CLUSTAL format seed alignment for MF_00358

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A9WE80_CHLAA      -------------MRVERREGE-TVEQLIRRFNKGVVAERITKTYREKMHFISKSEQRKE
RS21_MYCPN        ------------MPKIEVKNDD--LELALKKFKRVSLEIRRLAQ--RHEYHLRKGMRLRE
RS21_MYCGE        ------------MPKIEVKNDD--LELALKKFKRISLEVRRLAQ--RHEYHLRKGMRLRE
RS21_NEOSM        ------------MGQVFMVHHG-DVEQALRRLKQHLSREGITPGRKRI--FEKPSEKRHR
RS21_CHLTR        ------------MPSVKVRVGE-PIDRALRILKKKIDKEGILKTSKSHRFYDKPSVKKRA
RS21_RICPR        ------------MILVNVHAGN--CDNTLKNFKKKLQRELYFRKMKEQRYYETPSAKRVR
RS211_GEOSL       ------------M-QVSVQGND--VDKALRLLKRKLQTEGFFKEIKKRKHYEKPSVKKKR
RS21B_AGRFC       ------------M-QVLVRDNN--VEQALRVLKKRMQREGIFREMRARESYEKPSEKRVR
RS211_BRADU       ------------M-QVLVRDNN--VDQALRVLKKKMQREGVFREMKQRRSYEKPSERKTR
RS21C_AGRFC       ------------M-QVLVRDNN--VDQALRILKKKLQREGVFREMRLREAFEKPSIKKAR
RS21_CAUVC        --MVGLSNGEIPLVQIFVRDNN--VDQALKALKKKMQREGSFREMKRHVHYEKPSEKRAR
RS21_RHOS4        ------------M-QVSVRDNN--VEQALRALKKKLQREGVFREMKLKQHFEKPSVKRAR
RS21A_AGRFC       ------------M-QVLVRDNN--VDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAR
RS21_RHORT        MGGGSQVEGERALVQVLVRDNN--VDQALKALKKKMQREGVFREMKLRRNFEKPSEKRAR
RS212_BRADU       -------------MQVLVRDNN--VDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAR
E7MCA7_BACTN      ------------MIVVPVKEGE-NIEKALKKFKRKFEKTGIVKELRSRQQFDKPSVTKRL
RS21_FLAPJ        ------------MLIIPIKDGE-NIDRALKRYKRKFDKTGVVRQLRKRQAFIKPSVINRA
RS21_RHOBA        ------------MVKLLVRDRE-TIQEAVRRFRKLVERSGIKKEMRRREFYEKPSETNRR
I9S6Q7_HELPX      ------------MPGIKVREGD-AFDEAYRRFKKQTDRNLVVTECRARRFFESKTEKRKK
RS21_HELPY        ------------MPGIKVREGD-AFDEAYRRFKKQTDRNLVVTECRARRFFESKTEKRKK
RS21_CAMJE        ------------MPGIKVHPNE-SFDEAYRKFKKQVDRNLVVTEVRARRFFEPMTEIRKK
Q6F1A3_MESFL      ------------MASIIVHEGE-SIEKALKRFQKVASSNK--AEARKREYHLSKKEKRIY
Q6MT69_MYCMS      ------MELKKLMASVIVHDGE-TIEKALKRFQKVASSNK--AEARKREYHLSKKEKRIY
RS21_CHLTE        ------------MVSVQVNENE-SIDKLLKRFKKKYERAGVLKEFRKKAYFVKPSIEKRL
RS21_AQUAE        ------------MVTVIVQEGE-PIEKVLKRFKARVEQEQILTELKRREYYEPPSERKKK
RS21_BORBU        ------------MVTVTVDKNE-NLEKALKRFKRMIEKEAIIREWKRREYYEKPSTIRVK
RS21_KORVE        ------------MAEVKLQEGE-SLENALRRFKRKVQQEDIIKEVKRHSFYLKPGEKKRV
RS21_LEPIN        ------------MVGIIVKDGE-SIESALKRFKRDCANAGIMSEIKRREYFEKPSIKKKK
RS21_PROMA        ------------MTQVIVGENE-GVESALRRFKREVSKAGIFNDLKRIRHHETPVEKYKR
RS21_SYNY3        ------------MTQVVVGQNE-PIESALRRFKRQVAKAGIYTDFKKHQFFETPQEKHKR
RS211_GLOVI       ------------MAQVRVGQDE-SIESALRRFKRTVAKAGILAEAKRHRHFETPIEKRRR
D1B9B3_THEAS      ------------MTTVVRRDNE-SLEDTLKRFKRELRKVGVLREARKHEHYEKPSEIKKR
RS211_FRATT       ------------MLSIKVDERK-PFDISLRNFKRACEKAGIKQELRDRQHYVKPTEKRKI
RS212_FRATT       ------------MPRIIVDPKK-PFDISLRNFKRACEKAGIKQELRDRQHYVKPTQKRKI
