CLUSTAL format seed alignment for MF_00362

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL10_BUCBP      ------------------MMLDFKKKKELVTQINLIAKTALSIVVANPQGIKSNDITQLR
RL10_BUCAI      ------------------MALSIHDKKIIVSKINKISNTALSAVTADLQGVCVNKINELR
RL10_WIGBR      -------------------MLNRKNKENIISKINKITKSSLSILIVDPTGITSNQMNNLR
RL10_ECOLI      ------------------MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELR
RL10_SALTY      ------------------MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELR
RL10_YERPE      ------------------MALNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELR
RL10_HAEIN      ------------------MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVEKMTELR
RL10_PASMU      ------------------MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELR
RL10_VIBCH      ------------------MALNLQDKKAIVAEVNEAASGALSAVVADSRGVQVAAMTNLR
RL10_PSEAE      ------------------MAIKLEDKKAIVAEVNEAAKAALSAVVADARGVTVGAMTGLR
RL10_NEIMA      ------------------MSLNIETKKVAVEEISAAIANAQTLVVAEYRGISVSSMTELR
RL10_RALSO      ------------------MALNLEDKKAVVAEVTAQVAKASTIVVAEYRGITVGDLTKLR
RL10_XYLFA      ------------------MALNIFQKQEVVEELAGVATKAHSLIVAEYAGITVSQMTAMR
RL10_MYCPU      ---------------MHIESKNRQIKKDIVVEITKKINDSQSLFLAEYRGLTVAKLLNLR
RL10_BACHD      -------------------MSVLEQKKQIVTEIATKLKESQSTVVVDYRGLNVAEVTELR
RL10_BACSU      ------------------MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELR
RL10_LISMO      ------------------MSKVLEAKQSAVEEIKTKLSASASTVIVDYRGLNVGEITDLR
RL10_STAAM      ------------------MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLR
RL10_STRPN      -----------------MSEAIIAKKAELVDVVAEKMKAAASIVVVDARGLTVEQDTVLR
RL10_STRP1      -----------------MSEAIIAKKAEQVELIAEKMKAAASIVIVDSRGLTVDQDTVLR
RL10_LACLA      ------------MSDYKVNEATIAKKAELVDVYAQKMTEAASIVVADSRGLSVDQDTQLR
RL10_CLOAB      -----------------MVNKNRQLKEQKVAEIKEKMGKTEAMIMVKYQGLNVEEDTELR
RL10_CLOPE      ---------------MDTVNKNRQLKEAKVAEIKEKLEKAQSVVLASYQGLTVEQDTNLR
RL10_NOSS1      ------------------MGRTLENKKEIVADLKETLGESTLALVIEYQGLTVAEITDLR
RL10_SYNY3      ------------------MGRTRENKATVISDVQELFQDAQMTVIIDYQGLTVAEITDLR
RL10_BRUME      --------------------MDRAEKREFVAWLNGAFKESGSVVVAHYTGLTVAQMSDLR
