CLUSTAL format seed alignment for MF_00356

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DPO3_MYCGE      -MVFNLENEKDKKVLALSNFLIDNNILDHNELNSLIERIESIYFNKYIEEKVFLFAITIS
DPO3_MYCPN      -MVFDTETEKGKRIWALSQFLVKKNILDHNELHQLNNRIELVYLENDRENALFLVALTLK
DPO3_UREPA      METKNALFKKIVKISDQLLNKISIKKLTKDKKNNLFVYFDEFVDVTIIDELHQLSKTTLM
DPO3_BACSU      ------MEQLSVNRRQFQILLQQINMTDDTF-MTYFEHGEIKKLTIHKASKSWHFHFQFK
DPO3_BACHD      -----MNEEQRVRQERFKLLMEQLLIPEDVT-ANHLKDGKIEKLTIKKDERRWHFQLSIP
DPO3_STAAW      ----------MTEQQKFKVLADQIKISNQLD-AEILNSGELTRIDVSNKNRTWEFHITLP
DPO3_LACLA      ------------MENLFEKLMEQIKMPPNLRRSSQFEHADIENVEVHTASKLWHFQLIFD
DPO3_STRP1      ------------MSDLFAKLMDQIEMPLDMRRSSAFSSADIIEVKVHSVSRLWEFHFAFA
DPO3_THEMA      --------------------------------------MKKIENLKWKNVSFKSLEIDPD
DPO3_MYCPU      ----------------MQESFLNFCQEINFDIPEYLKNTKIANPYHDEEKSFFSCEIDFL
                                                       .                    

DPO3_MYCGE      RPLTIDIWNALYEGFNELNEGFKADNESFKLTITFKENEPFFKSKNSFSSVTIAIIKDYF
DPO3_MYCPN      KPLTIDIWNALYEGFQ--------DAEGAELRITFQEDATFFKDGSTKSSVTLAIIKDYF
DPO3_UREPA      HDLQIWYINNLKEVDHKKILTFFKKISEQNANLIFLEQINDLNTKIEYNSNLNSLILKIN
DPO3_BACSU      SLLPFQIYDTLTTRLTQSFAHIA-KVTSSIEVQDAEVSESIVQDYWSRCIEELQGISPPI
DPO3_BACHD      TVLPASIYELLADRLVQTFSHIA-KVSFQIQYGQPDLSEQVWQSYWPLIVAKLTNISQPL
DPO3_STAAW      QFLAHEDYLLFINAIEQEFKDIA-NVTCRFTVTNGTNQDEHAIKYFGHCIDQ-TALSPKV
DPO3_LACLA      EILPIDTYKLLTELTETAFSTIA-RTEISVSSRNQNIDEQNLNDYYQYALTLPELCDSAF
DPO3_STRP1      AVLPIATYRELHDRLIRTFEAADIKVTFDIQAAQVDYSDDLLQAYYQEAFEHAPCNSASF
DPO3_THEMA      AGVVLVSVEKFSEEIEDLVRLLEKKTRFRVIVNGVQKSNGDLRGKILSLLNG--------
DPO3_MYCPU      ETPKFEDFKSFYLKTKNFLNQLVKEQKLLFKIENIFYEKSEIKKYLDWIAEH-FFKNFDF
                          :                          .                      

DPO3_MYCGE      HSFFSKDKKYKILIEQELSNPNFLSYENDELKAQCQTKELTEWLVQKSKSFIFWMNNAGF
DPO3_MYCPN      KSFFGKDKKYRILLEQELTHPNFLSYSNHELKANCQSQELDQWLIEQRQAFIKWMHQAGF
DPO3_UREPA      DKLIYDHFIANKLEILNILKVWSLPYSNFEIHFENLSSLLNEKHEQAVNEIISHHIQQQK
DPO3_BACSU      ISLLNQQKPKLKGNKLIVKTKTDTEAAALKNKYSSMIQAEYRQFGFPDLQLDAEIFVSEQ
DPO3_BACHD      KEMLEKQTPRFDGKRLVIQVGNETEAIALKRKLTEPLQQAVQSFGFPAVQLDAEVKESKQ
DPO3_STAAW      KGQLKQKKLIMSGKVLKVMVSNDIERNHFDKACNGSLIKAFRNCGFDIDKIIFETNDNDQ
DPO3_LACLA      SSIFKKYHLEKEEEKIHLMVEDNPQMDFFVEKYFPILEEKFKSFGFGEVRITPLVDQELT
DPO3_STRP1      KSSFSKLKVTYEDDKLIIAAPGFVNNDHFRNNHLPNLVKQLEAFGFGILTIDMVSDQEMT
DPO3_THEMA      NVPY-IKDVVFEGNRLILKVLGDFARDRIASKLRSTKKQLDELLPPGTEIMLEVVEPP--
DPO3_MYCPU      KNTFRIDDLKVNLDGKIFLTAHSKHSFDLYKDFVEFANKKMQSFGFENFLLKLELNQIEI
                                 .                       .        :         