RS21_COXBU        ------------MPMIDVPDNN-AFDVAMRRFKRACEKAGILSKLRQIEYYEKPTSKRKR
RS213_FRATT       ------------MPSVRIKERE-PFDVALRRFKRSCEKAGIVSELRRREYFEKPTWARKR
RS212_BURPS       ------------MTTIVLNPNE-PVEVALRRFRRSIERTGLIKELRARTSYEKPTTERKR
RS211_BURPS       ------------MTTILLKENE-PFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKR
RS21_NEIG1        ------------MPAIRVKENE-PFEVAMRRFKRAVEKTGLLTELRAREAYEKPTTERKR
RS21_NEIMB        ------------MPAIRVKENE-PFEVAMRRFKRAVEKTGLLTELRAREAYEKPTTERKR
RS213_BURPS       ------------MTIIRVKENE-PFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAERKR
RS21_BORPE        ------------MPIVRLKENE-PFEAALRRFKRTIEKTGLLTELRSREFYEKPTAERKR
RS21_XANCP        ------------MPSVKVRENE-PFEFALRRFKRTCEKAGVLAETRKREFYEKPTQERKR
RS21_PSEAE        ------------MPAVKVKENE-PFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAERKR
RS21_HAEIN        ------------MPVIKVRENE-SFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKR
RS21_VIBCH        ------------MPVVKVRENE-PFDVALRRFKRSCEKAGILSEVRRREHYEKPTTVRKR
RS21_ALIF1        ------------MPVVKVRENE-PFDVALRRFKRSCEKAGILSEVRRREHYEKPTTVRKR
RS21_SHEON        ------------MPIIKVRENE-PFDVALRRFKRSCEKAGILADVRAREFYEKPTTARKR
RS21_BUCAI        ------------MPIIKVRENE-PFDVALRRFKRSCEKAGILAEIRRREFYEKPTTERKR
RS21_ECOLI        ------------MPVIKVRENE-PFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKR
RS21_SALTY        ------------MPVIKVRENE-PFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKR
RS21_SHIDS        ------------MPVIKVRENE-PFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKR
RS21_YERPE        ------------MPVIKVRENE-PFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKR
RS21_DICTD        ------------MTEVRVGKDE-SLDSALKRFKKKLQEDGVLADIRRHEYYEKPSEKRNR
RS21_DESVH        ---------MISLPGVYLNEDDYNFDIALRRFKKQVEKAGILSEMKKRQHYEKPSVMRKK
RS21_THEYD        ------------MPSVNVRDMD-SFEAALKMFKKQCEREGILSEIKKREHYEKPSVKRKK
RS21_THEEB        ------------MAEVRLGENE-SIESALRRFKKKIQKAGILSEVKRRERYEKPSLRRKR
RS212_GLOVI       ------------MTEVRLGENE-SIESALKRFKKKIQKAGILSEIKRRERYEKPSARRKR
RS212_GEOSL       ------------MPGVKVKETE-SFELALKKFKKQCEKAGILSEVRKREHYEKPSIKRKK
RS21_LACPL        ------------MAKTVVRKNE-SLDDALRRFKRTVSKSGTLQEYRKREFYEKPSVKKKL
RS21_LACLA        ------------MSKTLVRKNE-SLDDALRRFKRSVTKAGTLQELRKREHYEKPSVKRKR
RS21_STRR6        ------------MSKTVVRKNE-SLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKR
RS21_BACAN        ------------MSKTVVRKNE-SLEDALRRFKRSVSKTGTLAEARKREFYEKPSVKRKK
RS21_BACSU        ------------MSKTVVRKNE-SLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKK
RS21_ENTFA        ------------MSKTVVRKNE-SLDDALRRFKRSVSKAGTLQESRKREFYEKPSVKRKK
V7ZRJ8_ENTFL      ------------MSKTVVRKNE-SLDDALRRFKRSVSKAGTLQESRKREFYEKPSVKRKK