RL10_RHILO      --------------------MDRAEKRELVTGLNEAFGNAGSVVVAHYAGITVAQMNDLR
RL10_RHIME      --------------------MERAEKREFVTELNEVFKASGSVVVAHYAGVTVAQMNDFR
RL10_CAUVC      --------------------MDRAQKQESIESLKSVFADAGAVVVTHYMGLTVAEMTDLR
RL10_RICCN      --------------------MLRSEKPVAVEDIVNIYKESPSIIITHYHGLTVSQVSSLR
RL10_RICPR      --------------------MLRSEKPVAVEDIVNIYKESPSVIITHYHGLTVSQVSSLR
RL10_LIBAC      --------------------MNRQEKSVEISELSKILSSSGSVVVAHYKGISVAQIRTSK
RL10_LIBAF      --------------------MNRQEKSVEISELSKIFSSSGSVVVAHYKGISVAQIKDLR
RL10_LIBAS      --------------------MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLR
RL10_MYCLE      --------------------MARADKATAVANIAEQFKAATAALITEYRGLTVANLAELR
RL10_MYCTU      --------------------MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELR
RL10_STRAT      --------------------MARPDKAAAVAELTDKFRSSNAAVLTEYRGLTVAQLKTLR
RL10_STRCO      --------------------MATPEKAAAVAELTDKFRSSNAAVLTEYRGLTVAQLKTLR
RL10_STRGR      --------------------MARPDKAAAVAELTDQFRSSNAAVLTEYRGLTVAQLKELR
RL10_STRVG      --------------------MPTPNKAASVAELKDAFQSSNAAVLTEYRGLTVAQLKTLR
RL10_HELPY      ----------------MQKQHQRQHKVELVANLKSQFADAKALLICDYKGLSVRKLEALR
RL10_HELPJ      ----------------MQKQHQRQHKVELVANLKSQFDSAKALLICDYKGLSVKKLEALR
RL10_CAMJE      --------------------MTRSEKVEIIAKLEEGFKASEAIVVCNYRGLSTKKLEELR
RL10_CHLMU      ---------------------MKEEKKLLLREVEEKITASQGFILLRYLGFTAAHSRSFR
RL10_CHLTR      ---------------------MKEEKKLLLREVEEKITASQGFILLRYLGFTAAHSRSFR
RL10_CHLPN      ---------------------MKQEKTLLLQEVEDKISAAQGFILLRYLRFTAAYSREFR
RL10_MYCGE      ------------------MVDSKKNKKQQVTDFSNLLSQSKGFVIFDYSGMSAVDATLMR
RL10_MYCPN      -------------------MEAKKDKAQQVADVSHLLSTSAGFVIFDYTSMSAIEATSIR
RL10_UREPA      ---------------MANVRPSVVFKQQEVNHMADILKNSKSFIVFEYHGLTAANILALR
RL10_BORBU      -----------------MSAKINAKKLEMFDLLKQFIDSKQNLFFLDYRGLNVAQLTELR
RL10_TREPA      --------------MAVRARRLQPAKVAAVESLTRDLGEASSYIFTEYRGLTVEQLTALR
RL10_AQUAE      MAEFDKEAYAERERSAASRKTLLKKQELVNSYKERLQKSNGFVIFFNFQGIDAYPLTLLR
RL10_AQUPY      MAEFNREAYSERERSAASMKTLLRKQELVNSYKERLQRSNGFVVFFNFQGIDAYPLTLLR
RL10_THEMA      -------------------MLTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELR
RL10_DEIRA      --------------------MANEKNQQTLGSLKDSLQGIETFYVVDYQGLTAGQLTQLR
                                         :                        .        :

RL10_BUCBP      KLARKSNVK---LGVYRNTLLNLGIKNTP-FECLKNILIGPTLIAYSSEHPGSAAKLLKN
RL10_BUCAI      KSGREVGVK---MSIVQNTLLSLAIKNTV-FECLKKKLKGSTFIAYSMIHPGSGARLFKE
RL10_WIGBR      KSSRKLNVN---IKQVRNTLMRFAIVDTE-FDCLEKYIKGSNLIAFSHSHPGSAARIFKN
RL10_ECOLI      KAGREAGVY---MRVVRNTLLRRAVEGTP-FECLKDAFVGPTLIAYSMEHPGAAARLFKE
RL10_SALTY      KAGREAGVY---MRVVRNTLLRRVVEGTQ-FECLKDTFVGPTLIAYSMEHPGAAARLFKE
RL10_YERPE      RAGREAGVH---MQVVRNTLLRRIVEGTP-FECLKDTFVGPTLIAFSAEHPGAAARLFKA
RL10_HAEIN      KSAREAGVT---MRVVRNTLLRRAVEGTD-YECLKDTFVGPTLIAFSNEHPGARARLFKE
RL10_PASMU      KVARENGVS---MRVVRNTLLRRAVEGTE-FECLKDTFVGPTLIAFSTEHPGAAARLFKD
RL10_VIBCH      KQAREAGVY---LKVVRNTLARRAVEGTA-YECLKDVFVGPTLIGFSNEHPGAAARLFKD
RL10_PSEAE      KEAREAGVY---VKVVRNTLLKRAVEGTQ-FDVLNDVFKGPTLIAFSNEHPGAAARIFRE
RL10_NEIMA      ANARKEGVY---LRVLKNTLARRAVQGTS-FAELADQMVGPLVYAAS-EDAVAAAKVLHQ
RL10_RALSO      AQARQQGVY---LRVLKNTLARRAVEGTP-FAELAEQMTGPLIYGIS-EDAVAPAKVLND
RL10_XYLFA      KQARESGVY---LKVVKNKLAARALGDTE-YAVIKEKLIGPLLYAFSLEDPGAAGRLIKE
RL10_MYCPU      KEAKKHNVE---IKVYKNRLVKLATQKLG-HSDLDKFLVGPNLFVFSNELGMDGAKVLAE
RL10_BACHD      KQLREAGCE---FKVYKNTMTRRAAEVAE-LTELNDVLVGPTAIAFHNEDAIAPAKIINS
RL10_BACSU      KQLREANVE---FKVYKNTMTRRAVEQAE-LNGLNDFLTGPNAIAFSTEDVVAPAKVLND
RL10_LISMO      KQLRDAGIE---FKVYKNSLTRRAVEANG-YEGLEGALTGPNAIAFSNEDVVAPAKILND
RL10_STAAM      SQLREAGVE---YKVYKNTMVRRAAEKAG-IEGLDEFLTGPTAIATSSEDAVAAAKVISG
RL10_STRPN      RELRGSEVE---YKVIKNSILRRAAEKAG-LEDLASVFVGPSAVAFSNEDVIAPAKILND
RL10_STRP1      RSLRESGVE---FKVIKNSILTRAAEKAG-LDELKDVFVGPSAVAFSNEDVIAPAKVIND
RL10_LACLA      KQLREAGVE---FKVVKNSVLRRAAEKAG-LEGLSEAFSGPSAVAFSNEDVVAPAKVLAD
RL10_CLOAB      KALREAGVE---YRVYKNSLAVRAINELG-YEGIAQYLEGPIAIAMSYDDPTAPARIIND
RL10_CLOPE      KSLREAGVE---YKVYKNTLVTLAAKELG-FDGIVEYLEGPVSIAFGYEDATAPARILND
RL10_NOSS1      KRLRPSGTV---CKVTKNTLMGIAIQDDEKWQPLSELLKGSSAFLLVKEDFSSAIKAYQE
RL10_SYNY3      NRLRPLGGT---CKIAKNTLVRRALAGQEAWSPMEEFLTGTTAILVLKEDLGGAIKAYKK
RL10_BRUME      SKMRDAGGS---VKVAKNRLAKIALQGTE-SEGIADLFTGQ-TVVAYANDPITAPKVAVE
RL10_RHILO      SKMRAAGGT---VKVAKNRLAKIALQGTD-SASIIDLFKGQ-TLIAYSEDPIAAPKVASD
