHLL_GLOVI      ------------------------------------------------MKLAVYGKGGIG
CHLL_TETOB      ------------------------------------------------MKLAVYGKGGIG
CHLL_STIHE      ------------------------------------------------MKLAVYGKGGIG
CHLL_CHLVU      ------------------------------------------------MKLAVYGKGGIG
CHLL_NEPOL      ------------------------------------------------MKLAVYGKGGIG
CHLL_CHLRE      ------------------------------------------------MKLAVYGKGGIG
CHLL_OLTVI      ------------------------------------------------MKLAVYGKGGIG
CHLL_CYAPA      ------------------------------------------------MKLAVYGKGGIG
BCHL_HELMO      ------------------------------------------------MIIAVYGKGGVG
BCHL_RHOS4      ---MSPKD------LTIPTGA-------DGEGSVQVHLDEADKITG-AKVFAVYGKGGIG
BCHL_RHOS1      ---MSPKD------LTIPTGA-------DGEGSVQVHLDEADKITG-AKVFAVYGKGGIG
BCHL_RHOS5      ---MSPKD------LTIPTGE-------DGEGSVQVHLDESDKITG-AKVFAVYGKGGIG
BCHL_DINSH      ---MSPLD----TAPPVLKGE-------DGEGSVQVHQDDSMKIEG-AKVFSVYGKGGIG
BCHL_ROSDO      ---MSPLD----RTPPSLRGQ-------DGEGSVQVHQDETAKIEG-AKVFSVYGKGGIG
BCHL_JANSC      MREAAGLEARGLKSPPILKGQ-------DGEGSLQVHQSDDMKIEG-AKVFAVYGKGGIG
BCHL_BRASB      ------------MNVTLRPPLTTAPRRPDGAGSVQVQLDPNVVIGT-AKVFSVYGKGGIG
BCHL_BRASO      ------------MNVTLRPPLAAAPRRPDGAGSVQVQMDPNLVIGT-ARVFSVYGKGGIG
BCHL_RHORT      -----------MFDETMRQP-------PDGEGSVQVEMDPALHIET-AKVFAIYGKGGIG
BCHL_RHOPS      --MNILTDPLKLKTSGCADANASKCAEGDGEGSVQVQLDPNVKIGS-AKVFSIYGKGGIG
BCHL_RHOP2      --MNILTDPLKLKTSGCADANASKCAEGDGEGSVQVQLDPNVKIGS-AKVFSIYGKGGIG
BCHL_RHOPB      --MNILTDPAKLKTAGCADTNASKCSEGDGEGSVQVQLDPNLKIGT-AKVFSIYGKGGIG
BCHL_RHOPA      --MNILTDPNKLKTSGCADVNASKCAEGDGEGSVQVQLDPNLNIGT-AKVFSIYGKGGIG
BCHL_RHOP5      --MNILTDPTKLQ--GCTDTNANKCVEGDGEGSVQVQLDPDLKIGT-AKVFSIYGKGGIG
CHLL_PROM1      ------------MTSTITRKE-------DGEGSVQVKQDPKAQIQEGALVIAVYGKGGIG
CHLL_PROMT      ------------MTSTITRKE-------DGEGSVQVKQDPKAQIQEGALVIAVYGKGGIG
CHLL_PROMA      ------------MTTTLANRP-------DGEGSVQVKLDPKVNIEEGALVIAVYGKGGIG
CHLL_PROM3      ------------MTTTLTRPA-------DGEGSVQVQQDASVRIQEGALVIAVYGKGGIG
CHLL_PROMM      ------------MTTTLTRPA-------DGEGSVQVQQDASVRIQEGALVIAVYGKGGIG
CHLL_PROMS      ------------MTSTINRPL-------DGEGSVQVKQDPKINIEEGALVIAVYGKGGIG
CHLL_PROM0      ------------MTSTINRPL-------DGEGSVQVKQDPKINIEEGALVIAVYGKGGIG
CHLL_PROM2      ------------MTSTINKPL-------DGEGSVQVKQDPKINIEEGALVIAVYGKGGIG
CHLL_PROM9      ------------MTSTINKPL-------DGEGSVQVKQDPKINIEEGALVIAVYGKGGIG
CHLL_PROM5      ------------MTSTINKHL-------DGEGSVQVKQDPKVNIEEGALVIAVYGKGGIG
CHLL_PROMP      ------------MTSTINKPL-------DGEGSVQVKQDPKVNIEEGALVIAVYGKGGIG
CHLL_SYNS3      ------------MTTTLTRPA-------DGDGSVQVHQDPGTKIEEGALVIAVYGKGGIG
CHLL_SYNS9      ------------MTTTLSRPT-------DGEGSVQVQQDPSMKIEEGALVIAVYGKGGIG
CHLL_SYNSC      ------------MTTILTRPA-------DGEGSVQVHQDPALNIQEETLVIAVYGKGGIG
CHLL_SYNPX      ------------MTTTLTRPT-------DGEGSVQVHQDPGLNIQEETLVIAVYGKGGIG
CHLL_SYNPW      ------------MTTTLKRPT-------DGEGSVQVHQDPSVNIEEETLVIAVYGKGGIG
CHLL_SYNR3      ------------MTTTLTPPSSRR---EDGDGSVQVHQDASLKIEEGALVIAVYGKGGIG
BCHL_HALHL      ------MSNGSVPVSGIGGRG-------DGEGSSQVHMESTGGMDR-AKVFAVYGKGGIG
                                                                  .::*****:*

BCHL_CHLCH      KSTTSANISAALALKGAKVLQIGCDPKHDSTFPITGKLQKTVIEALEEVDFHHEELSPED
BCHL_CHLTE      KSTTSANISAALALKGAKVLQIGCDPKHDSTFPITGKLQKTVIEALEEVDFHHEELSPED
BCHL_CHLPD      KSTTSANISAALALKGAKVLQIGCDPKHDSTFPITGKLQKTVIEALEEVDFHHEELGAED
BCHL_PELLD      KSTTSANISAALALKGAKVLQIGCDPKHDSTFPITGKLQKTVIEALEEVDFHHEELTAED
BCHL_CHLAA      KSTTSANLSAAMALKGAKVLQIGCDPKHDSTFPLTGHLQPTVIDVLDSVNFHLEDVSKED
BCHL_ROSS1      KSTTSSNLSAALALKGAKVLQIGCDPKHDSTFALTGTLQPTVIDVLTEVDFHHEEVSVED
CHLL_MESVI      KSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_CHLAT      KSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_CHAVU      KSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_MARPO      KSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_PHYPA      KSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQLKDYHYEDVWPED
CHLL_HUPLU      KSTTSCNISIALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQIKDYHYEDVWPED
CHLL_ANTAG      KSTTSCNTSIASARRGKRVLQIGCDPKHDSTFTLTGSLIPTIIDTSQSKDYHYEDVWPED
CHLL_ANGEV      KSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_PINKO      KSTTSCNISVALARRGQKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDIWPED
CHLL_PINTH      KSTTSCNISVALARRGQKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDIWPED
CHLL_CYCTA      KSTTSCNISIALARRGGKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEEIWPED
CHLL_ADICA      KSTTSCNISIALARRGRKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQVKDYHYEDVWPED
CHLL_CHAGL      KSTTSCNISIALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_ZYGCR      KSTTSCNISIALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_STAPU      KSTTSCNISIALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_PLETE      KSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_NOSS1      KSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDVWPED
CHLL_TRIV2      KSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDVWPED
CHLL_TRIEI      KSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDIWPED
CHLL_SYNY3      KSTTSCNISTALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDFHYEDIWPED
CHLL_THEEB      KSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPED
CHLL_SYNP6      KSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPED
CHLL_SYNE7      KSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPED
CHLL_PORPU      KSTTSCNISVALSKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPED
CHLL_PYRYE      KSTTSCNISVALSKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPED
CHLL_SYNJB      KSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLEAKGYHHEDIYPED
CHLL_SYNJA      KSTTSCNLSVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLEAKGYHYEDIYPED
CHLL_GLOVI      KSTTSCNISVALAKRGRRVLQIGCDPKHDSTFTLTGFLIPTIIDTLEEKDYHYEDVYAED
CHLL_TETOB      KSTTSCNISIALAKRGKKVLQIGCDPKSDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPED
CHLL_STIHE      KSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYENVWPED
CHLL_CHLVU      KSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPED
CHLL_NEPOL      KSTSSCNISIALATRGKKVLQIGADPKHDSTFALTGFLIPTIMDTLQSKDYHYEEIWPED
CHLL_CHLRE      KSTTSCNISIALRKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLSSKDYHYEDIWPED
CHLL_OLTVI      KSTVSCNLSIALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDIWPED
CHLL_CYAPA      KSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGHLIPTIIDTLQEKDFHYEDIWPED
BCHL_HELMO      KSTTTSNLAVAIAKEGKRVLQIGCDPKSDSTFTIAGKMIPTVVEILDKFNYHYESIEPGD
BCHL_RHOS4      KSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPED
BCHL_RHOS1      KSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPED
BCHL_RHOS5      KSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPED
BCHL_DINSH      KSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTGSLVPTVIDILKEVDFHAEELRPED
BCHL_ROSDO      KSTTSSNLSAAFSMLGKRVLQIGCDPKHDSTFTLTGSLVPTVIDILKEVDFHPEELRAED
BCHL_JANSC      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTGMLQPTVIDILKSVDFHAEELRPED
BCHL_BRASB      KSTTSSNLSVALSKLGKRVLQIGCDPKHDSTFTLTKRLVPTVIDILEQVNFHAEELRPED
BCHL_BRASO      KSTTSSNLSVALSKLGKRVLQIGCDPKHDSTFTLTKRLVPTVIDILEQVNFHSEELRPDD
BCHL_RHORT      KSTTSSNLSAAFSKLGKRVVQIGCDPKHDSTFTLTKRLVPTVIDVLQAVHFHTEELRVED
BCHL_RHOPS      KSTTSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKRLIPTVIDVLEEVNFHSEELRPED
BCHL_RHOP2      KSTTSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKRLIPTVIDVLEEVNFHSEELRPED
BCHL_RHOPB      KSTTSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKRLVPTVIDVLESVNFHSEELRPED
BCHL_RHOPA      KSTTSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKKLMPTVIDVLESVNFHSEEVRPED
BCHL_RHOP5      KSTTSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKCLIPTVIDVLESVNFHAEELRPED
CHLL_PROM1      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPED
CHLL_PROMT      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPED
CHLL_PROMA      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPQD
CHLL_PROM3      KSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHRMVPTVIDILEEVDFHSEELRPDD
CHLL_PROMM      KSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHRMVPTVIDILEEVDFHSEELRPDD
CHLL_PROMS      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTD
CHLL_PROM0      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTD
CHLL_PROM2      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPND
CHLL_PROM9      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTD
CHLL_PROM5      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTD
CHLL_PROMP      KSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTD
CHLL_SYNS3      KSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPED
CHLL_SYNS9      KSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHSMVPTVIDILEEVDFHSEELRPDD
CHLL_SYNSC      KSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPED
CHLL_SYNPX      KSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPED
CHLL_SYNPW      KSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPED
CHLL_SYNR3      KSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELQPED
BCHL_HALHL      KSTTSSNLAVAFSQLGKRVLQIGCDPKHDSTFTLTKRLVPTVIDSLEEVDFHMEELRPED
                *** :.* : *    * :*:***.*** ****.::  :  *:::      :* *.:   *

BCHL_CHLCH      VIESGFAGIDGLEAGGPPAGSGCGGYVVGESVTLLQEMGLYDKYDVILFDVLGDVVCGGF
BCHL_CHLTE      IVETGFAGIDGLEAGGPPAGSGCGGYVVGESVTLLQEMGVYDKYDVILFDVLGDVVCGGF
BCHL_CHLPD      IIETGFAGIDCLEAGGPPAGSGCGGYVVGESVTLLQELGLYDKYDVILFDVLGDVVCGGF
BCHL_PELLD      VIETGFAGIDGLEAGGPPAGSGCGGYVVGESVTLLQELGLYDKYDVILFDVLGDVVCGGF
BCHL_CHLAA      VIRTGFAGVDTLESGGPPAGSGCGGYVVGETVKLLKEFGLYDKYDVIVFDVLGDVVCGGF
BCHL_ROSS1      VVHTGFAGVDTLESGGPPAGSGCGGYVVGETVKLLHEFGLYDKYDVIVFDVLGDVVCGGF
CHLL_MESVI      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGF
CHLL_CHLAT      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGF
CHLL_CHAVU      VIYKGYGEVNCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGF
CHLL_MARPO      VIYKGYGRCDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGF
CHLL_PHYPA      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGF
CHLL_HUPLU      VIHKGYGGVDRVEAGGPPAGAGCGGYVVGETVKLSKELNAFYEYDIILFDVLGDAVRGGF
CHLL_ANTAG      VIYKGYGGVDCVEVGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVSGDVVCGGF
CHLL_ANGEV      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKSLKELNAFYEYDIILFDVLGDVVCGGF
CHLL_PINKO      VIHKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGF
CHLL_PINTH      VIHKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGF
CHLL_CYCTA      VIHKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGL
CHLL_ADICA      VIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGF
CHLL_CHAGL      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGF
CHLL_ZYGCR      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGF
CHLL_STAPU      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGF
CHLL_PLETE      VIYQGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGF
CHLL_NOSS1      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGF
CHLL_TRIV2      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGF
CHLL_TRIEI      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGF
CHLL_SYNY3      VIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGF
CHLL_THEEB      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGF
CHLL_SYNP6      VIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGF
CHLL_SYNE7      VIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGF
CHLL_PORPU      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDIILFDVLGDVVCGGF
CHLL_PYRYE      VIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDIILFDVLGDVVCGGF
CHLL_SYNJB      VIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGF
CHLL_SYNJA      VIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGF
CHLL_GLOVI      VIYEGYGGVHCVEAGGPPAGAGCGGYVVGETMKLLKELRAFEDHDVILFDVLGDVVCGGF
CHLL_TETOB      VIYQGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKEFNAFYEYDVILFDVLGDVVCGGF
CHLL_STIHE      VIYQGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGF
CHLL_CHLVU      VIYQGYGEVDSVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGF
CHLL_NEPOL      IIYQGYGGVDCVEAGGPPAGAGCGGFVVGETTKLLKELNSFYEYDVILFDVLGDVVCGGF
CHLL_CHLRE      VIYGGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFFEYDVILFDVLGDVVCGGF
CHLL_OLTVI      VIYAGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGF
CHLL_CYAPA      VIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDIILFDVLGDVVCGGF
BCHL_HELMO      LIFTGYGGVDVVETGGPPAGSGCGGYVVGETVKLLEKMDVMARYDVILFDVLGDVVCGGF
BCHL_RHOS4      FVFEGFNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGF
BCHL_RHOS1      FVFEGFNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGF
BCHL_RHOS5      FVFEGFNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGF
BCHL_DINSH      FVFEGFNGVKCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLEDTDVVIFDVLGDVVCGGF
BCHL_ROSDO      FVFDGFNGVKCVEAGGPPAGTGCGGYVVGQTVKLLKQHHMLEDTDVVIFDVLGDVVCGGF
BCHL_JANSC      FVTQGYNGVQCIEAGGPPAGTGCGGYVVGQTVKLLKQHHLLEDTDVVLFDVLGDVVCGGF
BCHL_BRASB      FVYQGYNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
BCHL_BRASO      FVYQGYNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLDDTDVVIFDVLGDVVCGGF
BCHL_RHORT      FVYEGYNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHILEDADVVVFDVLGDVVCGGF
BCHL_RHOPS      FVFEGYNGVMCLEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
BCHL_RHOP2      FVFEGYNGVMCLEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
BCHL_RHOPB      FVFEGYNGVMCLEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