RS21_STAA8        ------------MSKTVVRKNE-SLEDALRRFKRSVSKSGTIQEVRKREFYEKPSVKRKK
RS21_LISMO        ------------MSKTVVRKNE-SLEDALRRFKRTVSKSGTLQESRKREFYEKPSVKRKK
RS21_MOOTA        ------------MSEVKIGKNE-SLDAALRRFKRICQKSGVLSEARRREHYEKPSVRRKK
RS21_CLOAB        ------------MSEIKVGENE-SLESALRRFKRKCARAGVLSEVRKREHYEKPSVKRKK
RS21_CLOBH        ------------MSEIKVGENE-SLENALRRFKKKCARAGVLSEVRKREHYEKPSVKKKK
                                           :   .  .                 .         

A9WE80_CHLAA      KRRRAERNRRKKLAKAAALGL--------------------------------
RS21_MYCPN        KRKIAQKKRRKFRNMV-------------------------------------
RS21_MYCGE        KQKIAQKKRRKFRSLASH-----------------------------------
RS21_NEOSM        RAVETRRKIRKQKLRVVPY----------------------------------
RS21_CHLTR        KSKAAAKYRGR------------------------------------------
RS21_RICPR        KAQEAARRIRKFARKKMYEE---------------------------------
RS211_GEOSL       KQMEAERKRRKAQRFRKPDRD--------------------------------
RS21B_AGRFC       EQAEAVRRHRKLEKKKMQREGLLPAPKKAVRTR--------------------
RS211_BRADU       EKSEAIRRARKLARKQAIREGLLPAPPKKKLPERKPPLPQTAARPAG------
RS21C_AGRFC       EKAEAIGRQRKLARKQMQREGLLPTKPRKDK----------------------
RS21_CAUVC        QKAEAVRRARKLARKRAQREGLLPMPKKPGR----------------------
RS21_RHOS4        EQAEAVRRARKLARKKAQREGAL------------------------------
RS21A_AGRFC       EKAEAVRRVRKLARKRAQREGLIAAPRASR-----------------------
RS21_RHORT        EKAEAVRRARKLERKRLEREGF-------------------------------
RS212_BRADU       EKAEAVRRARKLARKKLQREGLLPMKPKPVFGAGAGGERGGRGGPGAGPRGPR
E7MCA7_BACTN      KKERAVYVQQLQQVED-------------------------------------
RS21_FLAPJ        MIQKAAYVQNMREGLENM-----------------------------------
RS21_RHOBA        ARLRAERRNKRTRMLSR------------------------------------
I9S6Q7_HELPX      QKISAKKKVLKRLYMLRRYESRL------------------------------
RS21_HELPY        QKISAKKKVLKRLYMLRRYESRL------------------------------
RS21_CAMJE        QKISARKKMLKRLYMLRRYESRL------------------------------
Q6F1A3_MESFL      KQKQNRKYK--------------------------------------------
Q6MT69_MYCMS      KQKQNRKYK--------------------------------------------
RS21_CHLTE        KRSRSKRRAQRANEERNS-----------------------------------
RS21_AQUAE        RERNRRKKILKALKKQQQLI---------------------------------
RS21_BORBU        KEKAFKRKQAKKVRKLKQKTNR-------------------------------
RS21_KORVE        KEALARKRSRKKARKEQD-----------------------------------
RS21_LEPIN        AIESAKRKAEKKKRLFSKKDKA-------------------------------
RS21_PROMA        KQRLKNRTKRRR-----------------------------------------
RS21_SYNY3        KEATRRRQRSRRR----------------------------------------
RS211_GLOVI       KAIARRRRYPRR-----------------------------------------
D1B9B3_THEAS      KKAAQAKNRRRAG----------------------------------------