DPO3_MYCGE      ------------------------------------------------------------
DPO3_MYCPN      ------------------------------------------------------------
DPO3_UREPA      ------------------------------------------------------------
DPO3_BACSU      E-----------------------------------------------------------
DPO3_BACHD      A-----------------------------------------------------------
DPO3_STAAW      EQ----------------------------------------------------------
DPO3_LACLA      ETQAAAHAEKVAARLAAQTAEQAQISEIKKQRSEERESKNTREAKPEFVETALSDGIFFG
DPO3_STRP1      EHLT--------------------------------------------------------
DPO3_THEMA      ------------------------------------------------------------
DPO3_MYCPU      TN----------------------------------------------------------
                                                                            

DPO3_MYCGE      ------------------------------------------------------------
DPO3_MYCPN      ------------------------------------------------------------
DPO3_UREPA      ------------------------------------------------------------
DPO3_BACSU      ------------------------------------------------------------
DPO3_BACHD      ------------------------------------------------------------
DPO3_STAAW      ------------------------------------------------------------
DPO3_LACLA      RKISGQSPITSMSFIAGEGFGVIFEGLVFEAAHREFTGKESGKVNHILELKMADETSTFM
DPO3_STRP1      ------------------------------------------------------------
DPO3_THEMA      ------------------------------------------------------------
DPO3_MYCPU      ------------------------------------------------------------
                                                                            

DPO3_MYCGE      -----------------------------------------------------KNFNFIA
DPO3_MYCPN      -----------------------------------------------------THFGFVS
DPO3_UREPA      -----------------------------------------------------HLEQQIS
DPO3_BACSU      ---------------------------------------------------VQKFREQKL
DPO3_BACHD      ---------------------------------------------------FEKFVEQRK
DPO3_STAAW      --------------------------------------------------NLASLEAHIQ
DPO3_LACLA      ISKWGRKDEEIAQFDQIVSTVKAMNEKIIADRTDGEDNFTDSLSDALWLRVQGNIEHDKY
DPO3_STRP1      ------------------------------------KNFVSSRQALVKKAVQDNLEAQKS
DPO3_THEMA      -------------------------------------------------------EDLLK
DPO3_MYCPU      --------------------------------------------------------NQPL
                                                                            

DPO3_MYCGE      LYPIDKNESKLKVKAVTVSQYDKQFETKVFATEFIPIHKINQQ-----------------
DPO3_MYCPN      LFNP-PAEKQLKVKSMKVSKYDKQFETEVFSTEFVPIHKINQQ-----------------
DPO3_UREPA      QQQN--FYNNQKANFNYYKNPSNKTITKLIDINPLMNNAKIRA-----------------
DPO3_BACSU      AEDQERAMQALIEMEKKDKESDEDQAPSG----PLVIGYQIKDNEEIRTLDSIMDEE---
DPO3_BACHD      QEDHSKVVEAILEKKKLEQQVEKKMKEE-----KLTIGYPIKD--EPVPLETIVEEE---
DPO3_STAAW      EEDEQSARLATEKLEKMKAEKAKQQDNNESAVDKCQIGKPIQI-ENIKPIESIIEEE---
DPO3_LACLA      KDDLVLTANAVVEIKPKPTIDRVALQIKAVKSDKIQLGREIKNNEPVTPMRSVSEFSTNG
DPO3_STRP1      LEAMMPPVEEATPAPKFDYKERAAKRQAGFEKATITPMIEIETEE---------------
DPO3_THEMA      KEVPQPEKREEPKGEELKIEDENHIFGQKPRKIVFTPSKIFEYN----------------
DPO3_MYCPU      VSSINSQVKTQASSENQSFKKSNFYNKKR--HIQLSLKELIKTQE---------------
                                                         .                  

DPO3_MYCGE      ---IDDVKIIGQIFELKTHESLTG-KKTLNIYVTDFQLGGSLILKWSYT--DEKKIEGIT
DPO3_MYCPN      ---MDEIKLMGQIFELKDFPGYNNLRNTLNIYVTDFQLGGSLILKWFYK--DPKTIEGIK
DPO3_UREPA      ---YVFLKKIDILKSGAIAYKLNVIDDSETLTIMTYLPSGEHPLKKFLD--ELKIDQLIE
DPO3_BACSU      ----RRITVQGYVFDVETRELKSG-RTLCIFKITDYTNSILIKMFAR-EKEDAALMKSLK
DPO3_BACHD      ----RRITVQGYIFAAETKELRSG-RTLLTFKITDYTDSILVKMFSR-DKEDIPLLQAVK
DPO3_STAAW      ----FKVAIEGVIFDINLKELKSG-RHIVEIKVTDYTDSLVLKMFTRKNKDDLEHFKALS
DPO3_LACLA      PVVFEGYVFKGELREIKSRKTGNI-SYLLEFEMTDYTSSFYVQKWLR-GEEEIQLAKQIK
DPO3_STRP1      ----NRIVFEGMVFDVERKTTRTG-RHIINFKMTDYTSSFALQKWAK-DDEELRKFDMIA
DPO3_THEMA      ----KKTSVKGKIFKIEKIEGK---RTVLLIYLTDGEDSLICKVFND----VEKVEGKVS
DPO3_MYCPU      ----MFVSVVGMVFKKEIITTNSK-TKIFKISITDFQEATRAQKFSYLEK-DQEIFDSIQ
                          . :                 : :     .                   : 