BCHL_RHOPA      FVFEGYNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
BCHL_RHOP5      FVFEGYNGVMCLEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROM1      FMFKGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROMT      FMFKGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROMA      FMFEGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROM3      FMFEGFNGVKCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROMM      FMFEGFNGVKCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROMS      FMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROM0      FMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROM2      FMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROM9      FMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROM5      FMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_PROMP      FMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_SYNS3      FMFTGYNGVKCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_SYNS9      FVFTGYNGVKCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_SYNSC      FVFTGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_SYNPX      FVFTGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_SYNPW      FVFSGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
CHLL_SYNR3      FVFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGF
BCHL_HALHL      YVYEGYNGVLCVEAGGPPAGTGCGGYVVGQTVKLLKQHHLLEETDVVIFDVLGDVVCGGF
                 :  *:     :* ******:****:*.*:: .  .:       *:::*** **.* **:

BCHL_CHLCH      SAPLNYADYAIIIATNDFDSIFAANRLCMAIQQKSVR--YKVKLAGIVANRVDYTTGGGT
BCHL_CHLTE      SAPLNYADYAVIIATNDFDSIFAANRLCMAIQQKSVR--YKVQLAGIVANRVDYTKGGGT
BCHL_CHLPD      SAPLNYADYAIIIATNDFDSIFAANRLCMAIQQKSVR--YKVKLAGIVANRVDYTTGGGT
BCHL_PELLD      SAPLNYADYAIIIATNDFDSIFAANRLCMAIQQKSVR--YKVKLAGIVANRVDYAKGGGT
BCHL_CHLAA      SAPLNYADYGLIIACNDFDSIFAANRLCLAISQKSQR--HKVKLAGIIANRVDYEYGGGT
BCHL_ROSS1      SAPLNYADYGIIIACNDFDSIFAANRLCLAIKQKSAR--YRVELAGIIANRVDYELGGGT
CHLL_MESVI      AAPLNYADYCIIITDNGFDALFAANRIAASVREKART--HPLRLAGLVGNRTSKR-----
CHLL_CHLAT      AAPLNYADYCIIITDNGFDALFAANRIAASVREKART--HPLRLAGLVGNRTSKR-----
CHLL_CHAVU      AAPLNYADYCIIITDNGFDALFAANRIAASVREKART--HPLRLAGLVGNRTSKR-----
CHLL_MARPO      AAPLNYADYCIIITDNGFDALFAANRIAASVREKART--HPLRLAGLVGNRTSKR-----
CHLL_PHYPA      AAPLNYADYCIIITDNGFDALFAANRIAASVREKART--HPLRLAGLVGNRTSKR-----
CHLL_HUPLU      ASPLNYADYCIIIADNGFDALLATNRIAASVREKARTRTHPLRLAGLVGNRTSER-----
CHLL_ANTAG      VVLLNYADYCIIITDNGFDALFAVNCIAASVREKART--HSLRLAGSVGNRTSKR-----
CHLL_ANGEV      AAPLNYADYCIIITDNGFDALFAANRIAASVREKAHT--HPLRLAGLVGNRTSKR-----
CHLL_PINKO      AAPLNYADYCVIITDNGFDALFAANRITASIREKART--HPLRLAGLVGNRTSRR-----
CHLL_PINTH      AAPLNYADYCVIITDNGFDALFAANRITASIREKART--HPLRLAGLVGNRTSRR-----
CHLL_CYCTA      AAPLNYADYCVIITDNGFDALFAANRIAVSIGEKTRT--HLLRLAGLVGNRTSKR-----
CHLL_ADICA      AAPLNYADYCIIITDNGFDALFAANRIAASVREKSHT--HPLRLAGLVGNRTSGR-----
CHLL_CHAGL      AAPLNYADYCIIITDNGFDALFAANRIAASVREKART--HPLRLAGLVGNRTSKR-----
CHLL_ZYGCR      AAPLNYADYCIIITDNGFDALFAANRIAASVREKART--HPLRLAGLVGNRTSKR-----
CHLL_STAPU      AAPLNYADYCIIITDNGFDALFAANRIAASVREKART--HPLRLAGLVGNRTSKR-----
CHLL_PLETE      AAPLNYADYCIIVTDNGFDALFAANRIVASVREKART--HPLRVAGLVGNRTDAR-----
CHLL_NOSS1      AAPLNYADYCMIVTDNGFDALFAANRIAASVREKART--HPLRLAGLIGNRTSKR-----
CHLL_TRIV2      AAPLNYADYCMIVTDNGFDALFAANRIAASVREKART--HPLRLAGLIGNRTSKR-----
CHLL_TRIEI      AAPLNYSDYCMIVTDNGFDALFAANRIAASVREKART--HTLRLAGLIGNRTSKR-----
CHLL_SYNY3      AAPLNYADYCLIVTDNGFDALFAAKRIAASVREKART--HSLRLAGLIGNRTSKR-----
CHLL_THEEB      AAPLNYADYCLIVTDNGFDALFAANRIAASVREKART--HPLRLAGLIGNRTNKR-----
CHLL_SYNP6      AAPLNYSDYCLIITDNGFDALFAANRIAASVREKART--HTLRLAGLIGNRTSKR-----
CHLL_SYNE7      AAPLNYSDYCLIITDNGFDALFAANRIAASVREKART--HTLRLAGLIGNRTSKR-----
CHLL_PORPU      AAPLNYADYCLIITDNGFDALFAANRIAASVREKART--HSLRLAGLVGNRTDKR-----
CHLL_PYRYE      AAPLNYADYCLIITDNGFDALFAANRIAASVREKART--HSLRLAGLVGNRTDKR-----
CHLL_SYNJB      AAPLNYADYCLIVTDNGFDALFAANRIAASVREKAKT--RKLRLAGLIGNRTSKR-----
CHLL_SYNJA      AAPLNYADYCVIVTDNGFDALFAANRIAASVREKAKT--RKLRLAGLIGNRTSKR-----
CHLL_GLOVI      AAPLNYADYCVIITDNGFDALFAANRIAASCREKART--HPLKLAGLVGNRTNKR-----
CHLL_TETOB      AAPLNYADYCIIVTDNGFDALFAANRITASVREKART--HPLRLAGLIGNRTKKR-----
CHLL_STIHE      AAPLNYADYCLIVTDNGFDALFAANRIAASVREKART--HPLRLAGLVANRTTKR-----
CHLL_CHLVU      AAPLNYADYCLIVTDNGFDALFAANRIVASVREKSKT--HPLRLAGLIGNRTSKR-----
CHLL_NEPOL      PAPLNYADYCLIVTDNGFDALFAANRIAASVREKART--HPLRLAGLVGNRTSKR-----
CHLL_CHLRE      AAPLNYADYCIIVTDNGFDALFAANRIAASVREKART--HPLRLAGLIGNRTSKR-----
CHLL_OLTVI      AAPLNYADYCLIVTDNGFDALFAANRIVASVREKART--HPLRLAGLIGNRTATR-----
