CLUSTAL format seed alignment for MF_00357

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOE_BACHD      -----MKLAELSKEEIQELSMVEVAYLVMKETKE--PFNYQDLLKKVAELKGMSEEQMLD
RPOE_BACSU      -----MGIKQYSQEELKEMALVEIAHELFEEHKK--PVPFQELLNEIASLLGVKKEELGD
RPOE_STRPN      MRRNALELEVFAGQEKSELSMIEVARAILELRGRDHEMHFSDLVNEIQNYLGTSNSDIRE
RPOE_STRP1      -----MKLDVFAGQEKSELSMIEVARAILEERGRDNEMYFSDLVNEIQNYLGKSDAGIRH
RPOE_LACLA      -----MKITALEGQKISELSMIEVAHALLEQNGK--EMQFSEIIRAIQDYLEKSDDEIKA
RPOE_LISIN      -----MDLKNLTQEERSELSLIDVAHFILEQRKE--TILFPELVKEIQAFLGLKDAEIRE
RPOE_LISMO      -----MDLKNLTQEERSELSLIDVAHFILEQRKE--TILFPELVKEIQAFLGLKDAEIRE
RPOE_STAAM      -----MKIQDYTKQMVDEKSFIDMAYTLLNDKGE--TMNLYDIIDEFRALGDYEYEEIEN
RPOE_MYCGE      -------------MQLEYLNLISQAKVIAEKQFKANPFSFETIWKEVVKHFKISKQDEPS
RPOE_MYCPN      -------------MQVEYLDLISQAKEIAETQFKAEPFSFDAIWKEVVKHFKISKQDEPN
RPOE_UREPA      -----------MSRQLVDIAYNAIKNNKIYNKKP---FTFDDIINEIVKNSNVNLVEVNS
                                                     .    :   .      .      

RPOE_BACHD      RIGYLYTDLNIDGRFVTLGDNRWGLRSWYPLEQVEEEITGPTKKKAK--AKAEEEVDELD
RPOE_BACSU      RIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLD
RPOE_STRPN      ALPLFYTELNFDGSFISLGDNKWGLRSWYGVDEIDEEIIALEENDDDEV-APKAKKKRVN
RPOE_STRP1      ALPFFYTDLNTDGSFIPLGENKWGLRSWYAIDEIDEEIITLEEDEDG---AQKRKKKRVN
RPOE_LACLA      SISRFYTEINTDGSFIPLGNNIWALRSWYAIDEIDEEVIALDEIEDEEEEKPAKKRKKVN
RPOE_LISIN      RLVQFYTDMNIDGNFISLGNNTWGLRAWYPMDAIDEEVQTQTTPKKKR--KSDDDDDEDE
RPOE_LISMO      RLVQFYTDMNIDGNFISLGNNTWGLRAWYPMDAIDEEVQTQTTPKKKR--KSDDDEDEDE
RPOE_STAAM      RVVQFYTDLNTDGRFLNVGENLWGLRDWYSVDDIEEKIAPTIQKFDI----LDADDEEDQ
RPOE_MYCGE      LIGRFYQDFLEDPNFVYLGDRKWKLRDFMKFDEWNKISQSMFVTKEI-------------
RPOE_MYCPN      LISRFYQDFLEDPNFVYLGERNWKLRDFMKFDEWNKISQAMFVTKEI-------------
RPOE_UREPA      QLGVLYTTLIQDTRFISIGDLEWNLRERLSLDEITKINNAMYEVGLYK-----DSDREED
                 :  :*  :  *  *: :.:  * **     :   :                        

RPOE_BACHD      ENIEVFDD--EFEDLEDELD-----ELAES---EDSDEEDEEFD---------------E
RPOE_BACSU      EFEEIDEDDLDLDEVEEELD-----LEADDFDEEDLDEDDDDLEI--------------E
RPOE_STRPN      AFMDGDSDAIDYNADDPEDEDAYEADPALSYDDENPDDEKNEVEAYDAEINEIAPDDLGE
RPOE_STRP1      AFMDGDEDAIDYRDDDPEDEDFTEESAEVEYDEEDPDDEKSEVESYDSELNEIIPEDDFE
RPOE_LACLA      AF--GIEDEIDPEDEEGTKE---TTEEDMSYDTQAEDEDKDDVAAYDAELAEVELDNVDE
RPOE_LISIN      EI---LDDDVDYDDEEIVEE---LGEEEISLADVLLDEDEDD----DDHLPDGI-EGDLA
RPOE_LISMO      EI---LDDDVDYDDEEIVEE---LGEEEISLADVLLDEDEDD----DDHLPDGI-EGDLA
RPOE_STAAM      NLKLLGEDEMDDDDDIPAQTD--DQEELNDPEDEQVEEEINHSDIVIEE----------D
RPOE_MYCGE      ----FEEGYEDLSNKKVEPE-----EGVGDFIMGNDGDDNET--------------G--S
RPOE_MYCPN      ----FEEGYEDLSNKKKENE-----EEVNDFIMGNDGDDNST--------------G--D
RPOE_UREPA      EHEIVKNDKLTQSKEQEESD---EVSSLSDFVGYEDEDEEFKNN---------------N
                      ..                     .       ::                     

RPOE_BACHD      GDDIDELDDEFEESDDDL---
RPOE_BACSU      EDIIDEDDEDYDDEEEEIK--
RPOE_STRPN      DVDLNEDDDEFSDDDAETSEE
RPOE_STRP1      EVDINEEDEEDEEDEEPVL--
RPOE_LACLA      EVDIDVEDDEDDSDDTDED--
RPOE_LISIN      TVEDDYTDGDYTEDPEDK---
RPOE_LISMO      TVEDDYTDGDYTEDPEDK---
RPOE_STAAM      EDELDEDEEVFEDEEDFND--
RPOE_MYCGE      EIVQGLINDSFSEENQ-----
RPOE_MYCPN      EIVQGLIND-FRDDNQ-----
RPOE_UREPA      TSNKDEIEDEEELEEEE----
                    .  :     .