RL10_RHIME      SKMRAAGGT---VRVAKNRLAKIALQGTE-SEGMTDLFKGQ-TLIAFSEDPVTAPKVVMD
RL10_CAUVC      LRLRKEGAA---IKVVKNTLALKALDGKL-GDKGDKLFTGP-VAIAYGPDAVSAAKIAVQ
RL10_RICCN      ESLKSKEAG---FKVVKNTLAKIAANQTG-LNSIVNLFAGP-TAIVYSKEPVEMAKLVVN
RL10_RICPR      EELKSKEAG---FKVVKNTLAKIAAKQTG-LDSITNLFAGP-TAIVYSKEPVEMARLVVN
RL10_LIBAC      EGXREAGGG---VKVXXNRLVKIAVRDTS-VKEVSDLFVGQ-SLIVYSVDPIVAPKISVN
RL10_LIBAF      KKVREAGGG---VKVAKNRLVKIAVSDTS-LKGVSDLFVGQ-SLIVYSVDPIVAPKISVS
RL10_LIBAS      KKMREAGGG---VKVAKNRLVKIAIRDTS-IRGISDLFVGQ-SLIVYSDSPVIAPKISVS
RL10_MYCLE      RSL-TGSAS---YAVAKNTLIKRAASEVG-IEGLDELFAGPTAIAFVTGEPVDAAKAIKT
RL10_MYCTU      RSL-TGSAT---YAVAKNTLIKRAASEAG-IEGLDELFVGPTAIAFVTGEPVDAAKAIKT
RL10_STRAT      RSL-GENAQ---YAVVKNTLTKIAAKEAG-ITLEDQLFAGPTAVAFVTGDPVESAKGLRD
RL10_STRCO      RSL-GENAQ---YAVVKNTLTKIAANEAG-ITLDDQLFAGPTAVAFVTGDPVESAKGLRD
RL10_STRGR      RSL-GENAQ---YAVVKNTLTKIAANEAG-IDTLDDLFSGPTAVAFVTGDPVESAKGLRD
RL10_STRVG      RSL-GENAQ---YAVVKNTLTKIAANQAG-ITALDEHFAGPTAVAFITGDPVESAKSLRD
RL10_HELPY      NKARNQGIK---VQVIKNTLAHIAMKET---GYSDLDLKETNVFLWGGDQIALSKLVFDF
RL10_HELPJ      NKARIQGIK---VQVIKNTLAHIAMKEV---GCADLDLKETNVFLWGDDQIALSKLVFDF
RL10_CAMJE      NNARENNVK---VQIVKNTLANIALNNS---GKTGLVLKDTNIYLWGEDQLSVSKVAAKF
RL10_CHLMU      NNLSGVSAE---FEVLKKKIFFKALESSGVEMDPEDSEGHLGVVFAYGDPVSAAKQVLDF
RL10_CHLTR      NNLSGVSAE---FEVLKKKIFFKALETSGVEMDPEGGEGHLGVVFAYGDPVSAAKQVLDF
RL10_CHLPN      NSLSGVSAE---FEVLKKRIFFKAIEAAGLEVDCSDTDGHLGVVFSCGDPVSAAKQVLDF
RL10_MYCGE      KKLFNKGSK---IKIVKNNILRRALKTSNFEGVDESVIKGKIAVAVGINEILETLKVVDS
RL10_MYCPN      KKLFKNGSK---IKVIKNNILRRALKAGKFEGIDETAIKGKLAVAVGVNEIVETLKAVDG
RL10_UREPA      NVLHSSNSK---LYVLKNNITARAFEKAGVSGF-ENQLTGPNAVAVAMDDEIAAIKAVND
RL10_BORBU      NKIEGEHGS---LKVVKNNIMKMVLKEKN-INVVDSCLVGPTVVVTALEEANVIAKIFYD
RL10_TREPA      RALREFSCV---YRVVRNNFANIAFTSLN-MTVGEYLVGPTAIALVDTEHANGVARVLFD
RL10_AQUAE      LDIKDLKGE---IVVGKNTLFYRAFSDTVLSDHRDIFVGPTAALFAYE-DPVAVTKKLVE
RL10_AQUPY      LDIKDLKGE---IVVGKNTLFYRAFSDTALSDHRDIFIGPTAALFAYE-DPVAVTKKLVE
RL10_THEMA      SRLREKYGDGARFRVVKNTLLNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYN
RL10_DEIRA      KDIREKGGQ---LIVAKNTLLNLALQEGG--RDFDDALKGPSALVLAQEDPAGVAKALSD
                                 : .                                        