RS211_FRATT       AKRQAVKRARISQRRAFI-----------------------------------
RS212_FRATT       AKKAAISKAKKEARRSYSY----------------------------------
RS21_COXBU        KRAAAVKRYAKKLQKEQEALERERTRY--------------------------
RS213_FRATT       KKTAAVKRAHKSNIIVKR-----------------------------------
RS212_BURPS       KKAAAVARLRKQVRRSMPPKKKY------------------------------
RS211_BURPS       KKAAAVKRLHKRLRSQMLPKKLH------------------------------
RS21_NEIG1        KKAAAVKRLQKRLRSQQLPPKMY------------------------------
RS21_NEIMB        KKAAAVKRLQKRLRSQQLPPKMY------------------------------
RS213_BURPS       KKAAAVKRHYKRIRSQMLPKKLY------------------------------
RS21_BORPE        KHAAAVKRHYKRIRSQQLPPRLY------------------------------
RS21_XANCP        KAAAAVKRQLRRSSRDVTKRQRLY-----------------------------
RS21_PSEAE        KAAAAVKRHAKKVQREQRRRERLY-----------------------------
RS21_HAEIN        ENATLAKRHAKRNARENARNTRLY-----------------------------
RS21_VIBCH        AKAAAQKRHAKKLARENARRVRLY-----------------------------
RS21_ALIF1        AKAAAQKRHAKKLSRENARRVRLY-----------------------------
RS21_SHEON        AKAAAVKRLAKKLSRENARRVRLY-----------------------------
RS21_BUCAI        AKASAVKRLAKKLTRENARRIRMY-----------------------------
RS21_ECOLI        AKASAVKRHAKKLARENARRTRLY-----------------------------
RS21_SALTY        AKASAVKRHAKKLARENARRTRLY-----------------------------
RS21_SHIDS        AKASAVKRHAKKLARENARRTRLY-----------------------------
RS21_YERPE        AKASAVKRHAKKLARENARRTRLY-----------------------------
RS21_DICTD        KKAQSKKKK--------------------------------------------
RS21_DESVH        KKAAARKRLLKKIRKMNMA----------------------------------
RS21_THEYD        KVLAARKKLAKKMKMLSR-----------------------------------
RS21_THEEB        KQEAARKRNR-------------------------------------------
RS212_GLOVI       KAEAARKRRR-------------------------------------------
RS212_GEOSL       KAIAARKRAMKKQRKMMD-----------------------------------
RS21_LACPL        KSEAARKRKNRRRFK--------------------------------------
RS21_LACLA        KSEAARKRKKY------------------------------------------
RS21_STRR6        KSEVARKRKKF------------------------------------------
RS21_BACAN        KSEAARKRKF-------------------------------------------
RS21_BACSU        KSEAARKRKF-------------------------------------------
RS21_ENTFA        KSEAARKRKKF------------------------------------------
V7ZRJ8_ENTFL      KSEAARKRKKF------------------------------------------
RS21_STAA8        KSEAARKRKFK------------------------------------------
RS21_LISMO        KSEAARKRKF-------------------------------------------
RS21_MOOTA        KSEAARKRRWH------------------------------------------
RS21_CLOAB        KSEAARKRKFK------------------------------------------
RS21_CLOBH        KSEAARKRKFK------------------------------------------