CHLL_CYAPA      ASPLNYADYCLIVTDNGFDALFAANRIAASVREKART--HQLRLAGLIGNRTTKS-----
BCHL_HELMO      ATPLQYADLACVVSSNDFDALFAANRICESVVEKNMSG-YDVKMAGVIGNRCDQV-----
BCHL_RHOS4      AAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKN--YKVRLAGCVANRSRAT-----
BCHL_RHOS1      AAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKN--YKVRLAGCVANRSRAT-----
BCHL_RHOS5      AAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKN--YKVRLAGCVANRSRAT-----
BCHL_DINSH      AAPLQHADRALIVTANDFDSIYAMNRIIAAVQAKSKN--YSVRLAGCVANRSRET-----
BCHL_ROSDO      AAPLQHADRALIVTANDFDSIYAMNRIIAAVQAKSKN--YKVRLAGCVANRSRET-----
BCHL_JANSC      AAPLQHADRALIVTANDFDSIYAMNRIIAAVQAKSKN--YNVRLAGCVANRSKDT-----
BCHL_BRASB      AAPLQHADRALIVAANDFDSIFAMNRIVAAIQAKSRN--YPVRLGGVIANRSAAT-----
BCHL_BRASO      ASPLQHADRALIVAANDFDSIFAMNRIVAAIQAKSRN--YPVRLGGVIANRSAAT-----
BCHL_RHORT      ATPLQHAERALVVAANDFDSIFAANRIAAAIQAKAKN--YDVRLGGIIANRSVAT-----
BCHL_RHOPS      AAPLQHSERAMIVAANDFDSIFAANRIAAAIAAKSKN--YGVRLGGIIANRSKDT-----
BCHL_RHOP2      AAPLQHSERAMIVAANDFDSIFAANRIAAAIQAKSKN--YGVRLAGIIANRSRET-----
BCHL_RHOPB      AAPLQHSERAMIVAANDFDSIFAANRIAAAIAAKSKN--YGVRLGGIIANRSRET-----
BCHL_RHOPA      ASPLQHSERAMIVAANDFDSIFAANRIAAAIQAKSKN--YAVRLAGVIANRSRET-----
BCHL_RHOP5      AAPLQHSDRAMIVTANDFDSIFAANRIVAAITAKAKN--YGVRVGGIIANRSDAT-----
CHLL_PROM1      AAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKN--YKVRLGGVIANRSAEL-----
CHLL_PROMT      AAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKN--YKVRLGGVIANRSAEL-----
CHLL_PROMA      AAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKN--YKVRLGGVIANRSAEL-----
CHLL_PROM3      AAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKN--YKVRLGGVIANRSADL-----
CHLL_PROMM      AAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKN--YKVRLGGVIANRSAEL-----
CHLL_PROMS      AAPLQHANYCLIVTANDFDSIFAMNRIVSAIKAKAKN--YKVRLGGVVANRSKDT-----
CHLL_PROM0      AAPLQHANYCLIVTANDFDSIFAMNRIVSAIKAKAKN--YKVRLGGVVANRSKDT-----
CHLL_PROM2      AAPLQHANYCLIVTANDFDSIFAMNRIVSAIKAKAKN--YKVRLGGVVANRSKDT-----
CHLL_PROM9      AAPLQHANYCLIVTANDFDSIFAMNRIVSAIKAKAKN--YKVRLGGVVANRSKDT-----
CHLL_PROM5      AAPLQHANYCLIVTANDFDSIFAMNRIVSAIKAKAKN--YKVRLGGVVANRSKDT-----
CHLL_PROMP      AAPLQHANYCLIVTANDFDSIFAMNRIVSAIQAKAKN--YKVRLGGVVANRSKDT-----
CHLL_SYNS3      AAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKN--YKVRLGGVVANRSAET-----
CHLL_SYNS9      AAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKN--YKVRLGGVIANRSADT-----
CHLL_SYNSC      AAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKN--YKVRLGGVVANRSADT-----
CHLL_SYNPX      AAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKN--YKVRLGGVVANRSADT-----
CHLL_SYNPW      AAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKN--YKVRLGGVVANRSADT-----
CHLL_SYNR3      AAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKN--YKVRLGGVVANRSAET-----
BCHL_HALHL      AAPLQHADQALIVTANDFDSIFAMNRIAGAIQAKAKN--YKVRLGGVIANRSERT-----
                   *::::   ::: *.**:: * : :  :   *       :.:.* :.**         

BCHL_CHLCH      NMLDQFAEKVGTRLLAKVPYHEMIRKSRFAGKTLFAMEEAQT------------------
BCHL_CHLTE      NMLDQFAEQVGTRLLAKVPYHELIRKSRFAGKTLFAMDPNEP------------------
BCHL_CHLPD      NMLDQFAEKVGTRLLAKVPYHELIRKSRFAGKTLFAMEDTP-------------------
BCHL_PELLD      NMLDQFAEKVGTRLLAKVPYHELIRRSRFAGKTLFAMDDSEE------------------
BCHL_CHLAA      NLLDQFAEKVGTKVIGRVPYHDLIRRSRLAGKTLFEMEGPG-------------------
BCHL_ROSS1      TLLEQFAETVGTRIIGRVPYHDLIRRSRLMGKTLFEMEGPG-------------------
CHLL_MESVI      DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMVETE-------------------
CHLL_CHLAT      DLIDKYVEACPMPVLEVLPLIEDIRISRVKGKTLFEMAESE-------------------
CHLL_CHAVU      DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAETD-------------------
CHLL_MARPO      DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMVELQ-------------------
CHLL_PHYPA      DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMVESQ-------------------
CHLL_HUPLU      DLIDKYVEVCPMPILEILPLIEDIRVSRIKGKTLFEMVESQ-------------------
CHLL_ANTAG      DLINRYVEACPMPVLEVSLLIEDIRVSRVKGKTSFEMVEFQ-------------------
CHLL_ANGEV      DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAESQ-------------------
CHLL_PINKO      DLINKYVEACPMPVIEVLPIIEDIRVSRVKGKTLFEMVGSE-------------------
CHLL_PINTH      DLINKYVEACPMPVIEVLPIIEDIRVSRVKGKTLFEMVGFE-------------------
CHLL_CYCTA      DLIDGYVEVCPMPVIEVLPLIEDIRISRVKGKTLFEMVGSE-------------------
CHLL_ADICA      DLIDKYVEACPMPVLEVLPLVEDIRVSRVKGKTLFEMAEYQ-------------------
CHLL_CHAGL      DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAESQ-------------------