DPO3_MYCGE      IGNWIKAHIQVERDPNTQILYGIVREINPVEIPNNYKRLDLSKQKRVELVFHTKMTAFDG
DPO3_MYCPN      IGTWVKATVKVERDAKTQLLQGIIKEISPIETPAYYRRPDQDKQKRVELVFHTKMSAFDG
DPO3_UREPA      AEIDIVLDNMSKSGQ-------VPIGKIKKICCVEDKHVKKQITPRLELNFHTKMSSLDA
DPO3_BACSU      KGMWVKARGSIQNDT-FVRDLVMIANDVNEIKAKTREDSAPEGEKRVELHLHSPMSQMDA
DPO3_BACHD      KGMWVKVRGGVQNDT-FVRDLVMIANDVNEVSGKETKDEAPDDEKRVELHLHTAMSQMDG
DPO3_STAAW      VGKWVRAQGRIEEDT-FIRDLVMMMSDIEEIKKATKKDKAE--EKRVEFHLHTAMSQMDG
DPO3_LACLA      AGLWCRVRGNVQRDN-FKNDLVLQLTDLIEIPTQNVREDKSD-EKRVEFHAHTNMSQMDA
DPO3_STRP1      KGAWLRVQGNIETNP-FTKSLTMNVQQVKEIVRHERKDLMPEGQKRVELHAHTNMSTMDA
DPO3_THEMA      VGDVIVATGDLLLE---NGEPTLYVKGITKLPEAKRMDKSP--VKRVELHAHTKFSDQDA
DPO3_MYCPU      INDWVNVCGEIQLEK-MSLKQFIKIEKIEKIRSPIKDRQDNEKEKRIELSFRSKMSTMDG
                                      :                      *:*:  :: ::  *.

DPO3_MYCGE      INDIEEYAQFAKERGWKAITVTDKDNIHIYPKFYEVAKKY-DLKAIYGLEFNLTDDHIKI
DPO3_MYCPN      INSVQEYAQFAKERDWKTIAVTDKDNIHIYPTLYEVAKKY-GLKAIYGLECNLIDDHIKI
DPO3_UREPA      IISTQELIDFAVKNQLKTIGITDRNVVQAYPEIAKFSKKQ-DLKIIYGLETEELEDQIPL
DPO3_BACSU      VTGIGKLVEQAKKWGHEAIALTDHAVVQSFPDAYSAAKKH-GIKMIYGMEANLVDDGVPI
DPO3_BACHD      ISSAGAYVTQASKWGHKAIAITDHGVVQAFPEAYGASQKH-GIKVIYGVEANLVDDGVPI
DPO3_STAAW      IPNIGAYVKQAADWGHPAIAVTDHNVVQAFPDAHAAAEKH-GIKMIYGMEGMLVDDGVPI
DPO3_LACLA      IPSASSLVAQAAKWGHKAIAITDHGGLQSFPEAHSAGKKN-GVKIIYGVEANLVEDKIPI
DPO3_STRP1      LPTVESLIDTAAKWGHKAIAITDHANVQSFPHGYHRARKA-GIKAIFGLEANIVEDKVPI
DPO3_THEMA      ITDVNEYVKRAKEWGFPAIALTDHGNVQAIPYFYDAAKEA-GIKPIFGIEAYLVSDVEPV
DPO3_MYCPU      ILSPLDIVKQAKKFNHSSIAILDHNSVQAFPDFHNLTYKDKDFKVIYGMTLSVISKRNKI
                :         * .    :* : *:  ::  *       :  ..* *:*:     ..   :

DPO3_MYCGE      VHNPDN-----TKLSDATFVIFDIETTGLHGRYDDVIEFSARKIKNNS-EIDHQQFFLKI
DPO3_MYCPN      VSNPDK-----TKLKDATFVIFDIETTGLHGRYDSVIEFAGIKVKHNR-EVERMQFFLKI
DPO3_UREPA      VLNVRD-----QNLDNATYVIFDIETTGLFPNFDEIIEFGAVIMQNNKQIGEKIQFFIKP
DPO3_BACSU      AYNAAH-----RLLEEETYVVFDVETTGLSAVYDTIIELAAVKVKGGE-IIDKFEAFANP
DPO3_BACHD      AYNEAH-----IPLLDSEFVVFDVETTGLSAVYNKIIELAAVKVKNGE-IIDRFERFADP
DPO3_STAAW      AYKPQD-----VVLKDATYVVFDVETTGLSNQYDKIIELAAVKVHNGE-IIDKFERFSNP
DPO3_LACLA      VYNETD-----VDMYESTYVVFDVETTGLSAVHNDLIQIAATKMHKGN-PIDEFDEFINP
DPO3_STRP1      SYEPVD-----MDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGN-IVEQFDEFIDP
DPO3_THEMA      IRNLSDD----STFGDATFVVLDFETTGLDPQVDEIIEIGAVKIQGGQ-IVDEYHTLIKP
DPO3_MYCPU      FVEPLKDKFFDYKILDQEYVVYDIETTGLSPMLNELIQFGASVIKNGR-IIETHHFFIKP
                  :  .       : :  :*: *.*****    : :*::..  :  .    :  . : . 

