CLUSTAL format seed alignment for MF_00360

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RR6_GUITH       --------MTKLNSYETLYIVKPELTEDSLAKLIESYQGLLLER-GAKNIITQNRGRRTL
RR6_PORPU       MLQTKNSQEIKLNWYETVYLIKSDLNEDRTLCIINEYKSMLTNG-GAKNIILQHRGRRHL
RS6_NOSS1       ----------MSTVYETLYILRPDLTDEQVELAIAKYQNLLQEQ-GATDLEVQNRGKRRL
RR6_CYAPA       MQVITLQKPSKKITYRTTYILKPSLTEEEITKEIEDYQKLLIDN-GAEDIIIENTGKCRL
RS6_SYNY3       ---------MLVNSYELMVILRPDLNEERVSQEVTKYQEFLTNN-AAEEVSVKVWGKRRL
RR6_CYACA       -MKTITIPRQNLTQYEIMLIMRPDLPEEKFLKFLSEIKEHAKRN-LALEFNLSNRGRRKL
RS6_AGRFC       -----------MALYEHIFLARQDISAQQVDALVEQYKGVIESF-GGKVGRVENWGLKSL
RS6_RHIME       -----------MALYEHVFLARQDITPQQVDALVEQYKGVIEAN-GGKVGRVENWGLKSL
RS6_RHILO       -----------MALYEHVFLARQDLSQQQVDALVEQYKGVISAN-GGSVGRVENWGLKSL
RS6_BRUME       -----------MALYEHVLLARQDISQQQVDALVEQFKGVLEAN-GGKFGKVENWGLRPL
RS6_CAUVC       -----------MAFYEHVVIARQDISPQQAEALNEQLKALIEEN-GGHIAKIEYWGLRNL
RS6_RHOCB       -----------MPLYEHVLIARQDLSNAQAEGLIEHFSTVIGDN-GGKVLGTEYWGVKTM
RS6_RICCN       -----------MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDN-NGTIIKKEYWGLRTL
RS6_RICPR       -----------MSFYESVFIIRQDVSLNDIDKIVDDFTKIIKDN-NGTIIKKEYWGLRTL
RS6_ECOLI       -----------MRHYEIVFMVHPDQS-EQVPGMIERYTAAITGA-EGKIHRLEDWGRRQL
RS6_ECOL6       -----------MRHYEIVFMVHPDQS-EQVPGMIERYTAAITGA-EGKIHRLEDWGRRQL
RS6_SALTY       -----------MRHYEIVFMVHPDQS-EQVPGMIERYSAAITGA-EGKIHRLEDWGRRQL
RS6_YERPE       -----------MRHYEIVFMVHPDQS-EQVPGMIERYSATITNA-AGTIHRLEDWGRRQL
RS6_HAEIN       -----------MRHYEIVFMVHPDQS-EQVPGMIERYTGSVKEA-GGQVHRLEDWGRRQL
RS6_PASMU       -----------MRHYEIVFMVHPDQS-EQVPGMIERYTGSVKEA-GGQVHRLEDWGRRQL
RS6_VIBCH       -----------MRHYEIVFMVHPDQS-EQVAGMIERYTGSITEA-GGKIHRLEDWGRRQL
RS6_PSEAE       -----------MRHYEIVFLVHPDQS-EQVGGMVERYTKAIEED-GGKIHRLEDWGRRQL
RS6_NEIMA       -----------MRHYEIVFIVHPDQS-EQVPAMVERYKTMIAEA-NGKIHRLEDWGRRQL
RS6_NEIMB       -----------MRHYEIVFIVHPDQS-EQVPAMVERYKTMIAEA-NGKIHRLEDWGRRQL
RS6_NEIGO       -----------MRHYEIVFIVHPDQS-EQVPAMVERYKTMITEA-NGKIHRLEDWGRRQL