CHLL_ZYGCR      DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAESE-------------------
CHLL_STAPU      DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAESD-------------------
CHLL_PLETE      DLIDKYVEVCPMPVLEVLPLIEDIRISRVKGQTLFEIAETQ-------------------
CHLL_NOSS1      DLIEKYVEAVPMPVLEVLPLIEDIRVSRVKGKTLFEMAESD-------------------
CHLL_TRIV2      DLIEKYVEAVPMPVLEVLPLIEDIRVSRVKGKTLFEMAESD-------------------
CHLL_TRIEI      DLINKYVEAVPMPVLEVLPLIEDIRVSRVKGKTLFEMAETD-------------------
CHLL_SYNY3      DLIDKYIEAVPMPVLEILPLIEDIRVSRVKGKTLFEMAESD-------------------
CHLL_THEEB      DLIEKYVEAVPMPILEVLPLIEDIRVSRVKGKTLFEMAESD-------------------
CHLL_SYNP6      DLIDKYIEAVPMPVLEVLPLIEDIRISRVKGKTVFEMAETE-------------------
CHLL_SYNE7      DLIDKYIEAVPMPVLEVLPLIEDIRISRVKGKTVFEMAETE-------------------
CHLL_PORPU      DLIDKYIDCVPMPVLEVLPLIEDIRVSRVKGKTLFEMAESD-------------------
CHLL_PYRYE      DLIDKYIDCVPMPVLEVLPLIEDIRVSRVKGKTLFEMAEID-------------------
CHLL_SYNJB      DLIDKYVSAVPMPVIEVLPLIEDIRVSRVKGKTLFEMAETD-------------------
CHLL_SYNJA      DLIDQYVSAVPMPVLEVLPLVEDIRISRVKGKTLFEMAETD-------------------
CHLL_GLOVI      DLIDKYVEAVPMPVLEILPLIEDIRVSRVKGKTIFEMAETD-------------------
CHLL_TETOB      DLIEKYVETCPMPILEVLPLIEDIRVSRVKGKTLFEMTESE-------------------
CHLL_STIHE      DLIDKYVQVCPIPVLEVLPLLEDIRVSRVKGKTLFEMAESE-------------------
CHLL_CHLVU      DLIDKYVEVCPMPVIEVLPLIEDIRVSRVKGKTVFEMAETD-------------------
CHLL_NEPOL      DLIDKYVESCPMPVLEVLPLIEEIRVSRVKGKTLFEMTETD-------------------
CHLL_CHLRE      DLIDKYVEACPMPVLEVLPLIEEIRISRVKGKTLFEMSNKNNMTSAHMDGSKGDNSTVGV
CHLL_OLTVI      ELIDKYVEVCRMPVLEVLPLIEEIRISRVKGKTIFELEELE-------------------
CHLL_CYAPA      DLIEKYTENVPIPILQLLPLIEDIRISRVKGKTLFEMSESN-------------------
BCHL_HELMO      DLLETFTRRIETPLMGVVPRKEEIRQSRVKGYTLFELEEMG-------------------
BCHL_RHOS4      DEVDRFCKETNFRRLAHMPDLDAIRRSRLKKKTLFEMDEDQD------------------
BCHL_RHOS1      DEVDRFCKETNFRRLAHMPDLDAIRRSRLKKKTLFEMDEDQD------------------
BCHL_RHOS5      DEVDRFCEASDFRRLAHMPDLDAIRRSRLKKKTLFAMDEDPD------------------
BCHL_DINSH      DEVDRYCKTVGFNRIAHMPDLDAIRRSRLKKKTLFEMEDAED------------------
BCHL_ROSDO      DEVDRYCDTVGFNRIAHMPDLDAIRRSRLKKKTLFEMPDDEE------------------
BCHL_JANSC      DEVDRYCDVVGFKRIGHMPDVDAIRRSRLKKKTLFEMPDEED------------------
BCHL_BRASB      DQIDKFNERAGLKTVAHFPDLDVIRKSRLKKCTLFEMEPSPD------------------
BCHL_BRASO      DQIDKFNERIGMKTLAHFPDLDVIRKSRLKKCTLFEMEPSPD------------------
BCHL_RHORT      DQIERFNARSGMRTLAHFPDLDVIRRSRLCKSTLFEMEPSPE------------------
BCHL_RHOPS      DQIDKFGERTGIRRIAHLPDLDVIRKSRLKKMTLFEMDHTDE------------------
BCHL_RHOP2      DQIDKFGAATGIQRVAHLPDLDVIRKSRLKKMTLFEMDHTDE------------------
BCHL_RHOPB      DQIDKFGERTGIRRIAHLPDLDVIRKSRLKKMTLFEMDHTDE------------------
BCHL_RHOPA      DQIDKFGERTGIKRVAHLPDLDVIRKSRLKKMTLFEMDHTPE------------------
BCHL_RHOP5      DQIDKFSERTGVPRVAHFPALDIIRKSRLKKSTLFELDHSPE------------------
CHLL_PROM1      DQIEKFNERTGLKTMAHFRNVDAIRRSRLKKCTIFEMDSEEEG-----------------
CHLL_PROMT      DQIEKFNERTGLKTMAHFRNVDAIRRSRLKKCTIFEMDSEEEG-----------------
CHLL_PROMA      DQIEKFNEKTGLKTMAHFRNVDAIRRSRLKKCTIFEMDPEEEG-----------------
CHLL_PROM3      DQIEKFNKETGLKTMAHFKNVDAIRRSRLKKCTIFEMDSSEEG-----------------
CHLL_PROMM      DQIEKFNQQTGLKTMAHFKNVDAIRRSRLKKCTIFEMDSSDEG-----------------
CHLL_PROMS      DQIDKFNERTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTED------------------
CHLL_PROM0      DQIDKFNERTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTED------------------
CHLL_PROM2      DQIDKFNERTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTED------------------
CHLL_PROM9      DQIDKFNERTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTED------------------
CHLL_PROM5      DQIDKFNDRTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTED------------------
CHLL_PROMP      DQIDKFNNRTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTED------------------
CHLL_SYNS3      DQIDKFNERTGLRTMAHFKDVDAIRRSRLKKCTIFEMDDKDDG-----------------
CHLL_SYNS9      DQIDKFNERTGLRTMAHFKDVDAIRRSRLKKCTIFEMDDDDDA-----------------
CHLL_SYNSC      DQIDKFNERTGLRTMAHFRDVDAIRRSRLKKCTIFEMDDADEA-----------------
CHLL_SYNPX      DQIDKFNERTGLRTMAHFKDVDAIRRSRLKKCTIFEMDDEDEA-----------------
CHLL_SYNPW      DQIDKFNERTGLRTMAHFKDVDAIRRSRLKKCTIFEMDDDDEA-----------------
CHLL_SYNR3      DQIDKFNERTGLRTMAHFRDVDAIRRSRLKKCTIFEMDKDEEG-----------------
BCHL_HALHL      DQIDRINERIGLRTLAHVPNYDVVRRSRLHKSTLFELEEQSEE-----------------
                  ::          :      : :* **.   * * :                       

BCHL_CHLCH      ----EFPECLAPYNEIADALMQEHPIASVPVPIGDRELFKLVNGWQ--------------
BCHL_CHLTE      ----ELAECLAPYNEIADQILSEKPIASVPKPIGDREIFDIVGGWQ--------------