DPO3_MYCGE      DKPIPKTITEITKITDEMLEGGIDQQQGLEKIRNYLDDCVMVAHNGINFDLPFLQTQFEK
DPO3_MYCPN      DGPLPAAVTEITKITQAQLEDGMEQQAGLEKLRAWLDGCVMVAHNGLSFDLPFLQTQFEK
DPO3_UREPA      IQQINENVTNLTNISQEMVNNAIDEKTALLKIKEIFDDHILVAHNGINFDINFINQRLLK
DPO3_BACSU      HRPLSATIIELTGITDDMLQDAPDVVDVIRDFREWIGDDILVAHNASFDMGFLNVAYKKL
DPO3_BACHD      HEPLTNTIIELTGITDDMLKGQPEVEQVLNEFHAFIGDAVLVAHNASFDMGFLNTGFQKM
DPO3_STAAW      HERLSETIINLTHITDDMLVDAPEIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERL
DPO3_LACLA      GYRLSEFTTELTGITDDHVKNAKPLYEVLTKFQKFCEGTILVAHNATFDVGFMNMNYSRN
DPO3_STRP1      GHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNASFDVGFMNANYERH
DPO3_THEMA      SREISRKSSEITGITQEMLENKRSIEEVLPEFLGFLEDSIIVAHNANFDYRFLRLWIKKV
DPO3_MYCPU      KSKLDSFTTKLTGITQEHLEKGYELQEALEKISSIFKARIMVAHNAAFDHNFLKQKFIDN
                   :     ::* *::  :         :  :       ::****.      :       

DPO3_MYCGE      YNIKPLTNPLIDTLCLSWALNPLFSSHTLSNICSKLKLEFDDERLHRAEYDTEALKKVFF
DPO3_MYCPN      YNIAPLTNPLIDTLALSWALNPGFASHTLSNICAKLKFDFDDERLHRADYDTQALKKVFD
DPO3_UREPA      WGLEPLKNPSIDTLMISRAINP-FKSHRLGAICKKYEVDYNDESAHRADYDAIVLADVFK
DPO3_BACSU      LEVEKAKNPVIDTLELGRFLYPEFKNHRLNTLCKKFDI--ELTQHHRAIYDTEATAYLLL
DPO3_BACHD      -GLGEAKNPVIDTLELGRFLYPTLKNHRLNTLCKKFDI--ELVSHHRAIYDAEATGHLLW
DPO3_STAAW      -GFGPSTNGVIDTLELSRTINTEYGKHGLNFLAKKYGV--ELTQHHRAIYDTEATAYIFI
DPO3_LACLA      -GLPIITQPVVDTLEFARNLYPEMKRFGLGQLTKKFQI--GLEHHHMANFDAEATGRLLF
DPO3_STRP1      -DLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQV--SLDHHHMANYDAEATGRLLF
DPO3_THEMA      -MGLDWERPYIDTLALAKSLL-KLRSYSLDSVVEKLGL--GPFRHHRALDDARVTAQVFL
DPO3_MYCPU      -NIEFEEMISIDTLNLAKVLNPIYRSYRLGEVASKLSVVYDPSIAHRADYDSSVLTNIFI
                          :*** :.  :      . *. :  :  .       * *  *: .   :: 

DPO3_MYCGE      YFKKQLKEMGINTLTEIDQNLNKKCQIDLMKRVFTNTAIVYVKNQRGFQNLYEMLSIALT
DPO3_MYCPN      YFKEQVELMGITNLEQLDQELNQQCHFELLKRTFTNTGIIYIKSQSGFAKLYELLSIALT
DPO3_UREPA      VMKNNL--FNDFGITNLSEINTKLQTTMLKNRSFGNWINLYIKNQANVKDMYELVSISHT
DPO3_BACSU      KMLKDAA-EKG--IQYHDELNENMGQSNAYQRSRPYHATLLAVNSTGLKNLFKLVSLSHI
DPO3_BACHD      RMVKDAT-ERD--ILYHDQLNDNMGEG-NFHRQRPSHCILLAQTQEGLKNLYKLVSMAHV
DPO3_STAAW      KMVQQMK-ELG--VLNHNEINKKLSNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLV
DPO3_LACLA      VFLEELR-TRNTGWTSLLELNDKLVSEDSYKKVRPKHVTLYAKTQEGLKNLFKIVSFGNV
DPO3_STRP1      IFLKDAR-EKH-GIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFKLVSLSNI
DPO3_THEMA      RFVEMMK-KIG---ITKLSEMEKLKDTIDYTALKPFHCTILVQNKKGLKNLYKLVSDSYI
DPO3_MYCPU      LQMSHLK-EKG---INLFKELNSLSSEKFYSKMFAKDISIIAKNQAGLKELFKINSDVLT
                   .              .   .                :   .. .. .:::: *    

DPO3_MYCGE      DHNANRPLVLASSLAKFRKSFLLTENPVQGDIFKAALTKPIN-ELEKAIEKVDFVLISQP
DPO3_MYCPN      DNNATRPLVLTSTLQKFAKSFVITDNPVQGDIFKAALTKPLK-ELEAAIKRVDFVLIAPP
DPO3_UREPA      DMYYTRPTITTSFLANKKDKLIISNSIHESDLINALYSKNDE-EIKRLIQRYDFITLPSL
DPO3_BACSU      HYFYRVPRIPRSQLEKYREGLLIGSACDRGEVFEGMMQKSPE-EVEDIASFYDYLEVQPP
DPO3_BACHD      EYFYRTPRIPRSQLQKHREGILVGSGCDKGEVFEGMMQKTPQ-EVEEIAKFYDYIEVQPL
DPO3_STAAW      KYFYRTPRIPRSLLDEYREGLLVGTACDEGELFTAVMQKDQS-QVEKIAKYYDFIEIQPP
DPO3_LACLA      KYYAGLPRVPRSVLEANREGLLVGSACEIGEVFDAAINKTFE-ETLEIAKFYDFIEVFPP
DPO3_STRP1      KYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGID-AAVDLARYYDFIEIMPP
DPO3_THEMA      KYFYGVPRILKSELIENREGLLVGSACISGELGRAALEGASDSELEEIAKFYDYIEVMPL
DPO3_MYCPU      KYYFANPKMFWEDIKRSKN-LLIGSGGLNSPLIDKLLFSTQE-DVLNEIDKYDYIEIPSP
                .     * :    :    . :::      . :         .          *:: :   