RL10_BUCBP      FSMSQSSNPNFKILGAVF-EGKAISGSNINSLADIPTFNEALRRFIIIAKEISAGKLLRI
RL10_BUCAI      FSKK---NTQFKITGAAF-EGKLLSILEINQLADMPTYKEAIIKLLLTWKMLIAGKLIYT
RL10_WIGBR      FTKE---NNKIKIKLAVF-ERKIITDSNIDYLANLPTHEESVINFINIIQEASIKKLIRI
RL10_ECOLI      FAKA---NAKFEVKAAAF-EGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRT
RL10_SALTY      FAKA---NAKFEVKAAAF-EGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRT
RL10_YERPE      FAKD---NAKFEVKAAAF-EGELIPAAQIDRLATLPTYEEAIARLMGTMKEAAAGKLVRT
RL10_HAEIN      FAKA---NDKFEIKGAAF-EGKI---QDVEFLATLPTYEEAIARLMGTMKEAAAGKLART
RL10_PASMU      FAKA---NDKFEIKGAAF-EGKI---QDVEFLATLPTYDEAIARLMGTMKEAAAGKLVRT
RL10_VIBCH      FAKE---NKAFEIKAAAF-EGVL---TDPEVLATLPTYDEAIARLMMCMKEASAGKLVRT
RL10_PSEAE      FAKG---QDKFEIKAAAF-EGQFLAANQIDVLASLPTYDEAVSQLMSVIQGATS-KLART
RL10_NEIMA      FAKK---DDKIVVKAGSY-NGEVMNAAQVAELASIPSREELLSKLLFVMQAPVSGFARGL
RL10_RALSO      FAKG---NDKLVLRAGSY-EGKVLDAAGVKALASIPSREELLSKLLFVMQAPVSGFARAL
RL10_XYLFA      FSKK---HDKLKSKTVSL-GGVLYPAGHVDVLASLPTRLQALAMLARVLSEPVTLFARAI
RL10_MYCPU      FAKK---NKKLVLKAGIF-DGKVVDAAGVKAVAELPTYEEALTILASSLLGPLRQISLSF
RL10_BACHD      FAKE---HEALEIKAGVI-EGNVASVEEVKALAELPSREGLLSMLLSVLQAPVRNFALAT
RL10_BACSU      FAKN---HEALEIKAGVI-EGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALAA
RL10_LISMO      FAKD---HEALEIKAGVI-EGKVASLEEIKALATLPSREGLLSMLCNVLQAPVRGLAIAT
RL10_STAAM      FAKD---HEALEIKSGVM-EGNVITAEEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAV
RL10_STRPN      FSKN---AEALEIKGGAI-EGAVASKEEILALATLPNREGLLSMLLSVLQAPVRNVALAV
RL10_STRP1      FTKT---ADALEIKGGAI-EGAVSSKEEIQALATLPNREGMLSMLLSVLQAPVRNVAYAV
RL10_LACLA      FAKD---AENLEIKAGVI-EGKVSSKEEIQAIASLPSRDGLLSMLLSVLQAPVRNVALAV
RL10_CLOAB      FAKT---HKALELVAGYV-QGEVFDVNKVKELASVPAKEVLIAKLLGSFKAPLSNFAYLL
RL10_CLOPE      FAKE---NKKLELKAAIV-EGTVYNKEQTEQLAAIPSREVLLAKLLGSIKSPLSNFAYLL
RL10_NOSS1      FQKV---TKKTELRGGVMEGRL-LKEPDVKALGDLPSKEQLMGQIAGAINALATKIAVGI
RL10_SYNY3      FQKD---TKKTELRGGVLEGKS-LTQADVEAIGDLPSKEQLMGQIAGGINALATKIALGI
RL10_BRUME      FAKA---NDKLVILGGAMGATT-LNADGVKSLASLPSLDELRAKLVGMIQTPAQRLAVLT
RL10_RHILO      FAKG---NDKLVILGGAMGTTS-LNADGVKALATLPSLDELRAKLVGMIATPATRIAQIV
RL10_RHIME      FAKT---NDKLVVLGGAMGATT-LNAEGVKSLATLPSLDELRAKLLGLINAPATRVATVV