BCHL_CHLPD      ----GKDDCLIPYNEIADFLIQENPLASVPVPIGDREIFDMVGGWQ--------------
BCHL_PELLD      ----GKEECLQPYLQIAEDLLSEAPMSSVPVPIGDREIFEIVGGWQ--------------
BCHL_CHLAA      -----KEECTRPFEEMAEYLLAQ-PQATVPQPYHDRAIFEAIGGWR--------------
BCHL_ROSS1      -----KEECTAPFLEMAEELLNR-PRSTVPKPLGDREIFNVIGGWR--------------
CHLL_MESVI      ---KSLNYVCEFYLNIADQLLAR-PEGVVPNEVPDRELFSLLSDFYLNPVNTSNESTNSS
CHLL_CHLAT      ---PSLDYVCEFYLNIADQLLAR-PEGVVPKEVPDRELFSLLSDFYLNPANNASSIEQPT
CHLL_CHAVU      ---SSLEYVCDYYLNIADQILSQ-PEGIVPKEIPDRELFTLLSDFYLNININSNN-----
CHLL_MARPO      ---PSLKYVCDFYLNIADQILSK-PEGIIPKEVPDRELFSLLSDFYLNPVNTVNEK----
CHLL_PHYPA      ---PSLNYVCDFYLNIADQILSQ-PEGIVPKEVPDRELFSLLSDFYLNPVDKTKDKKENK
CHLL_HUPLU      ---PYLNYVCDFYLNTADQILSK-PEGIIPKEISDRELFSLLSDFYLNPVGNEEQE----
CHLL_ANTAG      ---PFLNYVCEFYLNIADQILSQ-PEGVIPKEIPDRELFSLLSDFYLNPTNNERENK---
CHLL_ANGEV      ---PTLNYVCEFYLNIADQILSQ-PEGVVPKEIPDRELFSLLSDFYLNPINSGKNEN---
CHLL_PINKO      ---PSLNYVCNYYLGIADQILSQ-PEGIVPKEIPDRELFSLLSDLYLNPIGGGGQKKKI-
CHLL_PINTH      ---PSLNYVCNYYLGIADQILSQ-PEGIVPKEIPDRELFSLLSDLYLNPIGGGGQKKNN-
CHLL_CYCTA      ---PSLNYVCEYYLNIADQILSQ-PEGIVPKEIPDRKFFSLLSDSYLSPINDGKQGKN--
CHLL_ADICA      ---PNLNYVCDFYLNIADQILSE-PEGVVPREIPDRELFSLLSDFYLNSTFTNESDGG--
CHLL_CHAGL      ---ESLNYVCDFYLNIADQILSC-PEGVVPKEVPDRELFSLLSDFYLNPTLSEKENTL--
CHLL_ZYGCR      ---PSLNYVCEFYLNIADQILSQ-PEGVVPKEVPDRELFSLLSDFYLNPSSSRSDMQL--
CHLL_STAPU      ---PSQNYVCDFYLNIADQILSK-SEGVVPREVPDRELFSLLSDFYLNQPSS-STNNS--
CHLL_PLETE      ---TAVSYVCDYFLNIADQLLSQ-PEGVVPNELGDRELFSLLSDFYLNPTSNSEKNANIS
CHLL_NOSS1      ---PSLNYVCDYYLSIADQILAR-PEGVVPNDAPDRELFSLLSDFYLNPGKPQ--VPN--
CHLL_TRIV2      ---PSLNYVCDYYLSIADQILAR-PEGVVPNDAPDRELFSLLSDFYLNPGKPQ--VPN--
CHLL_TRIEI      ---PSLQYVCNYYLNIADQILAL-PEGVVPSESPDRDLFALLSDFYLNPSKSH--VMS--
CHLL_SYNY3      ---PSLNYVCDYYLNIADQILSQ-PEGVVPKDAQDRDLFSLLSDFYLNPTQP----AS--
CHLL_THEEB      ---PSLNDVCDYYLNIADQILAR-PEGVVPKDVPDRDLFALLSDFYLNPQGS--------
CHLL_SYNP6      ---PSLLTVCDYYLNIADQILAR-PEGVVPKDAADRDLFSLLSDFYLNPPKQ----TT--
CHLL_SYNE7      ---PSLLTVCDYYLNIADQILAR-PEGVVPKDAADRDLFSLLSDFYLNPPKQ----TT--
CHLL_PORPU      ---TNLAYVCDYYLNIADQLIAR-PEGVVPKEAADRELFSLLSDFYLNPKSNTTKSTA--
CHLL_PYRYE      ---KDLAYVCDYYLNIADQLITR-PEGVVPKESPDRELFSLLSDFYLNPKSKVGQEKV--
CHLL_SYNJB      ---PSLEPVCQYYLNIADELLAR-PEGIVPQPAEDRELFALLSDFYNTPARQ--------
CHLL_SYNJA      ---PSLEPVCQYYLNIADELLAR-PEGIVPRPAEDRELFALLSDFYKTPVRE--------
CHLL_GLOVI      ---PSLEPVCQYYLNIADHLLAC-PEGVVPQECPDRALFELLSDFYSRTPVP--------
CHLL_TETOB      ---PTLQFVCDFYLNIADQLLTQ-PEGVIPRELGDRELFNLLSNFYLNSSNS--------
CHLL_STIHE      ---PDLSFVLDYYLNIADQLLTE-PEGVVPRELGDRELFSLLSDFYLNIENQ--------
CHLL_CHLVU      ---QKLNYICDFYLNIADQLLAS-PEGVIPLELEDRELFTLLSTFYLTVTPQNQGETQST
CHLL_NEPOL      ---SSLNYVCQYYLNIADQLLAE-PEGVVPKEVADRELFSLLSDFYHREASFTPQ-----
CHLL_CHLRE      SETPSEDYICNFYLNIADQLLTE-PEGVIPRELADKELFTLLSDFYLKI-----------
CHLL_OLTVI      ---PNLKSIGEYYLNIADQLLAQ-PEGIVPQELADRDLFTLLSSFYLSDQQTEKAYSSIQ
CHLL_CYAPA      ---PELSPICDYYLNIADQILAK-PEGIIPNEVLDRDLFTLLSDFYLNMDSS--------
BCHL_HELMO      ---EPVQDMTAEFRKMARYLLSK-PDGVIPNAVGTREMFELFKGEDMPWKGSNG------
BCHL_RHOS4      -----VLAARAEYIRLAESLWRGLDP-IDPHSLPDRDIFELLGFD---------------
BCHL_RHOS1      -----VLAARAEYIRLAESLWRGLDP-IDPHSLPDRDIFELLGFD---------------
BCHL_RHOS5      -----VLVARAEYLRLAQSLWDGLPP-MSPHSLPDREIFELLGFD---------------
BCHL_DINSH      -----VVQVRKEYIRLAETLWNGTEP-LAPAPLPDREIFELLGFD---------------
BCHL_ROSDO      -----IVQVRKEYIRLAETLWNGTEP-LAPAPLPDRDIFELLGFD---------------
BCHL_JANSC      -----IVQCRAEYIRLAEKLYAGTDP-LAPAPLEDRDIFELLGFD---------------
BCHL_BRASB      -----VERAQNEYLRLAASLLAGVEP-MQAVPLKDRDIFDLLGFD---------------
BCHL_BRASO      -----VERAQNEYLRLAASLLAGVEP-IHAVPLKDRDIFDLLGFD---------------
BCHL_RHORT      -----LAAVQQEYLRLAEALWEGVEP-LTATPLIDREIFDLLGFD---------------
BCHL_RHOPS      -----ILAVQQEYLRLATEMWEAKEPPIEGKPLKDRDIFDLLGFD---------------
BCHL_RHOP2      -----ILAVQQEYLRLATEMWEAKTPPVQGKPLKDRDIFDLLGFD---------------
BCHL_RHOPB      -----ILAVQQEYLRLATEMLEGKEPPIDGKPLKDRDIFDLLGFD---------------
BCHL_RHOPA      -----IEAVQNEYLRLATELWEAKEPPVQGKPLKDRDIFDLLGFD---------------
BCHL_RHOP5      -----LAKVQEEYMRLATELWEGKQPPCEGKALKDREIFDLLGFD---------------
CHLL_PROM1      -----VVEVQNEYLSLAQKMIDNVEP-LEAEPLKDREIFDLLGFD---------------
CHLL_PROMT      -----VVEVQNEYLSLAQKMIDNVEP-LEAEPLKDREIFDLLGFD---------------
CHLL_PROMA      -----VLEVQNEYLSLAKKMIDNVEP-LEAEPLKDREIFDLLGFD---------------
CHLL_PROM3      -----VLECQNEYLALAQKMIDKVEP-LEAEPLKDREIFDLLGFD---------------
CHLL_PROMM      -----VMECQNEYLSLAQKMLDNVEP-LEAEPLKDREIFDLLGFD---------------