RS6_XANAC       ----------MSRHYEVVFLVHPDQS-EQVPAMIERYKSLIEGG-NGTIHRLEDWGRRQL
RS6_XANCP       ----------MSRHYEVVFLVHPDQS-EQVPAMIERYKSLIEGG-NGTIHRLEDWGRRQL
RS6_XYLFA       ----------MGRHYEIVLLVHPDQS-EQVQAMLERYKALIENG-HGKIHRLEDWGRRQL
RS6_BUCAI       -----------MRHYEIIFMVHPDQS-DKIPLLIEKYKKIINDN-NGIIHRLEDWGRRQL
RS6_RALSO       -----------MRHYEIVFIVHPDQS-EQVPAMIERYKSTVTSQ-GGQVHRVEDWGRRQL
RS6_HELPY       -----------MRHYETMFILKPTLVEEEIKSKIEFYKEVITKH-HGVIETSLDMGMRNL
RS6_HELPJ       -----------MRHYETMFILKPTLVEEEIKSKIEFYREVITKH-HGVIETSLDMGMRNL
RS6_CAMJE       -----------MKHYEVLFILKPTLTEEEVNTKLEFVKEVLTKN-SAEIETVVPMGTRKL
RS6_MYCLE       -----------MRPYEIMVILDPTLDECTVGPSLETFLNVVRKD-GGAIDKVDIWGRRRL
RS6_MYCTU       -----------MRPYEIMVILDPTLDERTVAPSLETFLNVVRKD-GGKVEKVDIWGKRRL
RS6_CORGL       -----------MRQYELMIILDPSQDERTVAPSLDKFLEVVRKD-KGDVVKVDVWGKRRL
RS6_STRCO       -----------MRHYEVMVILDPDLEERSVSPLIENFLSVVRDG-GGKVEKVDTWGRRRL
RS6_CLOAB       -----------MNKYETLFILNPSLDEEGINTNVEKFKSVITNG-GGEVENVDLWGKRKL
RS6_CLOPE       -----------MRKYETIFVAHPSLDEEAVKALIEKFKGVIENG-NGTVDNVDFWGKRKL
RS6_CALS4       -----------MRSYETMYVLSPDLNEEERKGLIERFKNLIVER-GGEITNFDEWGKRKL
RS6_CHLMU       ------MKKKTGQLYEGAYVFSVTLSEDARRKALEKVTSGITNY-GGEVLKIHDQGRKKL
RS6_CHLTR       ------MKKKTGQLYEGAYVFSVTLSEDARRKALEKVTSGITNY-GGEVLKIHDQGRKKL
RS6_CHLPN       ------MGKKENQLYEGAYVFSVTLSEEARRKALDKVISGITNY-GGEIHKIHDQGRKKL
RS6_AQUAE       -----MRHYKTLRYYETVFAVKPTLSEEEMKKKFEQVKEFIKQK-GGEILYEEDWGMRQL
RS6_FUSNN       -----------MRKYEIMYIINPTVLEEGREELVNQVNALLTSN-GATIAKTEKWGERKL
RS6_THEMA       ------MAYVKERIYESMFIIAPNVPEEERENLVERVKKIIEERVKGKIDKVERMGMRKF
RS6_LISIN       ----------MARKYEIMYIIRPNIEEDEKKAVVERFDGILTEN-GAEIIESKEWGKRRL
RS6_LISMO       ----------MARKYEIMYIIRPNIEEDEKKAVVERFDGILTEN-GAEIIESKEWGKRRL
RS6_STAAM       -----------MRTYEVMYIVRPNIEEDAKKALVERFNGILATE-GAEVLEAKDWGKRRL
RS6_BACSU       -----------MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSN-GAEITGTKDWGKRRL
RS6_STRP1       -----------MAKYEILYIIRPNIEEEAKNALVARFDSILTDN-GATVVESKDWEKRRL
RS6_STRPN       -----------MAKYEILYIIRPNIEEEAKNALVARFDSILTDN-GATVVESKTWEKRRL