DPO3_MYCGE      NA-YLGYTLREGLKKELINDAIKLVIKTATKLKKLVAVASDAYFIHPWENEYYKAIVCAK
DPO3_MYCPN      GA-YAGYTIREGLKKEAIPNAIKLVVDTAQRLNKLVAVASDAYFIHPWENEYYKAIVCAK
DPO3_UREPA      GS-QKHLVYAKKITIENVQKAFKKLIYLALELNKIIIYSSSPYYFFKDDKKFYDVYVNTK
DPO3_BACSU      EVYRHLLELELVRDEKALKEIIANITKLGEKLNKPVVATGNVHYLNDEDKIYRKILISSQ
DPO3_BACHD      ANYEHLIEKELVKSREALQEIVANIVKLGEQLGKPVVATGNAHYLKEEDYIYRKILIASQ
DPO3_STAAW      ALYQDLIDRELIRDTETLHEIYQRLIHAGDTAGIPVIATGNAHYLFEHDGIARKILIASQ
DPO3_LACLA      ALYRSLVVGGSFKSEKELEQTLKDLIKIGKTLGKPVLATGNLHYLNPEDAIYREIIVRSL
DPO3_STRP1      AIYQPLVVRELIKDQAGIEQVIRDLIEVGKRAKKPVLATGNVHYLEPEEEIYREIIVRSL
DPO3_THEMA      ---DVIAEDEEDLDRERLKEVYRKLYRIAKKLNKFVVMTGDVHFLDPEDARGRAALLAPQ
DPO3_MYCPU      NNFSHFWTTKFS--DQQIKIQLQKLIKWAKEKNKIIVAIGEPRYNEKWQKIIHEIYINST
                                 :      :   .      :   ..  :    :       : . 

DPO3_MYCGE      GLGGKWHRHFNNKE--KEQTVPEVFLHTTDEMLKRMSFLGEDIAYKLVVENTNKIVKLLD
DPO3_MYCPN      GLGGRWHRHFNYKE--REQRVPNVFVRTTGEMLNEMSFLGEQLAYELVVENTNKLAKQLT
DPO3_UREPA      GLEGKAHRFAN------EVYVPDLEYIDQKNAIDELAYLEDEKLINLIINENPVHINSWF
DPO3_BACSU      GGANPLNRHE----------LPKVHFRTTDEMLEAFSFLGE--EKAKEIVVTNTQKVASL
DPO3_BACHD      GGANPLNKQT----------LPQVHFRTTSEMLEAFAFLGE--EKAKEIVVTNTNHIADQ
DPO3_STAAW      P-GNPLNRST----------LPEAHFRTTDEMLNEFHFLGE--EKAHEIVVKNTNELADR
DPO3_LACLA      GLGAEINWTQGHGEHAKPLPLPEAHFRTTDEMLEAFSFLDE--KTAREIVIDNTQKMADE
DPO3_STRP1      GQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGK--DLAYQVVVQNTQDFADR
DPO3_THEMA      G---NRNFEN----------QPALYLRTTEEMLEKAIEIFEDEEIAREVVIENPNRIADM
DPO3_MYCPU      GIENSLHPLFIIKKDMDTF-YPEQIYKTTNEMKQEFSFLYD-PELIEEIVVKNPNLISSQ
                      :              *        :  .    : .       :           

DPO3_MYCGE      LNELVPTKNKLYPPVMQ-----DSNQKLIDKTWKQAEKRYGKNLPKLIKERIEKELNAII
DPO3_MYCPN      ADDLVPVQTKLQPPVIE-----GSNENLAAKTWSQAKAIYGDPLPKLIEQRIQEELKAII
DPO3_UREPA      DDSIQPLKEGLYAPKME-----GVDQKTIDYVYHTAKKIYGENLPTIVEQRIKKELNSII
DPO3_BACSU      VDDIKPIKDDLYTPKI-----EGADEEIREMSYQRARSIYGEELPEIVEARIEKELKSII
DPO3_BACHD      IEEIHPIPDKLYTPKI-----EGADEEIRQMSYNRARKIYGDPLPEIVEARLEKELKSII
DPO3_STAAW      IERVVPIKDELYTPRM-----EGANEEIRELSYANARKLYGEDLPQIVIDRLEKELKSII
DPO3_LACLA      FDVLTPVRDDLYTPKMVFDGGETSEERIVRLTYEKAHEWYGNPLPDIIDARLEKELRSIL
DPO3_STRP1      IEEVEVVKGDLYTPYI----DKA-EETVAELTYQKAFEIYGNPLPDIIDLRIEKELTSIL
DPO3_THEMA      IEEVQPLEKKLHPPII-----ENADEIVRNLTMKRAYEIYGDPLPEIVQKRVEKELNAII
DPO3_MYCPU      IEKIQVIKDKLYTPKF-----DDSHIKLKKLVYENAWKKYGKNLPEIIEQRIEKELTPIL
                 : :      * .* :        .          *   **. ** ::  *:::** .*:

DPO3_MYCGE      SNGFGIVFWISHLLVEQSVKDGYFVGPRGSIGSSLIANLIGISEINPLAAHYLCEQCHYF
DPO3_MYCPN      DNGFGIIYWISHLLVKQSVQDGYFVGPRGSIGSSLVANLIGISEINPLVPHYLCESCQYF
DPO3_UREPA      KHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLTPHYLCPNCKKC
DPO3_BACSU      GHGFAVIYLISHKLVKRSLDDGYLVGSRGSVGSSLVATLTEITEVNPLPPHYVCPECQHS
DPO3_BACHD      GHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYVCPNCHHS
DPO3_STAAW      GNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEITEVNPLPPHYICPNCKTS
DPO3_LACLA      GNGFSVVYIISQELVKRSNDRGYIVGSRGSVGSSLVATMIGITEVNPLAPHYRCPECQYF
DPO3_STRP1      GNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPSCQHS
DPO3_THEMA      NHGYAVLYLIAQELVQKSMSDGYVVGSRGSVGSSLVANLLGITEVNPLPPHYRCPECKYF
DPO3_MYCPU      NYGFDVIYWISSILVQKSLSDGYLVGSRGSIGSSLVATLSGITEVNPLAPHYICSKCQYF
                  *: :::  :  **::* . ** **.***:***::*.:  *:::**: .** * .*:  

DPO3_MYCGE      EVSDSVDDGYDLMIRDCPKCHEKASFKGDGHNIPFATFMGFSGDKIPDIDLNFSSEYQAK
DPO3_MYCPN      EVNEEVDDGYDLMVRDCPKCGAKAAFKGDGHNIPFATFMGFAGDKIPDIDLNFSSEYQAK
DPO3_UREPA      EFITNADDGFDLAPKSCEQCQTPMLT--DGHNIPFETFLGFDGDKVPDIDLNFSGVYQAV
DPO3_BACSU      EFFNDGSVGSGFDLPDKTCPHCGTPLKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPQ
DPO3_BACHD      HFFNDGSVGSGYDLPDENCPKCGTPYVKDGQDIPFETFLGFKGDKVPDIDLNFSGEYQPR
DPO3_STAAW      EFFNDGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKGDKVPDIDLNFSGEYQPN
DPO3_LACLA      ECYDDGSFGSGYDMPDKNCPKCDHKLIKDGHDIPFETFLGFKGDKVPDIDLNFSGDDQPL
DPO3_STRP1      EFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSGDDQPS
DPO3_THEMA      EVVEDDRYGAGYDLPNKNCPRCGAPLRKDGHGIPFETFMGFEGDKVPDIDLNFSGEYQER
DPO3_MYCPU      ELVKDPMTNSGFDLDDKKCPKCNSFLDKDGQTIPFETFLGFKADKVPDIDLNFSGEYQGK
                .   .   . .    .            :*: *** **:** .**:********.  *  

DPO3_MYCGE      AHDYVRKLFGVNNTFRAGTIATVAEKTAYGYARNYFEIIK-RVDLATTAEIERFKQKLIG
DPO3_MYCPN      AHAYVRELFGEQYTFRAGTIATVAEKTAYGYARNYFEIIK-QTELATAPEIERFKQKLVG
DPO3_UREPA      AHNFIKSIFGETHSYRAGTIGTMAQTSAENTVKKYFENRFNENKIIRDSTVSLYVQKCID
DPO3_BACSU      AHNYTKVLFGEDNVYRAGTIGTVAEKTAYGYVKGYAGDNN---LHMRGAEIDRLVQGCTG
DPO3_BACHD      AHNYTKELFGESYVYRAGTIGTVAEKTAYGYVKGYQSDHD---LHFRGAEIDRLVTGCTG
DPO3_STAAW      AHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLNDQG---IHKRGAEIDRLVKGCTG
DPO3_LACLA      AHLDVRDIFGEDYAFRAGTIGTVAEKTAFGFVKGYERDYD---QFYGNAEIDRLAAGSTG
DPO3_STRP1      AHLDVRDIFGDEYAFRAGTVGTVAEKTAYGFVKGYERDYG---KFYRDAEVDRLAAGAAG
DPO3_THEMA      AHRFVEELFGKDHVYRAGTINTIAERSAVGYVRSYEEKTG---KKLRKAEMERLVSMITG
DPO3_MYCPU      IHDEVKRLFGSKHTFRAGTISTVAEKTAYGYIKKYLETAS---LDYSDNFVDFLTEKSTG
                 *   . :**    :****: *:*: :* .  : *               :.       .