CHLL_PROMS      -----VIEVQNEYLSLAKNMLENVEP-LEGNPLKDREIFDLLGFD---------------
CHLL_PROM0      -----VIEVQNEYLSLAKNMLEKVEP-LEGNPLKDREIFDLLGFD---------------
CHLL_PROM2      -----VIEVQNEYLSLAKNMLENVEP-LEGNPLKDREIFDLLGFD---------------
CHLL_PROM9      -----VIEVQNEYLSLAKNMLENVEP-LEGNPLKDREIFDLLGFD---------------
CHLL_PROM5      -----VIEVQNEYLSLAKNMLENVEP-LEGTPLKDREIFDLLGFD---------------
CHLL_PROMP      -----VVEVQNEYLSLAKNMLDNVEP-LEGTPLKDREIFDLLGFD---------------
CHLL_SYNS3      -----VKAVQDEYIRLASNMLNNVEP-LEAVSLKDREIFDLLGFD---------------
CHLL_SYNS9      -----VKAVKNEYLRLAQNMLDNVEP-LEAVSLKDREIFDLLGFD---------------
CHLL_SYNSC      -----VQAVQNEYLRLAQNMLDKVEP-LEATSLKDREIFDLLGFD---------------
CHLL_SYNPX      -----VQAVRSEYLRLAQNMLDKVEP-LEATSLKDREIFDLLGFD---------------
CHLL_SYNPW      -----VQAVREEYLRLAQNMLDNVEP-LEATSLKDREIFDLLGFD---------------
CHLL_SYNR3      -----VEAVQNEYLLLAQNMLDHVEP-LEAESLKDREIFDLLGFD---------------
BCHL_HALHL      -----LERVRDEYLSLAAALWNGVDP-LSPSPLKDREVFDLLGFD---------------
                            :   *  :               : .*  .                  

BCHL_CHLCH      ------------------------------
BCHL_CHLTE      ------------------------------
BCHL_CHLPD      ------------------------------
BCHL_PELLD      ------------------------------
BCHL_CHLAA      ------------------------------
BCHL_ROSS1      ------------------------------
CHLL_MESVI      I---------------EANQEVESSFLII-
CHLL_CHLAT      D---------------SIVQSEQEPFLII-
CHLL_CHAVU      ------------------LEKNESSFLII-
CHLL_MARPO      ------------------NKPNLIDFMII-
CHLL_PHYPA      ----------------KEDKENSADFTWL-
CHLL_HUPLU      ------------------NKENLLDSVVLI
CHLL_ANTAG      ------------------NQETLLDFMII-
CHLL_ANGEV      ------------------IENNLHDFMII-
CHLL_PINKO      -------------------QENFLGFTRI-
CHLL_PINTH      -------------------KENLLGFTRI-
CHLL_CYCTA      -------------------QENLLGFTMV-
CHLL_ADICA      ----------------YDHQDVPLDFTII-
CHLL_CHAGL      -------------------SPSSLDFMMV-
CHLL_ZYGCR      -------------------EDNSLDFVMV-
CHLL_STAPU      -------------------ETNNLDFLMV-
CHLL_PLETE      -----------------GLEPDSLDFLIV-
CHLL_NOSS1      -------------------PEEELDLMIV-
CHLL_TRIV2      -------------------PEEELDLMIV-
CHLL_TRIEI      -------------------EDEELDLMMV-
CHLL_SYNY3      -------------------QTKELDLMMV-
CHLL_THEEB      ----------------------ERSLAAV-
CHLL_SYNP6      -------------------EAIAPEALLV-
CHLL_SYNE7      -------------------EAIAPEALLV-
CHLL_PORPU      -------------------DEEELDLMMV-
CHLL_PYRYE      -------------------DQEELDLMIV-
CHLL_SYNJB      -------------------------LALV-
CHLL_SYNJA      -------------------------PALV-
CHLL_GLOVI      -------------------------A----
CHLL_TETOB      ---------------TNTTLKNETNLFDLV
CHLL_STIHE      ---------------TSVNKTEKLDFFLV-
CHLL_CHLVU      IST-----------PLTSNSASELDFILV-
CHLL_NEPOL      -------------------EGVVDSFLLV-
CHLL_CHLRE      ------------------------------
CHLL_OLTVI      HVHGSVGEGCSAQNSEQNQTANDYSFEFI-
CHLL_CYAPA      ---------------------ESSNLTLV-
BCHL_HELMO      -------------------KTGASTPSAQ-
BCHL_RHOS4      ------------------------------
BCHL_RHOS1      ------------------------------
BCHL_RHOS5      ------------------------------
BCHL_DINSH      ------------------------------
BCHL_ROSDO      ------------------------------
BCHL_JANSC      ------------------------------
BCHL_BRASB      ------------------------------
BCHL_BRASO      ------------------------------
BCHL_RHORT      ------------------------------
BCHL_RHOPS      ------------------------------
BCHL_RHOP2      ------------------------------
BCHL_RHOPB      ------------------------------
BCHL_RHOPA      ------------------------------
BCHL_RHOP5      ------------------------------
CHLL_PROM1      ------------------------------
CHLL_PROMT      ------------------------------
CHLL_PROMA      ------------------------------
CHLL_PROM3      ------------------------------
CHLL_PROMM      ------------------------------
CHLL_PROMS      ------------------------------
CHLL_PROM0      ------------------------------
CHLL_PROM2      ------------------------------
CHLL_PROM9      ------------------------------
CHLL_PROM5      ------------------------------
CHLL_PROMP      ------------------------------
CHLL_SYNS3      ------------------------------
CHLL_SYNS9      ------------------------------
CHLL_SYNSC      ------------------------------
CHLL_SYNPX      ------------------------------
CHLL_SYNPW      ------------------------------
CHLL_SYNR3      ------------------------------
BCHL_HALHL      ------------------------------