RS6_LACLA       -----------MTKYEILYIIRPNIDEEAKAALVERFDGILTDN-GAANLESKDWEKRKL
RS6_BACHD       -----------MRKYEIMYIIAPNLEEAANKEIIERFNGVLTNQ-GAEIEKVEEMGKRRL
RS6_DEIRA       -----------MNQYDLNLILNPNISAEQVQTEKDYIENAVRNA-GAEISNLDDLGNRRL
RS6_THET8       -----------MRRYEVNIVLNPNLDQSQLALEKEIIQRALENY-GARVEKVEELGLRRL
RS6_MYCGE       ------------MHYNIILLVDGTLSLEQANQVEQKHQKLLEKA---TEFKSEYLGLKEL
RS6_MYCPN       ------------MQYNIILLVDGSLSLEQANQVNEKQQQTLTNV---EGLQTEYLGLKEL
RS6_UREPA       -----------MAKYEIMLVVRGDLDQEQANKVANELKATLKNT---EVKENNYDGVQQL
RS6_BORBU       ----------MIKRYEACFLFKSE--EIEYKGSLEEVKKSLEFF-GATDVVSNFIGERAL
RS6_TREPA       -----------MRTYELMAVFSAH--EDLFLQGSTAVRALLQEN-DAVIAREDHIGEREL
RR6_TRICV       --------MSATKKYEMMILLTEEFNDSELKTWAFNYAKALRKL-SASEISVISRGKRDL
RS6_MYCPU       -----------MNKYEIVIMLDPA--EN-----IEKAQSLLKSTFKSGVEKFEKLEFTKL
RS6_MYCS5       -----------------MVLVGPKTSASTVESFLKSVF-------HDDFKKAEKLERTEL
                                                                           :

RR6_GUITH       KYMIKKYKDAHYVQMNYEGN--GEVIQLLERAMKINESIVRFLTTAI-------------
RR6_PORPU       SYSIKDYRDGIYVQVNYEGN--GKLVQSFEKSLRFDENIIRYLTNKQNKDNKIEG-----
RS6_NOSS1       AYEIKKQRDGFYVQFNYNAP--GKAIAILERAMRLSEEVIRYLTVKQEVTKEKEDKVAVT
RR6_CYAPA       AYLINKQNDGIYFQITYRGA--NTLVNILQRRMRLSINTLRYQTFKV-------------
RS6_SYNY3       AYQIRRFNDGIYVLFNFNGE--GQQIALIERDMRLNDNVMRFLSIKLTPEKPEKEKKAKA
RR6_CYACA       AYAMRKFQDGIYIQFNFLGS--GYILNSLIKRLKLEESILRYIVQKT-------------
RS6_AGRFC       TYRIKKNRKAHYALMDIDAP--AAAVHEVERQMRINEDVLRYMTIAVEAHEEGPSAMMQK
RS6_RHIME       TYRIKKNRKAHYVLMDIDAP--APAVHEVERQMRINEDVLRYMTIAVGKHEEGPSAMMQK
RS6_RHILO       TYRVNKNRKAYYTLMDLNCP--PAALNEMERQMGLSEDVLRFLTIKVEAHEEGPSAMMQK
RS6_BRUME       TYRIKKNRKAYYTLVNIDAP--AAAVAEMERQMRINEDVLSFLTVRVEEHEEGQSAMLTR
RS6_CAUVC       TYRIKKNRKGHYSLLAIDAP--APAVKEMERQLLINEDVLRFMTIRVEELDLELSPVLAR
RS6_RHOCB       AYKINKNRKGHYGFLRTDAP--SAAVQEMERLARLHDDVMRVLTIKVDGHDEGPSVQMQK
RS6_RICCN       AYKIGNNKKGHYYFLGLDIT--GNVKEELERKMKLNENIIRFLTIQADSISSEPSPILKN