DPO3_MYCGE      IKRTTGQHPGGIMIFPSDHSVYEFTPCGFPADDVESEWKTTHFEYDALGDAILKLDILGQ
DPO3_MYCPN      IKRTTGQHPGGIMIFPNHKSVYEFTPCGYPADDTSSDWKTTHFEYDALGNTILKLDILGQ
DPO3_UREPA      SKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDINETWKTTHFAFEYLHDSLLKFDILGH
DPO3_BACSU      VKRTTGQHPGGIIVVPDYMDIYDFSPIQFPADATGSEWKTTHFDFHSIHDNLLKLDILGH
DPO3_BACHD      VKRTTGQHPGGIIVVPDYMDIHDFCPIQFPADDRGAEWKTTHFDFHSIHDNLLKLDILGH
DPO3_STAAW      VKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFHSIHDNVLKLDILGH
DPO3_LACLA      VKRTTGQHPGGIIVIPNYMDVYDFSPVQFPADDVNAEWQTTHFDFHAIHDNILKLDILGH
DPO3_STRP1      VKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLDILGH
DPO3_THEMA      VKRTTGQHPGGLMIIPKDKEVYDFTPIQYPANDRNAGVFTTHFAYETIHDDLVKIDALGH
DPO3_MYCPU      VKRTTGQHPGGIIIIPKEFDVEDFTPVNFPANDTESSWKTTHFDFHAIHDNVLKLDILGH
                 **********:::.*.  .: :* *  :**:       **** :. : : ::*:* **:

DPO3_MYCGE      DDPTMLKHLADLTKINPQNIPHFDKNLISMFSSNKPLNLKPG-IVDEVTGAVGIPEFGTK
DPO3_MYCPN      DDPTMLKHLGDLTHVNPQNIPRFDKKLTEMFWSVNPLKLKPH-YLDEPTGAIGIPEFGTK
DPO3_UREPA      DNPTILKLLKDYTGIDERDVPMYDPLVMKSFSDISALNIKPSDVLNETTGAISIPEFGTR
DPO3_BACSU      DDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFQGTESLGVT-EEQIGCKTGTLGIPEFGTR
DPO3_BACHD      DDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFSGPDVLGVT-EEQILCKTGTLGIPEFGTR
DPO3_STAAW      DDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVT-EDEILCKTGTFGVPEFGTG
DPO3_LACLA      DDPTMIRKLQSLSGIVPQDIPMDDPGVMKLFTGTESLGLT-EEQLGVKLGTLGIPEMGTF
DPO3_STRP1      DDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEVLGVT-PEQIGTPTGMLGIPEFGTN
DPO3_THEMA      DDPTFIKMLKDLTGIDPMTIPMDDPDTLAIFSSVKPLGVD-PVELESDVGTYGIPEFGTE
DPO3_MYCPU      DDPTALKMLEKLTGVNVKDIPKKDEKIISIFTSPKALGISSEEILGEKTGALGIPEFGTN
                *:** :: * . : :    :*  *      *   . * :     :    *  .:**:** 

DPO3_MYCGE      FVRKILEQTKPKDFADLIRVSGLSHGKNVWADNAQKLIKSNRLTLRDVIACRDDIMLYLI
DPO3_MYCPN      FVRKILEQTKPKGFGDLIRVSGLSHGKNVWADNAQKILKDQNLSLKDVIACRDDIMLYLI
DPO3_UREPA      FVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKSG-KLLKDVIACRDDIMTYLI
DPO3_BACSU      FVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIHNNICELSEVIGCRDDIMVYLI
DPO3_BACHD      FVRQMLEETKPSTFSELVQISGLSHGTDVWLNNANELIYNGTCELKDVIGCRDDIMVYLI
DPO3_STAAW      FVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSSVIGCRDDIMVYLM
DPO3_LACLA      TSMNMIAEAKPKNFADLLQISGLSHGTDVWSGNAQDLIRSGIADLSSVIGCRDDIMVYLI
DPO3_STRP1      FVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDIMVYLM
DPO3_THEMA      FVRGMLVETRPKSFAELVRISGLSHGTDVWLNNARDWINLGYAKLSEVISCRDDIMNFLI
DPO3_MYCPU      FVRQMLSEAKPKTFADLVSISGLSHGTDVWINNAHYIIQSLGKTLDQVISCRDDIMVDLI
                    :: :::*. *.:*: :****** .** .**.  :      *  **.******  *:

DPO3_MYCGE      NKGMQAKDAFEIMEKVRKG------IKVNAKEVSLMQNCGVEQYWINACLKINYLFPKAH
DPO3_MYCPN      HKGMQAKDAFEIMEKVRKG------IALNAKEVQLMQSNGVEQHWINSCLKISYLFPKAH
DPO3_UREPA      RQNVEPKTAFLIMEDVRKG------KKIKPEHQIILKELKVPEWYIESANKIKYMFPKAH
DPO3_BACSU      YQGLEPSLAFKIMEFVRKG------KGLTPEWEEEMKNNNVPDWYIDSCKKIKYMFPKAH
DPO3_BACHD      YKGLEPSLAFKIMEFVRKG------KGLQPEWIEEMKKHDVPDWYIGSCLKIKYMFPKAH
DPO3_STAAW      YAGLEPSMAFKIMESVRKG------KGLTEEMIETMKENEVPDWYLDSCLKIKYMFPKAH
DPO3_LACLA      HKGLENGLAFTIMERVRKGMWNKIPAEEREKYVEAMREHDVPEWYIESCSKIKYMFPKAH
DPO3_STRP1      HAGLEPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKYMFPKAH
DPO3_THEMA      HKGMEPSLAFKIMENVRKG------KGITEEMESEMRRLKVPEWFIESCKRIKYLFPKAH
DPO3_MYCPU      KKGVPIDLSFTIMEQVRKG------KGLSLEQKRKLIEHGIENWYIESMEKIKYMFPKAH
                  .:    :* *** ****                :    : : :: :  :*.*:*****