RL10_CAUVC      FAKE---NDKLKIVGGVLDQTNVLDEAGVRALATLPSLDELRGKLIGLIQAPATKIAGVL
RL10_RICCN      FAKA---NDNLKIIGGIVDNHV-LDEHSIKELSKLPTLNELRGKIVGLLQAPATKVVGVL
RL10_RICPR      FANS---NDNLKIIGGIVDNHI-LDAYSIKELSKLPSLHELRGKIVGLLQAPATKVVGVL
RL10_LIBAC      FAND---NKQFVVLGGVLENDV-LDQCSIKQIASLPNIDGIRAIIISAIQFNATKLLRLL
RL10_LIBAF      FAND---NKQFVVLGGILEKDI-LDQDSIKRIASLPNIDGIRSMIISAIQFNSTRLVNLL
RL10_LIBAS      FSND---NNEFRVLGGVVEKGV-LNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLL
RL10_MYCLE      FAKE---HKALVIKGGYMDGHP-MTVAEVERIADLESREVLLAKLAGAMKGTFAKAIGLF
RL10_MYCTU      FAKE---HKALVIKGGYMDGHP-LTVAEVERIADLESREVLLAKLAGAMKGNLAKAAGLF
RL10_STRAT      FAKE---NPNLVIKGGVLDGKA-LSADEIKKLADLESREVLLSKLAGAFKAKQSQAASVF
RL10_STRCO      FAKD---NPNLVIKGGVLDGKA-MSADEIKKLADLESREVLLSKLAGAFKGKQSQTAQLF
RL10_STRGR      FAKD---NPNLIIKGGVLDGKA-LSADEIKKLADLESREVLLSKLAGAFKGKQTQAAQVF
RL10_STRVG      FAKD---NPNLIIKAGVLDGKA-LTADEIKKLADLESREVLLSKLAGAFKGKQSQAASLF
RL10_HELPY      QKEHK---DHFVLKAGLF-DKESVSVAHVEAVSKLPSKEELMGMLLSVWTAPARYFVTGL
RL10_HELPJ      QKEHK---DHFVLKAGLF-DKESVSVAHVEAVSKLPSKEELMGMLLSVWTAPARYFVTGL
RL10_CAMJE      E-ENN---DKFEIKTAHI-EGEVADVAKVKALAKMPSRNELLAMLLQVWNAPITNFTIGL
RL10_CHLMU      NKQHN---DSLVFLAGRI-DNASLSGKEVEAVAKLPSMKELRQQVVGLIAAPMSQVVGIM
RL10_CHLTR      NKQHN---DSLVFLAGRI-DNASLSGREVEAVAKLPSMKELRQQVVGLIAAPMSQVAGIM
RL10_CHLPN      NKQHK---DSLVFLAGRM-DNASLSGAEVEAVAKLPSLKELRQQVVGLFAAPMSQVVGIM
RL10_MYCGE      VVKEK---ELMKFVCGHF-DNRIFNSDDLQKIAKLPGRNELYGMFLSVLQAPLRKFLYAL
RL10_MYCPN      VVKAK---EAMNFVCGYF-DNRAFNSADLEKIAKLPGRNELYGMFLSVLQAPLRKFLYAL
RL10_UREPA      VAKEF---DFVKIKGAYL-ENKFADTHKIDQLAAIPGREGLYSMLLSCFTAPLRNVMYGL
RL10_BORBU      FVKS----STLKVKGGFV-LGEFYDEAKVQAYSKLPTKKESISLFASVLKAPVSKLARTL
RL10_TREPA      FAKEV---PALVVKGAIL-DGEVFDASKVEAYSKLPGKKELVSMFLSALNATTVKFVRVL
RL10_AQUAE      FLKETFDKEWEGRIKGGLLDYKYITPEQVKELAELPSKEELIAKLLGVLMAPVTQLAMTL
RL10_AQUPY      FLKETFDKEWEGRIKGGLLDYKYISPEQVKELAELPSKEELIAKLLGVMMAPVTQLAMTL
RL10_THEMA      FYKDK--KADLSRLKGGFLEGKKFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFAL
RL10_DEIRA      AAGRN--DRGIPTVKGGFVEGSKVDVAVVQRLASLGSKTTLQAELVGVLSAHLSNFVGIL
                                                . :         .               