RS6_RICPR       AYKIGNNKKGHYYFLGIDIT--SNVKEELERKMKLNENIIRFLTIKADSISSEPSPILKN
RS6_ECOLI       AYPINKLHKAHYVLMNVEAP--QEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA
RS6_ECOL6       AYPINKLHKAHYVLMNVEAP--QEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA
RS6_SALTY       AYPINKLHKAHYVLMNVEAP--QEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKA
RS6_YERPE       AYPINKLHKAHYVLLNVEAP--QEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKA
RS6_HAEIN       AYPINKLHKAHYVLMNVEAP--QQVIDELETTFRYNDAVLRSLVIHTKHAVTEASPMKAA
RS6_PASMU       AYPINKLHKAHYVLMNVEAP--QEVIDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKA
RS6_VIBCH       AYPINKLHKAHYVLMNVEAD--QAVVDELETAFRFNDAVLRNMIMRTKAAITEPSIMLKA
RS6_PSEAE       AYAINNVHKAHYVLMNVECS--AKALAELEDNFRYNDAVIRNLVMRRDEAVTEQSEMLKA
RS6_NEIMA       AYPINKIHKAHYVLMNIETT--PEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGG
RS6_NEIMB       AYPINKIHKAHYVLMNIETT--PEVVEELETAFRFNDAILRHLTIKTKHAVTEASPMLGG
RS6_NEIGO       AYPINKIHKAHYVLMNIETT--PEVVGELETAFRFNDAVLRHLTIKTKHAVTEASPMLGG
RS6_XANAC       AYPIQNLVKAHYVLLNIEVD--QAVLSELVESFRFNDAVLRHLVVKRDGADTEQSLIMKS
RS6_XANCP       AYPIQNLVKAHYVLLNIEVD--QAVLSELVESFRFNDAVLRHLVIKRDGPDTEQSLIMKS
RS6_XYLFA       AYPIQKLVKAHYLMMNIEVE--QSVLNELVDLFRFNDAILRHLAIKRSGPDTEQSFIMKS
RS6_BUCAI       SYSINKLQKAHYILMNIEVF--PKTITLLETDFRFNNIILRNMIMSVKKAIVELSPILKL
RS6_RALSO       AYMIQKLAKAHYVCVNIECG--KETLAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKE
RS6_HELPY       AYEIKKHKRGYYYVAYFKAE--PSMIVELERLYRINEDVLRFIVIKYESKKEVEAWHALV
RS6_HELPJ       AYEIKKHKRGYYYVAYFKAD--PSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALV
RS6_CAMJE       AYKIKKYERGTYFVIYFKAP--TNLIAELERVLRITEEVIRFLIVKYENKKEIAAW----
RS6_MYCLE       AYEISKHAEGIYVVIDLKAA--PATVSELDRQLSLNESVLRTKVMRTDKH----------
RS6_MYCTU       AYEIAKHAEGIYVVIDVKAA--PATVSELDRQLSLNESVLRTKVMRTDKH----------
RS6_CORGL       AYPIDKKEEGVYAVVDLKCE--SATVLELDRVLNLNDGVLRTKVLRLDK-----------
RS6_STRCO       SYEIKKKPEGIYSVIDLQAE--PAVVKELDRQMNLNESVLRTKVLRPEMH----------
RS6_CLOAB       AYEIDKVNEGIYVLVNFQSD--AQLPKELDRVFRISDSIIRHLIISLEK-----------