DPO3_MYCGE      AAAYVLMAWRIAWFKLYHPLSYYACLLSFKLKEHDINGFEKGYEFIKNRLDELNKLYRIK
DPO3_MYCPN      AAAYVLMAWRIAWFKLYHPLSYYACLLSFKLKEHDVSGFKSGVSFVKQKLEELNTLYRIK
DPO3_UREPA      ATAYVMHAWKFAWYKIYYPLEYYAAFFSVRADNFDLFVINQGKEFIEKTYNDIEQRSKSR
DPO3_BACSU      AAAYVLMAVRIAYFKVHHALLYYAAYFTVRADDFDIDTMIKGSTAIRAVMEDINAKG---
DPO3_BACHD      AAAYVLMAVRIAYFKVHYPILYYASYFTVRADDFDLDTMVKGSAAIRAKIEEINGKG---
DPO3_STAAW      AAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDMYSRY---
DPO3_LACLA      AAAYIMMALRVAYFKVHHPILYYCAWFSIRATAFDIGVMGAGLEAVKAKMKEIKDKG---
DPO3_STRP1      AAAYVLMALRVAYFKVHHPIMYYCAYFSIRAKAFELKTMSGGLDAVKARMEDITIKRKN-
DPO3_THEMA      AVAYVSMAFRIAYFKVHYPLQFYAAYFTIKGDQFDPVLVLRGKEAIKRRLRELKAM----
DPO3_MYCPU      ATAYVLMAWRVAFYKVYYPLEYYATYFSTRTEFFDIEIMSKDKLTLESKIKELAYRENLR
                *.**:  * :.*::*:::.: :*.  :: :   .:   .  .   :.    ::       

DPO3_MYCGE      KIK----PKEAELLTSYEVYLEMMARNIKLQQISIQNS--NARMFVEHNGVLIAPFITIP
DPO3_MYCPN      RIK----PKEAELLTSYEVYLEMMARGIKLEQISLTHS--HATRFVEHNGMLIAPFITIP
DPO3_UREPA      DPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIDKENNAIIPPFIAIQ
DPO3_BACSU      --LD-ASPKEKNLLTVLELALEMCERGYSFQKVDLYRSSATEFIIDGNS--LIPPFNSIP
DPO3_BACHD      --LD-ASPKEKSLLTVLELALEMVERGFSFQKVDLYRSEATEFLVEGNT--LIPPFNALT
DPO3_STAAW      --MD-LGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDT--LIPPFISVP
DPO3_LACLA      --FD-ATNVETNLYTTLELCNEMLERGFTFGKIDLYRSEATEFVIDGDT--LIPPFVTMD
DPO3_STRP1      --NE-ATNVENDLFTTLEIVNEMLERGFKFGKLDLYKSDAIEFQIKGDT--LIPPFIALE
DPO3_THEMA      --PA-KDAQKKNEVSVLEVALEMILRGFSFLPPDIFKSDAKKFLIEGNS--LRIPFNKLP
DPO3_MYCPU      NDNQ-LTTKEKNTLPTLYIANEMKARGFNIQNINLKISLANDWIIDKNSKSLIPPFNVID
                         :    .   :  *:  *.  :   .:  *      .  ..  :  **  : 

DPO3_MYCGE      GMGEAVASSIVEARNEKPFASLNDFKKRTKITKKHVETMEQLQLFDEFEHQDDHKLFN--
DPO3_MYCPN      GMGEAVANSIIEARNEKPFSSLDDFKKRTKITKKHIEAFTQMQLLDEFREQDNQKKLF--
DPO3_UREPA      GLGETVANSIIEARNQKVFSTIEDLKNRTKISRTDLKNLRVLGVLDHLSETEQLTLF---
DPO3_BACSU      GLGTNAALNIVKAREEGEFLSKEDLQKRGKVSKTILEYLDRHGCLESLPDQNQLSLF---
DPO3_BACHD      GVGTNAAINIVKARDEREFLSKEDLQQRSKITKTVLENLDAHGCLEGLPESNQLSLF---
DPO3_STAAW      GLGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFDM-
DPO3_LACLA      GLGENVAKQIVAARAEGEFLSKMELRKRGGVSQTIIENMTNMGVLEGMPDDNQLSLFDDF
DPO3_STRP1      GLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDEMGILGNMPEDNQLSLFDDF
DPO3_THEMA      GLGDSVAESIIRAREEKPFTSVEDLMKRTKVNKNHIELMKSLGVLGDLPETEQFTLF---
DPO3_MYCPU      GLGETLAQKIVDSRNEKEFLSVEDFINRTGINSTLVEKFKSMGIFEQIPETNQIFLI---
                *:*   *  *: :* :  * :  :: ::   . . :: :     :  : .  :   :   

DPO3_MYCGE      -
DPO3_MYCPN      -
DPO3_UREPA      -
DPO3_BACSU      -
DPO3_BACHD      -
DPO3_STAAW      -
DPO3_LACLA      F
DPO3_STRP1      F
DPO3_THEMA      -
DPO3_MYCPU      -