RL10_BUCBP      LVSIKNI--------KENS----------------
RL10_BUCAI      LSAIKQK--------KETS----------------
RL10_WIGBR      LILINNN--------K-------------------
RL10_ECOLI      LAAVRDA--------KEAA----------------
RL10_SALTY      LAAVRDA--------KEAA----------------
RL10_YERPE      LAALRDQ--------KEAA----------------
RL10_HAEIN      FAALRDKL-------QEAA----------------
RL10_PASMU      LAALRDKL-------QEAA----------------
RL10_VIBCH      IAAVRDQ--------KEAA----------------
RL10_PSEAE      LAAIRDQ--------KEAAAA--------------
RL10_NEIMA      AALAEKKA------GEEAA----------------
RL10_RALSO      AALAEKKQ------SEEGAAA--------------
RL10_XYLFA      KAVADDKSETVAVSAPEASQA--------------
RL10_MYCPU      KLLVDEN--------KLSN----------------
RL10_BACHD      KAVADQK--------EEQGA---------------
RL10_BACSU      KAVAEQK--------EEQGA---------------
RL10_LISMO      KAVADQK--------EGQEA---------------
RL10_STAAM      KAIGEQK--------EENAE---------------
RL10_STRPN      KAVAESK--------EDAA----------------
RL10_STRP1      KAVAENK--------EGAA----------------
RL10_LACLA      KAVAEKE--------ESAA----------------
RL10_CLOAB      SAIKDKK--------EAEEQA--------------
RL10_CLOPE      SAIADKK--------EESAE---------------
RL10_NOSS1      NEVPGGLARALQAVADKENGGDDSAA---------
RL10_SYNY3      KEVPASVARGLQAHVDKE-----------------
RL10_BRUME      SAPAGQIARVIGAHARKNEAA--------------
RL10_RHILO      NAPAASVARVIGAYARKDEAA--------------
RL10_RHIME      AAPASQLARVFSAYAKKDEAA--------------
RL10_CAUVC      QAPAAQLARVFNAYATKDAA---------------
RL10_RICCN      QAPSSSMARVIQAHASKN-----------------
RL10_RICPR      QATSSSIARVIHAHAIKH-----------------
RL10_LIBAC      SAPQAQVVRALSAFVDKNKQS--------------
RL10_LIBAF      NAPQTKIVRAISAFVDKNQQS--------------
RL10_LIBAS      GTPQTQVVRAISAFVDKNQQG--------------
RL10_MYCLE      NAPTSQMARLTAALQEKKAFE-PASAE--------
RL10_MYCTU      NAPASQLARLAAALQEKKACPGPDSAE--------
RL10_STRAT      QALPSKLVRTVDALRAKQAEQGGAE----------
RL10_STRCO      QALPSKLVRTVDALRAKQDEQGGAE----------
RL10_STRGR      QALPSKFVRTAEALRAKKEEQGGAGTPAPAEAAE-
RL10_STRVG      QALPSKFVRTAKRFASSSPSRAVPSNSARALIHAA
RL10_HELPY      DNLRKAKEEN-------------------------
RL10_HELPJ      DNLRKAKEEN-------------------------
RL10_CAMJE      NALKNKKESE-------------------------
RL10_CHLMU      NSVLSGVISCVDQKAEKTQE---------------
RL10_CHLTR      NSVLSGVISCVDQKAEKTQE---------------
RL10_CHLPN      NSVLSGVISCVDQKAGKN-----------------
RL10_MYCGE      QAVRNAK----------------------------
RL10_MYCPN      EAVKAAK----------------------------
RL10_UREPA      KAVAEQKGE--------------------------
RL10_BORBU      KALADVKN---------------------------
RL10_TREPA      QAVMDKRDEGVEVSVVSGGDSS-------------
RL10_AQUAE      KAVPQKLVLVLKAIEEEKSKGGQ------------
RL10_AQUPY      KAVPQKLVLVLKAIEEEKSKGGQ------------
RL10_THEMA      SGILRNLVYVLNAIKEKKSE---------------
RL10_DEIRA      EAYREKLE------GEGGSESA-------------