RS6_CLOPE       AYEIAKVNEGYYTLINFTAN--PELPKELDRVFGITDGIIRHIIVKEEQ-----------
RS6_CALS4       AYPIQKKSEGYYVLMNFNSS--PDVSRELERVYRITDGVLRYLIIRTDD-----------
RS6_CHLMU       AYTIRGAREGYYYFIYFTVA--PEAISELWREYHLNEDLLRFMTLKASAVKEVLEFATLP
RS6_CHLTR       AYTIRGAREGYYYFIYFTVA--PEAIAELWREYHLNEDLLRFMTLKASAVKEVLEFATLP
RS6_CHLPN       AYTIRGAREGYYYFIYFSVS--PGAITELWKEYHLNEDLLRFMTLRADSVKEVLEFASLP
RS6_AQUAE       AYPIQKFNNARYFLVQFKTEN-PQLPNELDFQLKIDEDVIRWLNFQIKESEVKKNAQ---
RS6_FUSNN       AYPIDKKKSGFYVLTTFEID--GTKLAEVESKLNIMESVMRYIVVKQD------------
RS6_THEMA       AYEIKKFNEGDYTVIYFRCD--GQNLQELENFYRVTPEIIRWQTFRRFDLEKKERKAQRE
RS6_LISIN       AYEINDYRDGFYHIVKLNA-DKADSINEFDRLAKISDDIVRHMVIKEEA-----------
RS6_LISMO       AYEINDYRDGFYHIVKLNA-DKADSINEFDRLAKISDDIIRHMVIKEEA-----------
RS6_STAAM       AYEINDFKDGFYNIVRVKS-DNNKATDEFQRLAKISDDIIRYMVIREDEDK---------
RS6_BACSU       AYEINDFRDGFYQIVNVQS-D-AAAVQEFDRLAKISDDIIRHIVVKEEE-----------
RS6_STRP1       AYEINDFREGLYHIVNLEA-TDAAALNEFDRLSKINGDILRHMIVKLDA-----------
RS6_STRPN       AYEIQDFREGLYHIVNVEA-NDDAALKEFDRLSKINADILRHMIVKIDA-----------
RS6_LACLA       AYEINDFREGIYHIATFEAETTSEALSEFDRLAKINLDILRHMIVKVEA-----------
RS6_BACHD       AYEINKFREGYYVLLNVKA--DADAIAEFNRLIKINDNVIRVLITKDEE-----------
RS6_DEIRA       AYQVGKDREGYYLMYTIKAS--GNPETAIASSLRLRDNVRRVLVVKDRPEWKTKKA----
RS6_THET8       AYPIAKDPQGYFLWYQVEMP--EDRVNDLARELRIRDNVRRVMVVKSQEPFLANA-----
RS6_MYCGE       AYPIKKQLSAHYYRWSFHGE--SNCTKEFKRAANINKQIIRELIINREKDYGYLGSVNPK
RS6_MYCPN       AYPIKKQLSAHYYRWKFSGD--NQSTKDFKRTANINKQVLRELIINLEREYGYLASINPK
RS6_UREPA       AYEINKLKTAYRYVYNFETTD-VSLINEFRRLAIINKNVLRHIIINLEKDYGYKATVNTK
RS6_BORBU       EYPIKKQARGRYEIIEFSME--GNNLKEFESRLKLIRNLLRYMILVKIVRKINTKKIKRR
RS6_TREPA       AYPLKKQKRGRYLLFIVQCE--PGKVRELDHKLRLRHDLLTHLFVRVDS-----------
RR6_TRICV       SYYINNQKKGNFIQINFSSM--PKYVDNFSKNLKFDSNVLRFLILNK-------------
RS6_MYCPU       AYEINKSKVAQYVLAIVNSQG-KEEINEFVRKANITKTFWRHMIINLTSEKGINKPAKPK
RS6_MYCS5       AYEINKTKHAQYFLVNLETE--RKNIAEFIRLSNINKEIWRHLVVNLDTEKGLNKVFKTH
                 * :     .                  .                               

RR6_GUITH       ------------------------------------------------------------
RR6_PORPU       ------------------------------------------------------------
RS6_NOSS1       A-----------------------------------------------------------
RR6_CYAPA       ------------------------------------------------------------
RS6_SYNY3       VAVEA-------------------------------------------------------
RR6_CYACA       ------------------------------------------------------------
RS6_AGRFC       RD-RDDR-PRRDGDRPDRGPR-------EDRGPRPPREGGFGDRE-DR-PRRPREDRA--
RS6_RHIME       RD-RDDR-PRRDGDRPDRGGF-------GDRGPRPDR----GDRD-DR-PRRPREDRA--
RS6_RHILO       REERSERGSFGDRDRGDRGPRSFGDRDRGDRGDRPPR--SFGDAGGDRGPRRPREGFEGG
RS6_BRUME       RDDRRER----DGD--DRPRR---------REGGFDR----GDRG-DRGPRRPRDNEAGE
RS6_CAUVC       RD-RGDR------------------------------------------PERPREDFGAQ
RS6_RHOCB       RDDRGDR-----EERGDRG----------DRGDRGPR----GDRG-PREDRGPRPERR--
RS6_RICCN       QS--TEN--------------------------------------------TPVIDVTIN
RS6_RICPR       QS--TEN--------------------------------------------TPVIDVTIN
RS6_ECOLI       KDERRER---------------------RD------------DFANETADDAEAGDSEEE
RS6_ECOL6       KDERRER---------------------RD------------DFANETADDAEAGDSEE-
RS6_SALTY       KDERRER---------------------RD------------DFANETADDAEAGDSEE-
RS6_YERPE       KDERRER----------------------H------------DFASEANDDSEAGDSEE-
RS6_HAEIN       KEERK---------------------------------------PLAEVENNDFEDAEE-
RS6_PASMU       KDDRK---------------------------------------ALAEVENNDFEDAEE-
RS6_VIBCH       REER------------------------------------------VKRDEMKFDADVE-
RS6_PSEAE       EESRNER---------------------RER----------RERPNDNAEGADGDDNSDS
RS6_NEIMA       EKAKN--------------------------------------LLSGASEEAVAQ-----
RS6_NEIMB       EKAKN--------------------------------------LLSGASEEAVAQ-----
RS6_NEIGO       EKAKN--------------------------------------LLVGAAEEAAAQ-----
RS6_XANAC       KDEKGDK---------------------PERSERRRRDDEEG--EAPAANDNDGDNAEAA
RS6_XANCP       KDEKGDK---------------------PERSERRRRDDEEGD-AAPAATDTDGDNAEAA
RS6_XYLFA       KDDKGDK---------------------PER--RRRDDDENGDVGVSNDSDNDGGNAEAA
RS6_BUCAI       KDDKK------------------------------------------EKK----------
RS6_RALSO       VQ-RE------------------------------------------EAKKAAAQSEQAA
RS6_HELPY       DRANKKPSHAKEKHEKT------------------------EHTHSHHTEEAESVGSHSE
RS6_HELPJ       DRANKKPSHAKEKHEKT------------------------EHTHSHHAEEAKSTESHSE
RS6_CAMJE       ----EKLSHGIKQSKK--------------------------EIKPLDAPEIQ-------
RS6_MYCLE       ------------------------------------------------------------
RS6_MYCTU       ------------------------------------------------------------
RS6_CORGL       ------------------------------------------------------------
RS6_STRCO       ------------------------------------------------------------
RS6_CLOAB       ------------------------------------------------------------
RS6_CLOPE       ------------------------------------------------------------
RS6_CALS4       ------------------------------------------------------------
RS6_CHLMU       E-----------------------------------------------------------
RS6_CHLTR       E-----------------------------------------------------------
RS6_CHLPN       E-----------------------------------------------------------
RS6_AQUAE       ------------------------------------------------------------
RS6_FUSNN       ------------------------------------------------------------
RS6_THEMA       K-------------------------------------------AAAEATESSEGGSED-
RS6_LISIN       ------------------------------------------------------------
RS6_LISMO       ------------------------------------------------------------
RS6_STAAM       ------------------------------------------------------------
RS6_BACSU       ------------------------------------------------------------
RS6_STRP1       ------------------------------------------------------------
RS6_STRPN       ------------------------------------------------------------
RS6_LACLA       ------------------------------------------------------------
RS6_BACHD       ------------------------------------------------------------
RS6_DEIRA       ------------------------------------------------------------
RS6_THET8       ------------------------------------------------------------
RS6_MYCGE       KQQLSLQKLTKYNEIIASENNPDNPDAPVTSGLASVKPRLSRVEKQKERELEKWTVVHQS
RS6_MYCPN       KQQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQKPKEELWDVVQKM
RS6_UREPA       KVQRNEKRAEVYARQKEE----------AERRAVERQAAYEAMKAEREAAGLPVKEFVKN
RS6_BORBU       NFREFRDNIDKDS--------------------------LKGASKVETPTGPESTDIQEK
RS6_TREPA       ------------------------------------------------------------
RR6_TRICV       ------------------------------------------------------------
RS6_MYCPU       KTFKKTFVARKFS-------------RDDESKTHSTE---EPRRANTKSTYKKSTSFSQD
RS6_MYCS5       RKFGHDFRDQRSHHGQAGEFRKREPQQKSKEQSEFSKEKKSFSKSVTKKTVVSKPKETKE
                                                                            

RR6_GUITH       ----------------------------------------------------
RR6_PORPU       ----------------------------------------------------
RS6_NOSS1       ----------------------------------------------------
RR6_CYAPA       ----------------------------------------------------
RS6_SYNY3       ----------------------------------------------------
RR6_CYACA       ----------------------------------------------------
RS6_AGRFC       ----------------------------------------------------
RS6_RHIME       ----------------------------------------------------
RS6_RHILO       AE--------------------------------------------------
RS6_BRUME       GA--------------------------------------------------
RS6_CAUVC       AQA-------------------------------------------------
RS6_RHOCB       ----------------------------------------------------
RS6_RICCN       N---------------------------------------------------
RS6_RICPR       N---------------------------------------------------
RS6_ECOLI       EEE-------------------------------------------------
RS6_ECOL6       ----------------------------------------------------
RS6_SALTY       ----------------------------------------------------
RS6_YERPE       ----------------------------------------------------
RS6_HAEIN       ----------------------------------------------------
RS6_PASMU       ----------------------------------------------------
RS6_VIBCH       ----------------------------------------------------
RS6_PSEAE       DNADE-----------------------------------------------
RS6_NEIMA       ----------------------------------------------------
RS6_NEIMB       ----------------------------------------------------
RS6_NEIGO       ----------------------------------------------------
RS6_XANAC       ----------------------------------------------------
RS6_XANCP       ----------------------------------------------------
RS6_XYLFA       ----------------------------------------------------
RS6_BUCAI       ----------------------------------------------------
RS6_RALSO       ----------------------------------------------------
RS6_HELPY       ----------------------------------------------------
RS6_HELPJ       ----------------------------------------------------
RS6_CAMJE       ----------------------------------------------------
RS6_MYCLE       ----------------------------------------------------
RS6_MYCTU       ----------------------------------------------------
RS6_CORGL       ----------------------------------------------------
RS6_STRCO       ----------------------------------------------------
RS6_CLOAB       ----------------------------------------------------
RS6_CLOPE       ----------------------------------------------------
RS6_CALS4       ----------------------------------------------------
RS6_CHLMU       ----------------------------------------------------
RS6_CHLTR       ----------------------------------------------------
RS6_CHLPN       ----------------------------------------------------
RS6_AQUAE       ----------------------------------------------------
RS6_FUSNN       ----------------------------------------------------
RS6_THEMA       ----------------------------------------------------
RS6_LISIN       ----------------------------------------------------
RS6_LISMO       ----------------------------------------------------
RS6_STAAM       ----------------------------------------------------
RS6_BACSU       ----------------------------------------------------
RS6_STRP1       ----------------------------------------------------
RS6_STRPN       ----------------------------------------------------
RS6_LACLA       ----------------------------------------------------
RS6_BACHD       ----------------------------------------------------
RS6_DEIRA       ----------------------------------------------------
RS6_THET8       ----------------------------------------------------
RS6_MYCGE       GNFDTVQINPYRPRIKRFLQN--NQQTSQANNNQPRFQNQFKKGAKP-----
RS6_MYCPN       GNFDSVQANPYRPRFKRFNAEHVNQRQNQQNNNNNRFDRNRNRQHNRFKDKQ
RS6_UREPA       TNSKR-----------------------------------------------
RS6_BORBU       ----------------------------------------------------
RS6_TREPA       ----------------------------------------------------
RR6_TRICV       ----------------------------------------------------
RS6_MYCPU       NKNKK-----------------------------------------------
RS6_MYCS5       EK--------------------------------------------------